Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR012W (CLU1)1277125464830.0
Scas_709.561281126138040.0
CAGL0M07722g1267121637380.0
Kwal_26.81611229122131800.0
ABR050W1228122327880.0
KLLA0F25322g1269126724520.0
KLLA0F06138g307156741.4
AFR200W69468741.7
AGL061W41196713.8
Sklu_1773.323359694.1
Kwal_26.7565704110697.0
KLLA0D13090g363177687.0
YOL049W (GSH2)49150688.3
YOL090W (MSH2)964135688.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR012W
         (1254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiat...  2501   0.0  
Scas_709.56                                                          1469   0.0  
CAGL0M07722g complement(774048..777851) similar to sp|Q03690 Sac...  1444   0.0  
Kwal_26.8161                                                         1229   0.0  
ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH] complement(4...  1078   0.0  
KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...   949   0.0  
KLLA0F06138g complement(596318..597241) no similarity, hypotheti...    33   1.4  
AFR200W [3392] [Homologous to ScYKL135C (APL2) - SH] complement(...    33   1.7  
AGL061W [4250] [Homologous to ScYBR288C (APM3) - SH] complement(...    32   3.8  
Sklu_1773.3 YNR057C, Contig c1773 4329-5030                            31   4.1  
Kwal_26.7565                                                           31   7.0  
KLLA0D13090g 1120945..1122036 similar to sgd|S0002730 Saccharomy...    31   7.0  
YOL049W (GSH2) [4770] chr15 (238617..240092) Glutathione synthet...    31   8.3  
YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3...    31   8.5  

>YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiation
            factor eIF3, p135 subunit [3834 bp, 1277 aa]
          Length = 1277

 Score = 2501 bits (6483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1223/1254 (97%), Positives = 1223/1254 (97%)

Query: 1    MSEKKEEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVL 60
            MSEKKEEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVL
Sbjct: 1    MSEKKEEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVL 60

Query: 61   AMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKSELKLQLILKPYSAREALKHVITV 120
            AMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKSELKLQLILKPYSAREALKHVITV
Sbjct: 61   AMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKSELKLQLILKPYSAREALKHVITV 120

Query: 121  RDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIXXXXXXXXXXXXXXXXXXXNTFKDVTD 180
            RDFIGFAQETSDGLSEFAISTGSSFSSLPLGPI                   NTFKDVTD
Sbjct: 121  RDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERSKQEEKDEKSDPEEKKNTFKDVTD 180

Query: 181  EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY 240
            EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY
Sbjct: 181  EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY 240

Query: 241  LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSLIYYSLFDLIASRSK 300
            LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSLIYYSLFDLIASRSK
Sbjct: 241  LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSLIYYSLFDLIASRSK 300

Query: 301  KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN 360
            KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN
Sbjct: 301  KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN 360

Query: 361  FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD 420
            FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD
Sbjct: 361  FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD 420

Query: 421  QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYLLTTVVE 480
            QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYLLTTVVE
Sbjct: 421  QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYLLTTVVE 480

Query: 481  FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF 540
            FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF
Sbjct: 481  FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF 540

Query: 541  DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFDKRRYILDLANTYPLDINFARQNF 600
            DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFDKRRYILDLANTYPLDINFARQNF
Sbjct: 541  DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFDKRRYILDLANTYPLDINFARQNF 600

Query: 601  DNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEFEKAYEENLFSYNPDAYQVEGIED 660
            DNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEFEKAYEENLFSYNPDAYQVEGIED
Sbjct: 601  DNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEFEKAYEENLFSYNPDAYQVEGIED 660

Query: 661  ANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKIIELSQKE 720
            ANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKIIELSQKE
Sbjct: 661  ANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKIIELSQKE 720

Query: 721  LDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKEVPKELTE 780
            LDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKEVPKELTE
Sbjct: 721  LDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKEVPKELTE 780

Query: 781  DLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLSKDVPVFLVPSL 840
            DLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLSKDVPVFLVPSL
Sbjct: 781  DLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLSKDVPVFLVPSL 840

Query: 841  VAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRFRHQLPSN 900
            VAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRFRHQLPSN
Sbjct: 841  VAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRFRHQLPSN 900

Query: 901  WIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLESYKQSLDKKIRNKFVEPPTTFSL 960
            WIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLESYKQSLDKKIRNKFVEPPTTFSL
Sbjct: 901  WIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLESYKQSLDKKIRNKFVEPPTTFSL 960

Query: 961  SDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNNILHPAVA 1020
            SDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNNILHPAVA
Sbjct: 961  SDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNNILHPAVA 1020

Query: 1021 EKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNLAILEFSNESPYN 1080
            EKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNLAILEFSNESPYN
Sbjct: 1021 EKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNLAILEFSNESPYN 1080

Query: 1081 ATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLSSYVVELE 1140
            ATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLSSYVVELE
Sbjct: 1081 ATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLSSYVVELE 1140

Query: 1141 GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSRQWVNGLS 1200
            GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSRQWVNGLS
Sbjct: 1141 GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSRQWVNGLS 1200

