Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR013C (SEC59)51951023380.0
Scas_709.555195177671e-95
CAGL0M07700g4874097101e-87
ABR051C4844096979e-86
Kwal_26.81645004036981e-85
Sklu_2168.25004036631e-80
KLLA0D11198g5154205892e-69
CAGL0I09812g28148840.025
Sklu_2266.528539750.33
AGR037C58934711.2
YNL237W (YTP1)45958657.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR013C
         (510 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   905   0.0  
Scas_709.55                                                           300   1e-95
CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   278   1e-87
ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   273   9e-86
Kwal_26.8164                                                          273   1e-85
Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        259   1e-80
KLLA0D11198g complement(954239..955786) some similarities with s...   231   2e-69
CAGL0I09812g complement(936925..937770) highly similar to tr|Q12...    37   0.025
Sklu_2266.5 YOR311C, Contig c2266 9409-10266                           33   0.33 
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...    32   1.2  
YNL237W (YTP1) [4370] chr14 (205187..206566) Protein with simila...    30   7.2  

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/510 (89%), Positives = 455/510 (89%)

Query: 1   MVAIIPHASFTTIKLTQKTEGSQMPTEEICKINMRTRKFDVGGNSRDFECFYSNFVQTVI 60
           MVAIIPHASFTTIKLTQKTEGSQMPTEEICKINMRTRKFDVGGNSRDFECFYSNFVQTVI
Sbjct: 1   MVAIIPHASFTTIKLTQKTEGSQMPTEEICKINMRTRKFDVGGNSRDFECFYSNFVQTVI 60

Query: 61  LLGTFFYCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKYWQHGYKSLPKFDTI 120
           LLGTFFYCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKYWQHGYKSLPKFDTI
Sbjct: 61  LLGTFFYCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKYWQHGYKSLPKFDTI 120

Query: 121 YSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXFFNFEAGDRXXX 180
           YSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRT            FFNFEAGDR   
Sbjct: 121 YSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTQLVVIILQLCLIFFNFEAGDRLKN 180

Query: 181 XXXXXXXXXXXXXXXYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRILKGIILALT 240
                          YIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRILKGIILALT
Sbjct: 181 IISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRILKGIILALT 240

Query: 241 TIISINYVLKKVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPLLWLVKYILESTIRQK 300
           TIISINYVLKKVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPLLWLVKYILESTIRQK
Sbjct: 241 TIISINYVLKKVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPLLWLVKYILESTIRQK 300

Query: 301 ILFAWXXXXXXXXXXXXXEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFVKIALSGTIP 360
           ILFAW             EKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFVKIALSGTIP
Sbjct: 301 ILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFVKIALSGTIP 360

Query: 361 VFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLLMNNSPMG 420
           VFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLLMNNSPMG
Sbjct: 361 VFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLLMNNSPMG 420

Query: 421 LIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLRFDKAAIFNHXX 480
           LIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLRFDKAAIFNH  
Sbjct: 421 LIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLRFDKAAIFNHLT 480

Query: 481 XXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
                     SGVLEGNSVLNDNILIPAFM
Sbjct: 481 TLQLLTLCTLSGVLEGNSVLNDNILIPAFM 510

>Scas_709.55
          Length = 519

 Score =  300 bits (767), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 208/517 (40%), Positives = 284/517 (54%), Gaps = 33/517 (6%)

Query: 11  TTIKLTQKTEGSQMPTEEICKINMRTRKFDVGGNSRDFECFYSN----FVQTVILLGTFF 66
           +T  +    + SQ+  EE  +  + T   D   N R  E  +S+     +Q  IL  + F
Sbjct: 10  STHAIRSSKDMSQIQEEEKKRKEVDT---DPVLNDRWLEDIFSSVPEKLIQIFILASSVF 66