Query: 1201 SLIMXXXXXXXXXXXXMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLTF 1254
            SLIM            MSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLTF
Sbjct: 1201 SLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLTF 1254

>Scas_709.56
          Length = 1281

 Score = 1469 bits (3804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/1261 (57%), Positives = 958/1261 (75%), Gaps = 28/1261 (2%)

Query: 6    EEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVLAMIPS 65
            +E  N  +K+++KLP     +H+  H  K  ++K N++ F+  K++K++T+++VLA    
Sbjct: 12   QEGTNEHIKISIKLP---TLAHSHHHHAKKSNNKKNELLFQFNKDAKVETIINVLAFTEQ 68

Query: 66   SKYLTNVGLKTIEGDSQLSDEMSIKEIV-GEKSEL-KLQLILKPYSAREALKHVITVRDF 123
            +KYLTN+ L+    D  L++E +I +++ G+ S++  L + +KPY+AR++LKH++TVRDF
Sbjct: 69   TKYLTNIQLRW--NDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHLLTVRDF 126

Query: 124  IGFAQETSDGLSEFAISTGSSFSSLPLGPI---XXXXXXXXXXXXXXXXXXXNTFKDVTD 180
            IGFA ETSDGLSEFA+STGS F+ LPLG I                      N FK V+D
Sbjct: 127  IGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTAEEEEQKDEAAEDKEVKKNVFK-VSD 185

Query: 181  EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY 240
            EEK  F ++VHE+F S K ++IN++LT++SN++TPCVRSL+ + YNPVP FY+S+GHLFY
Sbjct: 186  EEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQGHLFY 245

Query: 241  LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSLIYYSLFDLIASRSK 300
            LQ+VTLEGE+F++TA  SGFY+NKS STKFDPS +  ++E+ + S I+YSL+DL+AS SK
Sbjct: 246  LQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERL-SEEHNNESKIFYSLYDLLASHSK 304

Query: 301  KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN 360
            KF+SHV+ FEKKL+ ++S SYV+P +TFLHKPW V+  P N PD+ RLQ  + + + E N
Sbjct: 305  KFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTP-PTNPPDFFRLQLDSQNVSVETN 363

Query: 361  FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD 420
            FND+FQAI+DL T++L +RIE ERL +K++HEFSV A  GAMSIF  +   +NPESPT +
Sbjct: 364  FNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESPTNE 423

Query: 421  QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYLLTTVVE 480
            QIFL  +IFYS+V+ +  N      ++AA A SN DLKTIN+LNR+++++VRY+LTT+V+
Sbjct: 424  QIFLSGHIFYSFVTSIKDN---GINEDAARAISNHDLKTINLLNRVNLNDVRYVLTTIVD 480

Query: 481  FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF 540
            FAGRR+LAQTPVPGLL +MG ++ KD  TGEE  +D  ND+ VKYGLDE  GKI++DADF
Sbjct: 481  FAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADF 540

Query: 541  DSVLEKKFVKAFHLKKHKV-NG-----TELAFSSQSKGIVGFDKRRYILDLANTYPLDIN 594
            D+ L K+F K FHLKKH+V NG      ++ FSS+S+GIVGFDKR+YILDLANTYPLDIN
Sbjct: 541  DAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDIN 600

Query: 595  FARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEK-EGVEFEKAYEENLFSYNPDAY 653
            F ++N+DN+ +T  RYPHRQTL+RPELVEKWWN +VEK + +  + AY+ N+FSYNPDA+
Sbjct: 601  FVKENYDNVADT-KRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAF 659

Query: 654  QVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKI 713
             V+G+ED  V+E+S YL KEV+P V+ DY+  N++ PYNGEHL DTLHKNGIN+RYLGK 
Sbjct: 660  VVDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKF 719

Query: 714  IELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKE 773
            IEL Q EL  Q+  + + LK V + N EYE+WEK YL KIE +I ERQAKINKL+QEGKE
Sbjct: 720  IELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKE 779

Query: 774  VPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLSKDVP 833
            VPKELTEDLKLND+EI+KPTD +P+VVA DEL  LI I+ELEI++RSLKHVL+  SKD+P
Sbjct: 780  VPKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLP 839

Query: 834  VFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRF 893
            V +VPSL+A+V N+L G  YN  P  E +D F+P+   SF KLTR+ LLEA+SK+++LRF
Sbjct: 840  VLMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRF 899

Query: 894  RHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLESYKQSLDKKIRNKFVE 953
            R++LP++WI  Y E+PF  IRS+SYK GIQL+NK+YFFT E  E++KQS DKKIRNK V 
Sbjct: 900  RYELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVA 959

Query: 954  PPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNN 1013
            P  TFS+ DLTIIPRVK SE++S V ++FW QG   I E  + ALTL AQ+ITV+E+V++
Sbjct: 960  PLNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSS 1019

Query: 1014 ILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNLAILEF 1073
            ILHP+VAEKYLS+S +YN+L L  EA+AFCRKAC IYERV G+DSFEM+RALTNLA+LE 
Sbjct: 1020 ILHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLET 1079

Query: 1074 SNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLS 1133
            SN+SPYNA VVY RL E L+ + L  +HHP+ TSI++++EQL+LGV++ KL++ VL  L 
Sbjct: 1080 SNKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLC 1139

Query: 1134 SYVVELEGKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSR 1193
              +V  EGK+SLAY +TESRLGNL+  +KDF  AL+HI VT+ IF+K+LG NH  +AQSR
Sbjct: 1140 DLIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSR 1199

Query: 1194 QWVNGLSSLIMXXXXXXXXXXXXMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLT 1253
            QW+NGL++++             ++   SN+   K   H+ KKD+   ELA+KSVDELL 
Sbjct: 1200 QWINGLTNVVNDMQKQLNQTQAAVN-AKSNAPAKK---HKNKKDEPNAELADKSVDELLN 1255

Query: 1254 F 1254
            F
Sbjct: 1256 F 1256

>CAGL0M07722g complement(774048..777851) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w translation initiation
            factor eIF3, hypothetical start
          Length = 1267

 Score = 1444 bits (3738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1216 (57%), Positives = 904/1216 (74%), Gaps = 10/1216 (0%)

Query: 43   ISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLS-DEMSIKEIVGEKSELKL 101
            I+ +  K+SK+Q VLD L++ P++KY TN  LK   GD  LS +E +++E+  +K E K+
Sbjct: 35   ITLQFRKDSKLQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKV 94

Query: 102  QLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIXXXXXXXX 161
             L LKPY+  +ALKHV+T RDF GFA ET DGLS  A+STGS F  LPL  I        
Sbjct: 95   ALELKPYNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENE 154

Query: 162  XXXXXXXXXXXNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKL---LTSESNIITPCVR 218
                        T  +VTDEEK++FN MVH +F + K      L   + ++++++TPC+R
Sbjct: 155  DKDTENKKP---TSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLR 211

Query: 219  SLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENT 278
            S++F+PYNPVP FYR+KGHLFYLQIVTLEGES  +TAIPSGFY+NKS ++KFDPSPKEN 
Sbjct: 212  SINFSPYNPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKEN- 270

Query: 279  DENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSL 338
              + H   ++Y+L+DL+AS SK F++H+ + EKK   L+S +YVRP+ T L+KPW + ++
Sbjct: 271  --DGHVDTVHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAI 328

Query: 339  PPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAA 398
            P N PDYLR Q  + +  PERNFNDEFQ+IK++ T+TLQ RIE ER+F+K+ HEF++ A 
Sbjct: 329  PTNGPDYLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINAT 388

Query: 399  SGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLK 458
             GAM I Y +  AMNP+SP  +QIFLK+NIFYS+V D++  Y  KGGDEAAIA++NQDL+
Sbjct: 389  KGAMDILYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLR 448

Query: 459  TINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFV 518
            T+N+L RL++  + +LLTT+V+F G+RILAQTPVPGLL+ MG KI  +  T EE   +  
Sbjct: 449  TLNMLTRLNLPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELS 508

Query: 519  NDINVKYGLDEGLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFDK 578
            +DI VKYGLDE   K+V++ +FD +L  +F K+FHLKKH + GTEL FSSQSKGIVG DK
Sbjct: 509  SDICVKYGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDK 568

Query: 579  RRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEFE 638
            R YILDLANTYPLD+ FA++NFD+++E   +YPHRQTL+RPELVEKWW  K+E + VE  
Sbjct: 569  RHYILDLANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELV 628

Query: 639  KAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLAD 698
            KAYEENL+SYNPDAYQV G+ED  V E+S YL +E+IP+V+QDYL+GN+ +PYNGEHLAD
Sbjct: 629  KAYEENLYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLAD 688

Query: 699  TLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIK 758
            T HKNG+NMRYLGK   L ++EL  Q   +E  L  V  DNKEYE+WEKSYLQKIE MIK
Sbjct: 689  TFHKNGVNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIK 748

Query: 759  ERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVS 818
            ERQAKINKLVQEGKEVPKELTEDLKL+D EIKKP+  KPVVV+YDELVPLIK +ELEI+S
Sbjct: 749  ERQAKINKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIIS 808

Query: 819  RSLKHVLKDLSKDVPVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTR 878
            RSLKH+L+  S+ +P  ++P+L+++VFN+L G  YN  P  E VD  YPV++  F  LT 
Sbjct: 809  RSLKHILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTH 868

Query: 879  SELLEAVSKQAFLRFRHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLES 938
              LL+ + ++A +R+R++L  +W   +   PFTLIRS+  KFG+QLLNK+YFF+ EQLE 
Sbjct: 869  DTLLKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEE 928

Query: 939  YKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSAL 998
            YKQSLDKK R K+V P TTFS+SDLT+IP++K  +Y+S +SEE W+QGAS+INE+++  L
Sbjct: 929  YKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGL 988