Query: 67  YCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKYWQHGYKSLPKFDTIYSLYLP 126
            C +  Q  ++   D S   IF N   V  +++  +  K       +LP+F+ +Y L+LP
Sbjct: 67  LCYK--QYGAVDDDDFS---IFKNEARVAGMLLSFLLRKCNDRDANTLPQFEIVYLLFLP 121

Query: 127 FMVSLLFDTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXFFNFEA---GDRXXXXXX 183
           FM S LF    T+ N+IL L+ L+   +              F  F A    +       
Sbjct: 122 FMTSFLFKKELTIFNSILALNALDIPLYEKIPMQAL------FIGFSAESDAELWEYGYG 175

Query: 184 XXXXXXXXXXXXYIGQLKSLDNIDSNLFSILLTNILYV--SEAGTVHFRILKGIILALTT 241
                        IGQLKSLD ID NLFSI+LTN+LY+   E  ++ F+IL+G ++A   
Sbjct: 176 MLLNFSICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFV 235

Query: 242 IISINYV-------LKKVMHFKPFMLSISFAIGLPLFANTFIHLED-GENPLLWLVKYIL 293
            ++INY+       +KK  H K   L   F I  P+  +  I LE   E P +WL++Y+L
Sbjct: 236 TVAINYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVL 295

Query: 294 ESTIRQKILFAWXXXXXXXXXXXXXEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFVKI 353
            S+ R+ IL  W              K + SLNTSRK+WHF+I LLI   FQMD  FVKI
Sbjct: 296 GSSARKSILLVWLSFLLILIPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKI 355

Query: 354 ALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLL 413
           ALSGTI +FLS+EY+RF  L P G+ I+ +LR FAD RD  GP+IISY+YL+ GISTPLL
Sbjct: 356 ALSGTIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPIIISYIYLIIGISTPLL 415

Query: 414 MNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLRFDKA 473
           +N+SP+GLI LG+GDSLASIIG ++GR  W GT+KT+EGTL+FI+ + IV  +L  +   
Sbjct: 416 INDSPVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYY--M 473

Query: 474 AIFNHXXXXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
             F              SG+LEGNS LNDNILIP +M
Sbjct: 474 EYFADITFSNLLWVCTISGILEGNSELNDNILIPTYM 510

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  278 bits (710), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 231/409 (56%), Gaps = 25/409 (6%)

Query: 117 FDTIYSLYLPFMVSLLF-DTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXFFNFEAG 175
           FD  Y +YLPF+VS  F D + T +N I+  + +    +                 F+AG
Sbjct: 79  FDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLI--------FQAG 130

Query: 176 ---------DRXXXXXXXXXXXXXXXXXXYIGQLKSLDNIDSNLFSILLTNILYVSEAGT 226
                    D                    IGQLK+LD ID NLF ILLT+ L ++ A  
Sbjct: 131 LMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATA 190

Query: 227 VHFR-ILKGIILALTTIISINYVLKKVMHF--KPFMLSISFAIGLPLFANTFIHLEDGE- 282
            ++  +LKG + ++  II +N+ L +++       +L+ +F +  P+  N  I   + + 
Sbjct: 191 PNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEKI 250

Query: 283 -NPLLWLVKYILESTIRQKILFAWXXXXXXXXXXXXXEKDSLSLNTSRKLWHFIIFLLII 341
            +P LWL+ +ILES IRQ I+ +W              K  +SLNTSRK+WHF+IFLLI+
Sbjct: 251 TSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLLIV 310

Query: 342 PSFQMDSNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISY 401
             F +D  FVKI+L G IP FLS+EY+R+  + P G  ++  LR FAD RD  GPLI+SY
Sbjct: 311 EPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSY 370

Query: 402 LYLLFGISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSF 461
           +YL+ GI+ PLL+  SP+GL+ LG+GDSLASI+GK+ GR+ WKGT KT+EGT+AFIV + 
Sbjct: 371 IYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTT 430