Query: 999  TLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDS 1058
            TLLAQSI   E+VN+ILH +VAEKYL+LS IYNKL L  EAIAFCRK+C IYERV G+DS
Sbjct: 989  TLLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDS 1048

Query: 1059 FEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALG 1118
            FE++RALTNLA LEF+NESPYN  ++Y R+ + +  Y L KIHHP  T+IFN+LEQL+LG
Sbjct: 1049 FELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLG 1108

Query: 1119 VQDTKLAIEVLGQLSSYVVELEGKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIF 1178
            VQD KLA+EVL  L  ++V ++G +SL Y Y +S+LGNL AA   F  AL  I V + IF
Sbjct: 1109 VQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIF 1168

Query: 1179 TKQLGMNHTHSAQSRQWVNGLSSLIMXXXXXXXXXXXXMSTTGSNSAGHKKTNHRQKKDD 1238
            TK+LG NH  +AQ+RQWV+GL++LI              + +G      K  +   KK+ 
Sbjct: 1169 TKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKET 1228

Query: 1239 VKPELANKSVDELLTF 1254
              P+LA+KSVDELL+F
Sbjct: 1229 TNPDLADKSVDELLSF 1244

>Kwal_26.8161
          Length = 1229

 Score = 1229 bits (3180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/1221 (49%), Positives = 845/1221 (69%), Gaps = 29/1221 (2%)

Query: 38   SKNNDISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKS 97
            ++  ++   + K S +Q V +VL   PS++ LTN  L+      +LS E S+ ++  E  
Sbjct: 17   NQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTN--LEFYHRGKKLSGEESLLDLASE-D 73

Query: 98   ELKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIXXXX 157
            ++KL +    Y+AR+A++HV  VRD IGF  ET DG+S+FA+STG  F  +PL P+    
Sbjct: 74   KVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCDMPLRPVEHAA 133

Query: 158  XXXXXXXXXXXXXXXNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCV 217
                             FK ++++EK  F   V +  +  K  ++N++L + S IITPC+
Sbjct: 134  PQEEDKTAS------TAFK-ISEDEKNDFQRTVKDTLNQGK--TVNEVLKTRSGIITPCL 184

Query: 218  RSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKEN 277
            R+L+ + YNPVPPFYR+KGHL YLQ  +LEGE F+ITA   GFYVNKS + KFDPSP+++
Sbjct: 185  RALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSPRDD 244

Query: 278  TDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSS 337
                  +     SL DL+++ SKKF  H++  E+++S+ D+  + RPS TFL KPW +S+
Sbjct: 245  ------AGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLIST 298

Query: 338  LPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTA 397
            +P ++ DY RLQ + +D   ERNFNDEFQAIKD+T+S  Q  ++ E+L +KV  EF+ TA
Sbjct: 299  MPTSSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETA 358

Query: 398  ASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDL 457
               AMSIFY+D VAMNPE+PT++QIFLK+NIFYS+V DV+GNY   GGD AA AASNQDL
Sbjct: 359  VRDAMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDL 418

Query: 458  KTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDF 517
            +T+ +L+R+ + E+ YLL T+++FAGRRILAQTPVPGLL+ MG    +D  TGE VTED 
Sbjct: 419  QTVKLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDL 478

Query: 518  VNDINVKYGLDEGLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFD 577
            V+D+N+ YG DE  G ++Y+ +FD  LE  F K FHL+KHK    E+  SS SKGI+G D
Sbjct: 479  VSDVNIVYGQDEASGDVLYNQEFDDALES-FSKVFHLRKHKAGSVEIKTSSHSKGIIGSD 537

Query: 578  KRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEF 637
            KR+YILDLAN+ PLD+ FA  N+D + E+  RYPHRQTL+R ELV+KWW NK+++  ++F
Sbjct: 538  KRKYILDLANSQPLDVEFATGNYDGVPES-ERYPHRQTLVRNELVDKWWANKLDESKLDF 596

Query: 638  EKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLA 697
             KA+EEN F+ NPDAY VEG+ED+ V ++S YL  +V+PSV+ +Y +GNL+ PY+G+HL 
Sbjct: 597  NKAFEENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLT 656

Query: 698  DTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMI 757
            ++LHKNGINMRYLGK+I L++KE +SQI  ++  L  V   N+++E WEK YL K+E  I
Sbjct: 657  ESLHKNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQI 716

Query: 758  KERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIV 817
            KERQ KINKLV EGKE+P+EL  DLKL++ +I+KPT G+ V+V  D++  LIK+S+LEIV
Sbjct: 717  KERQEKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIV 776

Query: 818  SRSLKHVLKDLSKDVPVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLT 877
            +RSLKH+L+D SK +PV LVPS+VAY FN+L G +YN+ P+ E VDEF+     SF  L+
Sbjct: 777  ARSLKHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLS 836

Query: 878  RSELLEAVSKQAFLRFRHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLE 937
            R +LL+A+  QA  RF + L    +E     PF LIR+VS +FGIQLLNKEYFF  E+ E
Sbjct: 837  RGDLLKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYE 896