Query: 462 IVCLVLLRFDKAAIFNHXXXXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
            +  +L R+     F+              GVLEGNS LNDNILIP FM
Sbjct: 431 FISWILQRYFNY--FSTIDIFKILVICTTGGVLEGNSELNDNILIPLFM 477

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  273 bits (697), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 160/409 (39%), Positives = 220/409 (53%), Gaps = 22/409 (5%)

Query: 114 LPKFDTIYSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXFFNFE 173
           +P F+ +Y +YLP MVSLLF      +N  + L  +                   +    
Sbjct: 76  VPAFNAVYVVYLPVMVSLLFRRELVPVNCAMALGGMQ----MPVVLRVLQQLTILYLQPA 131

Query: 174 AGDRXXXXXXXXXXXXXXXXXXYIG--QLKSLDNIDSNLFSILLTNILYV-SEAGTVHFR 230
           A  R                  + G  +L+SLD +D  L SILLTN+L+V     +V F+
Sbjct: 132 ARGRGFPGRGGVGGAPGGVVGRWRGWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQ 191

Query: 231 ILKGIILALTTIISINYVL-----KKVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPL 285
           IL+  +      +  NYV      ++  + +  +L   FA+  P     F+ L+D +N L
Sbjct: 192 ILRACLYGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTDNAL 251

Query: 286 LWLVKYILESTIRQKILFAWXXXXXXXXXXXXXEKDSLSLNTSRKLWHFIIFLLIIPSFQ 345
           +WL+KYI  S +R +I+  W              K  LSLNTSRK+WHF +  L++    
Sbjct: 252 VWLIKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMA 311

Query: 346 MDSNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLL 405
           ++  F  +A++GT+ VFL +EY R+ NL P G  I  QLR F D RD  GP+I+SYLYL+
Sbjct: 312 VEPEFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLI 371

Query: 406 FGISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCL 465
            G+S PLL+N S +G+I LG+GDSLASIIG+RYG+  W GT KT+EGTLAFIV S  +CL
Sbjct: 372 LGVSFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCL 431

Query: 466 V----LLRFDKAAIFNHXXXXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
           V     L F+  A  N             SG+LEGNS LNDNILIP+FM
Sbjct: 432 VCQQAFLAFEGVATRN------IILACVVSGILEGNSDLNDNILIPSFM 474

>Kwal_26.8164
          Length = 500

 Score =  273 bits (698), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 167/403 (41%), Positives = 234/403 (58%), Gaps = 13/403 (3%)

Query: 114 LPKFDTIYSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXFFNFE 173
           +P F+ +Y LY+P ++SLLF    TV+N  L  +  +                    N +
Sbjct: 97  VPDFNVLYLLYIPSLLSLLFARDLTVVNMALAFNCTD----HPLILRLPLQAIFVLMNND 152

Query: 174 AGD-RXXXXXXXXXXXXXXXXXXYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRIL 232
            GD R                   IGQLKS D ++SNLFSI LTN+LY+ E+ ++HF++L
Sbjct: 153 FGDKRSKNLKAIGINCLIEFLIERIGQLKSFDRVESNLFSICLTNVLYLLESSSLHFQVL 212

Query: 233 KGIILALTTIISINYVLKKVM-HFKPFM----LSISFAIGLPLFANTFIHLEDGENPLLW 287
           + ++L     ++ N+ L  +   F P++    LS SF +  PL       +E G+NP +W
Sbjct: 213 RHVLLGFLAAVAFNFPLLIITSRFNPYLRSAILSTSFFVVFPLTILYTFEVE-GQNPAIW 271

Query: 288 LVKYILESTIRQKILFAWXXXXXXXXXXXXXEKDSLSLNTSRKLWHFIIFLLIIPSFQMD 347
           L  YI  + IR +I+  W              K + SLNTSRK+WHF+I  LI   F+ D
Sbjct: 272 LFDYITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYD 331