Query: 938  SYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSA 997
            ++KQS DKK R+K  +P +TFS +D+T+IP +K  +Y S   + FW QGA+++NE +   
Sbjct: 897  TFKQSQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADG 956

Query: 998  LTLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGID 1057
            L LL+Q++ + E+VN  +H +VAE Y+++S IY+ L   PEAI FCR+AC IYER  G+D
Sbjct: 957  LVLLSQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVD 1016

Query: 1058 SFEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLAL 1117
            SFE++R LTNLA+LE SN+SP NA VV  R+  +  +  L    HPA  + +  L+Q +L
Sbjct: 1017 SFEVLRCLTNLAVLELSNKSPSNAAVVLQRI--LCTMNALCVTIHPATINSYTMLQQASL 1074

Query: 1118 GVQDTKLAIEVLGQLSSYVVELE-GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQG 1176
              +D +LAIEVL +LSS ++E+E G+ SLAYGY +SR+G+L+  +KD+  +L+ I+  + 
Sbjct: 1075 ACKDARLAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKN 1134

Query: 1177 IFTKQLGMNHTHSAQSRQWVNGLSSLIMXXXXXXXXXXXXMSTTGSNSAG---HKKTNHR 1233
            +FT++LG+N   +AQ RQWV  L  L+                T +NSAG    +K  + 
Sbjct: 1135 VFTRELGVNDETTAQCRQWVQALEGLLQ---SQKQQQTLNQQQTAANSAGTTRMRKQKNS 1191

Query: 1234 QKKDDVKPELANKSVDELLTF 1254
            +  +  +P+LANKSVDELL+F
Sbjct: 1192 KNDEKPRPDLANKSVDELLSF 1212

>ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH]
            complement(483635..487321) [3687 bp, 1228 aa]
          Length = 1228

 Score = 1078 bits (2788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1223 (44%), Positives = 790/1223 (64%), Gaps = 36/1223 (2%)

Query: 38   SKNNDISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKS 97
             K+  +S    + +++Q+++  LA   +SKY TN  L  +    ++ ++  I E+ G + 
Sbjct: 17   GKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYEL--LHNGVEVDEQQLISELAGNEQ 74

Query: 98   ELKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIXXXX 157
             + LQL LKPY+  E ++H +T R++IGF  ++ D ++  A+S  + F  LPL  I    
Sbjct: 75   TVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRELPLTDIAAAS 134

Query: 158  XXXXXXXXXXXXXXXNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCV 217
                                V+D EK  F + +  +       S   +L   S +  PC+
Sbjct: 135  GKTEVADDRQKEEF-----QVSDAEKAVFTKELDSILE--LRPSAQDVLKGGSALSKPCL 187

Query: 218  RSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKEN 277
            RSL  + YNPVP F+R+KGHL YLQ VTLEGE+ +ITA  SGFYVNKS++ KFDP+ K  
Sbjct: 188  RSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTLK-- 245

Query: 278  TDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSS 337
            TD     + +  +L++L+   SKKF SH+   E  L A +S +YV+P + FLHK WF SS
Sbjct: 246  TD-----AAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSS 300

Query: 338  LPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTA 397
            LP N+ D+   Q  AL+   ERNFNDEFQA+K+ ++  +  R+E E+L ++V+H+F+V A
Sbjct: 301  LPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAA 360

Query: 398  ASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDL 457
            + G+M IFY + VAMNP++P ++ IFLK+NIFYS+VSD+ G+Y+ KGGD AA AASNQDL
Sbjct: 361  SKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDL 420

Query: 458  KTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDF 517
              I  L + +M  VR+LL  V+          +PVPG+L T G K +K+   GEE     
Sbjct: 421  HIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKN-EKGEEEAIQA 479

Query: 518  VNDINVKYGLDEGLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFD 577
             NDI V YG DE   K++ DA+F S L+  F K FHLKKH+V+G EL  +S SKG+VGFD
Sbjct: 480  KNDITVCYGFDEASNKVIADAEFGSSLDD-FAKVFHLKKHEVDGVELKVASTSKGVVGFD 538

Query: 578  KRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEF 637
            KR YILDLA+  PLD+ FA +NFD + +   RYPHRQTLLR ELVEKWW +KV+  G E 
Sbjct: 539  KRNYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEM 598

Query: 638  EKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLA 697
            E AYEE  FSYNPDAY++EGIED  V E+S+YL+KEV+P+++++   G+++ P+NGEHL 
Sbjct: 599  EAAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLV 658

Query: 698  DTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMI 757
            D +HKNGIN+RYLG++IEL+++EL++Q    E +L+ VE DNKE+ +WE +YL+ IE++I
Sbjct: 659  DIMHKNGINIRYLGRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLI 718

Query: 758  KERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIV 817
            KERQ  I KL+ EGKEVP EL E+LKL+D+EI+KP + + V V  D+L  L+ ++++EI+
Sbjct: 719  KERQVTIQKLLAEGKEVPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEII 778

Query: 818  SRSLKHVLKDLSKDVPVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKC----SF 873
            SRS+KHV +    ++P  ++P+ +A+  N+L G  YN  P  E     +P +      +F
Sbjct: 779  SRSIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAE-----FPTDGSDIDFAF 833

Query: 874  AKLTRSELLEAVSKQAFLRFRHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTR 933
             KLTR +LL  +S+QA LRFR+ LP  W   Y   PF L+R +  KFGIQLLNKEYFFTR
Sbjct: 834  TKLTREQLLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTR 893

Query: 934  EQLESYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMIN-E 992
            EQ ++++Q+ D +IR+K VEP +TFS++DL++   +  +  T+ VS++ WAQGA MIN E
Sbjct: 894  EQYQNWRQAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDE 953

Query: 993  DKQ-SALTLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYE 1051
            DKQ +AL L +Q+I   E+ +  +HP VAE YL+LS I++KL    EA+A CRKAC IYE
Sbjct: 954  DKQATALGLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYE 1013

Query: 1052 RVSGIDSFEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNH 1111
            RV G DSFEM+R+L NLA+LE +N+SPYNA +    +  IL V  +P ++HPA  + ++ 
Sbjct: 1014 RVCGFDSFEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVV-IP-VNHPATINSYSM 1071

Query: 1112 LEQLALGVQDTKLAIEVLGQLSSYVVELEGKDSLAYGYTESRLGNLFAALKDFHRALEHI 1171
            L  +   +Q++   I+VL +L   +VE++G  SL Y   ESRL NL+A++ ++ R+L  I
Sbjct: 1072 LHSMCSSLQNSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACI 1131

Query: 1172 TVTQGIFTKQLGMNHTHSAQSRQWVNGLSSLIMXXXXXXXXXXXXMSTTGSNSAGHKKTN 1231
                 +F+K+LG+NH  + +   W+ G+ +LI                  +   G KK  
Sbjct: 1132 ESCYELFSKELGVNHKTTVECNSWITGVENLI--ESTSQSKALAASKAAAAAKQGEKKPA 1189

Query: 1232 HRQKKDDVKPELANKSVDELLTF 1254
             +Q++     EL +KS+DEL+ F
Sbjct: 1190 QKQQQ---SAELRDKSIDELMNF 1209

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w CLU1 translation
            initiation factor eIF3 (p135 subunit) singleton,
            hypothetical start
          Length = 1269

 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1267 (40%), Positives = 763/1267 (60%), Gaps = 86/1267 (6%)

Query: 38   SKNNDISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKS 97
            SKN+DI +++GKES +  +   L+   S+K+ T+  L  IE    + DE  + ++ G  S
Sbjct: 19   SKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDL--IENSRVVDDEDVLGDLAGNGS 76

Query: 98   ELKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIXXXX 157
             L  Q   K Y+   A++H++ +R+ +GF+ E  DG+SEFAIS+GS F  + L P     
Sbjct: 77   SLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLEP----- 131

Query: 158  XXXXXXXXXXXXXXXNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKLLTSESNI-ITPC 216
                            +   ++D+EK+KF +  +E+  S  N+  N       N+ +TP 
Sbjct: 132  ---------NSEKSNGSETTISDQEKVKFLQTCNELLES-TNTDFNIASLKTGNLLVTPV 181

Query: 217  VRSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKE 276
            ++SL F+ YNPVP FY++KGHL YLQ  TLE E+F+IT   SGFYVNKS+S KFDPSPK+
Sbjct: 182  LKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPKD 241

Query: 277  NTDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVS 336
              +         ++L DL+   SKKF  HV +   KLS+ DS  YV+P++ FL KPW VS
Sbjct: 242  EFEPK-------FNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVS 294

Query: 337  SLPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVT 396
             LP NN D++R Q    +   ERNF DEFQAIKDL  ++  DR++ E++ + ++HEF+  
Sbjct: 295  QLPSNNGDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSE 354

Query: 397  AASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQD 456
            A  GAM+IF ++   ++P +   + ++   ++ +S+V+DVSG Y   GG+EAA A +NQD
Sbjct: 355  AVKGAMAIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQD 414

Query: 457  LKTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTED 516
            L+ IN LNRL +  +R+ LT ++++AG R+L Q+PVPGLL  +G  I+ D    +EV E 
Sbjct: 415  LQIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEED-KEVAEP 473

Query: 517  FVNDINVKYGLDEGLGKIVYDADF-DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVG 575
                I+V YG D+ +  + +D  F + V E  F K F+LK+HKV   +L  SS+SKGI G
Sbjct: 474  METLISVNYGYDDFVATLKFDEKFHEKVCE--FSKNFYLKEHKVEEVDLRISSKSKGIFG 531

Query: 576  FDKRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGV 635
             D+R YILDLANT P+DI F + ++D+++E  N+YPHRQ LLR ELVE+W   K+   G 
Sbjct: 532  VDQRAYILDLANTNPVDIEFVKAHYDDVKE--NKYPHRQVLLRRELVERWRAEKIAASGK 589

Query: 636  EFEKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEH 695
              ++A E+  F YNPDAY ++G+ED NV +MS +L   V+   ++D L GN + PY+G+H
Sbjct: 590  TLQEASEDVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQH 649