Query: 348 SNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFG 407
            +FVKI+L+GTI +FL++EY+RF  L P G  ++ +LR FAD RD  GP+IISY+YL+ G
Sbjct: 332 PDFVKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRDERGPIIISYIYLIIG 391

Query: 408 ISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVL 467
           ++TP+L+N S +G+I LG+GDSLASI+G R+GR +W GT KTLEGT AFI+++ I  L  
Sbjct: 392 VATPILINGSLVGVISLGVGDSLASIVGYRWGRHQWPGTSKTLEGTFAFILSTSICSLCF 451

Query: 468 LRFDKAAIFNHXXXXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
             F  A  F              SG+LEGNSVLNDNILIPA+M
Sbjct: 452 KLFLGA--FQEITSAQVILACILSGILEGNSVLNDNILIPAYM 492

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  259 bits (663), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 231/403 (57%), Gaps = 13/403 (3%)

Query: 114 LPKFDTIYSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXFFNFE 173
           LP F+ IY LYLPFM+SLLF     ++N+ +     NS                      
Sbjct: 97  LPDFNVIYLLYLPFMLSLLFARRLVLVNSAM---AFNSTDIPVHLKLPLQLVFVLINEEY 153

Query: 174 AGDRXXXXXXXXXXXXXXXXXXYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRILK 233
             DR                   I  LKSLD++D NLFSILLTN+LY+ ++ TVHF+IL+
Sbjct: 154 YTDRSTNMKAIAINVALCYVLEKISDLKSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQ 213

Query: 234 GIILALTTIISINYVLK-----KVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPLLWL 288
            ++      +S+NY L         + +  +L  SF++  PL     + + D + PL WL
Sbjct: 214 KVLYGFIVAVSVNYALSFPLRYASTYLRSLILFSSFSLIFPLTVTRILTI-DRKKPLTWL 272

Query: 289 VKYILESTIRQKILFAWXXXXXXXXXXXXXEKDSLSLNTSRKLWHFIIFLLIIPSFQMDS 348
            +YI  S  R KI+F W              K + SLNTSRK+WHF+I  L+IP  Q+D 
Sbjct: 273 YEYIFSSDTRIKIIFIWLLCLLVLIPNVMIFKSNFSLNTSRKIWHFLILFLLIPPLQLDP 332

Query: 349 NFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGI 408
            FVK++LSGT+ +FL +EY+R+  L P+G  ++ +LR F+D RD  GP+IISY+YL+ G+
Sbjct: 333 EFVKVSLSGTVVLFLVVEYLRYLKLEPVGKFLDEKLRSFSDFRDDRGPIIISYIYLIIGV 392

Query: 409 STPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIV-TSFIVCLVL 467
           S P+L+N S +G+I LG+GDSLASI+G ++GRI+W GT KT+EGTL FI+ TS +     
Sbjct: 393 SAPILINGSLVGVISLGVGDSLASIVGGKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQ 452

Query: 468 LRFDKAAIFNHXXXXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
            R++    F+             SG+LEGNSVLNDNILIP FM
Sbjct: 453 HRYNS---FSPISNGNVVLTCIVSGILEGNSVLNDNILIPPFM 492

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  231 bits (589), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 153/420 (36%), Positives = 222/420 (52%), Gaps = 37/420 (8%)

Query: 110 GYKSLPKFDTIYSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTXXXXXXXXXXXXF 169
           G  +LP F+TIY  Y+  ++S LF     ++NT+L  S+ +                  F
Sbjct: 105 GVNTLPTFNTIYLFYMQLLLSTLFVPQYLLLNTVLAFSISD---------------ISVF 149

Query: 170 FNFE-------AGDRXXXXXXXXXXXXXXXXXXYIG-----QLKSLDNIDSNLFSILLTN 217
           F           GD                     G     +LKSLD  + ++F++L T+
Sbjct: 150 FKIPLQIIFLLMGDDGSANIANDVKALVLNYFFIFGLYKTSKLKSLDKTECHMFALLCTD 209