Query: 696  LADTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIEN 755
            L D  H NG+NMRYLGK IE  + + + Q     + L  +EQ+NKEY+DWE  YL K+E 
Sbjct: 650  LTDLFHTNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEK 709

Query: 756  MIKERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELE 815
            +IKERQ +INK VQ+GKEVP +L E ++L+  ++K+P   +   V  D+   LI + ELE
Sbjct: 710  LIKERQEEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELE 769

Query: 816  IVSRSLKHVLKDLSKDV--PVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSF 873
            +++RS+KH+ +  SK +  P  LVP LVA+  N+L G +YN     E +D  + +N+  F
Sbjct: 770  MIARSIKHIFRQQSKKLSSPT-LVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEF 828

Query: 874  AKLTRSELLEAVSKQAFLRFRHQLPSNW--IEAYMENPFTLIRSVSYKFGIQLLNKEYFF 931
            A+ TR +L+E V  QA LRFR+ L S W  I     + + LIR+++ KFGIQL+NKEYFF
Sbjct: 829  AQYTREQLIEEVRVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFF 888

Query: 932  TREQLESYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMIN 991
            T+EQ E +KQ+ DKK+R+K V+P  TFS++D ++ P +K +E+ S ++EE W QGAS++N
Sbjct: 889  TKEQYEKWKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVN 948

Query: 992  ----------------------------------EDKQS---------ALTLLAQSITVL 1008
                                              E++Q+         ALTLL QSI   
Sbjct: 949  AVSVEEEEAEKKKEESKKAAADGEDAGSSGATSKEEEQAKERAKKMNEALTLLGQSIAFR 1008

Query: 1009 EDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNL 1068
            ED+  ++HP++   YL LS +Y++L  Y +A+ FC KA  + ER  G+DSFE +R L+NL
Sbjct: 1009 EDIFGLVHPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNL 1068

Query: 1069 AILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEV 1128
            A LE+   S YN+ +V  ++ E+LK+  L    H    ++FN L Q+A   +D K+ I++
Sbjct: 1069 AYLEYGQGSIYNSALVLKKVHELLKL--LAPFVHSGRVNVFNLLFQIAASTEDKKVQIKI 1126

Query: 1129 LGQLSSYVVELEG-KDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHT 1187
            L +LS  ++++ G +++L YG  ESR+ NL+ +L D   AL HI   + IF+K+LG+N  
Sbjct: 1127 LNKLSELLLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQ 1186

Query: 1188 HSAQSRQWVNGLSSLIMXXXXXXXXXXXXMSTTGSNSAGHKKTNHRQKKDDVKPELANKS 1247
             +  S+QW   +  +I              +T  +N +  K            P L NKS
Sbjct: 1187 TTLTSKQWSETIKGIITKQQQEKKLASAQQATKPANISQKKGKKSSSS----SPALTNKS 1242

Query: 1248 VDELLTF 1254
            VDELL F
Sbjct: 1243 VDELLQF 1249

>KLLA0F06138g complement(596318..597241) no similarity, hypothetical
           start
          Length = 307

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 67/156 (42%), Gaps = 11/156 (7%)

Query: 848 LVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEA-VSKQAFLRFRHQLPSNWIEAYM 906
           +VG        P+ VD+F P+N C+F + +++  L+  +SK   +   +Q   +    + 
Sbjct: 29  IVGTLLRVQQHPDGVDDFEPLNACAFGEESQNPSLQTEISKNMKVCDLYQCVHSRHYHHH 88

Query: 907 ENPFTLIRSVSYKFG---IQLLNKEYFFTREQLESYKQSLDKKIRNKFVEPPTTFSLSDL 963
           ++ F  + + + +F    +  L   Y   REQ + + Q       N    P +  +LS  
Sbjct: 89  DDWFVHVPACARRFSESNLTRLPGHYLELREQQQGHHQ-------NSIQRPASESTLSSP 141

Query: 964 TIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALT 999
           ++  R + +   SS    F ++    + E + S  T
Sbjct: 142 SLKCRSRRTASCSSAGLGFGSEVLPTLMESETSEFT 177

>AFR200W [3392] [Homologous to ScYKL135C (APL2) - SH]
            complement(801518..803602) [2085 bp, 694 aa]
          Length = 694

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 1080 NATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQL--ALGVQDTKLAIEVLGQLSSYVV 1137
            N  VV N +A + ++YEL +   P P  I +H+ Q   AL        I +LG L+ Y  
Sbjct: 183  NPMVVANSIAALTEIYELDRSAVPLPLLIQSHVTQFLNALNECTEWARITILGALAQY-- 240

Query: 1138 ELEGKDSL 1145
              E KD++
Sbjct: 241  --EAKDAM 246

>AGL061W [4250] [Homologous to ScYBR288C (APM3) - SH]
           complement(593647..594882) [1236 bp, 411 aa]
          Length = 411

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 10  NATVKVTVKL---PKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVLAMIPSS 66
           N TV++ ++    P +++  H    L +   +  N +  + G+ +  +  +D+ A+  ++
Sbjct: 193 NPTVQLKLRTSGHPLDNSALHRCVELGEAGVATMNFVPPD-GRFTLAEYAIDLSAISQAA 251

Query: 67  KYLTNVGLKTI---EGDSQLSDEMSIKEIVGEKSEL 99
           + LTN+GL T+    G  Q  DE  IK I+G  +++
Sbjct: 252 RRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQV 287

>Sklu_1773.3 YNR057C, Contig c1773 4329-5030
          Length = 233

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 781 DLKLNDEEIKKPTDGKPVVV--AYDELVPLIKISELEIVSRSLKHVLKDLSKDVPVFLV 837
           D+KL D +I + +D +P++V  A    VP+ K  +LEI +  +KH+++   + V + +V
Sbjct: 99  DIKLQDFQIPQNSDERPLIVEGAGGIYVPITK--KLEITTDLIKHLIQSTKRPVKIVVV 155

>Kwal_26.7565
          Length = 704

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 9/110 (8%)

Query: 1080 NATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQD-TKLA-IEVLGQLSSYVV 1137
            N  VV N +A +  +YE  +   P P  I  H+ Q  L + + T+ A I +LG L+ Y  
Sbjct: 183  NPMVVANAIAALSDIYEADESAVPLPKLIQTHVSQFLLALNECTEWARIIILGALAEYTA 242

Query: 1138 E--LEGK---DSLAYGYTESRLGNLFAALKDFHRALEHITVT--QGIFTK 1180
            +  +E +   D +A          + A++K     L HI V     IF+K
Sbjct: 243  KDAIEAQEIIDRVAPHLQHVNAAVVLASIKVVITNLPHIQVNAESAIFSK 292

>KLLA0D13090g 1120945..1122036 similar to sgd|S0002730 Saccharomyces
            cerevisiae YDR322w MRPL35 ribosomal protein YmL35 of the
            large subunit, mitochondrial, start by similarity
          Length = 363

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 77/177 (43%), Gaps = 21/177 (11%)

Query: 949  NKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSAL-----TLLAQ 1003
            NK+VEP    S +  +++P +K  EY + +  E       ++N D+   L     T LA 
Sbjct: 190  NKWVEPGEILSSNTTSMVPTIKIQEYENGIDFEKQKYTVVIVNPDEPDVLNDTFKTTLAF 249

Query: 1004 SITVLE-DVN-NILHPAVAEKYLSLSAIYNKLALYPEA-IAFCRKACTIYERVSGIDSFE 1060
             +T L+ D N N++ P    KY     + + +   PE  +   R +  ++ +   ++S E
Sbjct: 250  GLTNLKIDYNDNVVDP---RKYNESQILADYIPPVPEKNVGKQRFSVWVFRQNGDLESPE 306

Query: 1061 MMRALTNLAILEF---SNESPYNATVVYNR----LAEILKVYELP--KIHHPAPTSI 1108
             +    N  I EF    N  P  A V  +     +A I + Y LP  ++ H    S+
Sbjct: 307  PV-DRENFDIREFVRSHNLDPVGAHVWRSEWDSNVANIREKYGLPEGRVFHRVRRSV 362

>YOL049W (GSH2) [4770] chr15 (238617..240092) Glutathione
           synthetase, carries out synthesis of glutathione from
           gamma-glutamylcysteine and glycine [1476 bp, 491 aa]
          Length = 491

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 528 DEG-LGKIVYDADFDSVLEKKFVKAFHLKKHKVN--GTELAFSSQSKGIV 574
           DEG LGK + DA+  S L K FVK + L   K+   G  LA S  SK ++
Sbjct: 332 DEGVLGKYISDAEKKSSLLKTFVKIYPLDDTKLGREGKRLALSEPSKYVL 381

>YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3p
           and Msh6p of DNA mismatch binding factor, involved in
           repair of single base mismatches and short
           insertions/deletions [2895 bp, 964 aa]
          Length = 964

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 28/135 (20%)

Query: 678 VIQDYLSGNLSTPYNG--------EHLADTLHKNGINMRYLGKIIELSQKELDSQ----I 725
           +I D L    ST Y+G        EH+A  +    +   +  ++ ELS+K  + +    +
Sbjct: 764 IIVDELGRGTST-YDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVV 822

Query: 726 VHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKIN---------KLVQEGKEVPK 776
            H E+NLK      ++++D + + L K+E  I ++   I+         K+V+  K    
Sbjct: 823 AHIEKNLK-----EQKHDDEDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKAN 877

Query: 777 ELTEDLKLNDEEIKK 791
           EL +DLK N+E++KK
Sbjct: 878 EL-DDLKTNNEDLKK 891

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,612,746
Number of extensions: 1915633
Number of successful extensions: 6263
Number of sequences better than 10.0: 138
Number of HSP's gapped: 6505
Number of HSP's successfully gapped: 151
Length of query: 1254
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1141
Effective length of database: 12,684,275
Effective search space: 14472757775
Effective search space used: 14472757775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)