Query: 218 ILYVSEAGTVHFRILK----GIILALTTIISINYVLKKVMH---FKPFMLSISFAIGLPL 270
           IL + E+ +++F++ +      I+ +T   +++Y L+ V      +  +L     +G   
Sbjct: 210 ILALVESDSIYFQVFQVCFTSFIVLVTVTSAVSYGLESVGATRWIRTLLLLPMIVVGFSY 269

Query: 271 FANTFIHLEDGENPLLWLVKYILESTIRQKILFAWXXXXXXXXXXXXXEKDSLSLNTSRK 330
           +  T + + +   P  WL+ YI  S IR KI+  W              K + SLNTSRK
Sbjct: 270 YIQTNLIINNVP-PFTWLIDYIGSSMIRLKIMGIWLGSALLLLPSVFALKSNWSLNTSRK 328

Query: 331 LWHFIIFLLIIPSFQMDSNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADD 390
           +WHF I  L+IP+  MDSNFVKIAL+GT+ +FL +EYIRF ++ P+G  ++  LR FAD 
Sbjct: 329 VWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADF 388

Query: 391 RDHSGPLIISYLYLLFGISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTL 450
           RD  GP+IISYLY + GIS P L+N S +G+I LG+GDSLASIIGK++GR RW  T KT 
Sbjct: 389 RDEKGPIIISYLYFIIGISLPFLINGSIIGIISLGVGDSLASIIGKKFGRNRWPNTCKTF 448

Query: 451 EGTLAFIVTSFIVCLVLLRFDKAAIFNHXXXXXXXXXXXXSGVLEGNSVLNDNILIPAFM 510
           EGT AFI  + I  +++  +     F              +G+LEGNS LNDN+LIP FM
Sbjct: 449 EGTFAFIAATGITTVIMKVYFN--FFTEVSFMNLVLVCFLAGILEGNSTLNDNLLIPTFM 506

>CAGL0I09812g complement(936925..937770) highly similar to tr|Q12382
           Saccharomyces cerevisiae YOR311c, hypothetical start
          Length = 281

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 424 LGIGDSLASIIGKRYGRIRWKGTQ-KTLEGTLAFIVTSFIVCLVLLRF 470
           L   D+ AS IG+RYG +  K T+ K+L G+LA  V  F+ CL    F
Sbjct: 164 LSWSDTAASTIGRRYGYLTPKITKNKSLAGSLAAFVVGFLTCLSFYGF 211

>Sklu_2266.5 YOR311C, Contig c2266 9409-10266
          Length = 285

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 428 DSLASIIGKRYGRIRWK-GTQKTLEGTLAFIVTSFIVCL 465
           D+ AS IG++YG +  K    K++ G++A  V  F +CL
Sbjct: 172 DTAASTIGRKYGHLTPKLARNKSMAGSIAAFVVGFAICL 210

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 249 LKKVMHFKPFMLSISFAIGLPLFANTFIHLEDGE 282
           L+K     P+    +  IGLP F N + HL+ GE
Sbjct: 84  LRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGE 117

>YNL237W (YTP1) [4370] chr14 (205187..206566) Protein with
           similarity to mitochondrial electron transport proteins
           [1380 bp, 459 aa]
          Length = 459

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 49  ECFYSNFVQTVILLGTFFYCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKY 106
           +C     + +  +L  F Y +  + PW I +A  SY Q +V+ +V+C+  V   FT++
Sbjct: 199 QCIAHGIMGSAFVLYGFIYVLVLVIPW-IRSAQTSYSQDYVDSWVMCIWGVVNTFTEH 255

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.144    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,949,854
Number of extensions: 544478
Number of successful extensions: 1633
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1648
Number of HSP's successfully gapped: 21
Length of query: 510
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 404
Effective length of database: 12,926,601
Effective search space: 5222346804
Effective search space used: 5222346804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 64 (29.3 bits)