Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR011W (HXT2)54153227430.0
YFL011W (HXT10)54650521560.0
Sklu_2380.257252721340.0
CAGL0D02662g56453821290.0
CAGL0D02640g56453821290.0
CAGL0I00286g55553420990.0
Kwal_14.85457052520410.0
Sklu_2362.157254619350.0
Scas_715.5055951119030.0
AFL205C54651618860.0
Sklu_2376.557953718810.0
AFL207C53949018760.0
Scas_628.759350418740.0
Sklu_2415.257151618660.0
Scas_658.2457054318640.0
Kwal_55.2007557153118590.0
YDR343C (HXT6)57052818470.0
YDR342C (HXT7)57052818470.0
YLR081W (GAL2)57451818320.0
YHR092C (HXT4)56052918050.0
YOL156W (HXT11)56752718030.0
CAGL0A02211g55252417990.0
YJL219W (HXT9)56752317990.0
KLLA0D13310g56750717950.0
CAGL0A01782g56852317930.0
CAGL0A01826g53347317870.0
CAGL0A00737g54952217820.0
CAGL0A02233g54951517800.0
Scas_541.657352617730.0
YHR096C (HXT5)59251417590.0
CAGL0A02321g55650817430.0
YJL214W (HXT8)56954117420.0
Scas_541.759153217400.0
Sklu_2304.657152617320.0
YDR345C (HXT3)56753117260.0
Scas_658.2356853217200.0
YHR094C (HXT1)57048717200.0
AFL204C53551717120.0
Scas_712.155853217110.0
Kwal_55.1958256753017090.0
Kwal_56.2228556753017020.0
Kwal_26.668656953916740.0
Scas_687.461053916700.0
Scas_509.256853916610.0
CAGL0A01804g56353316590.0
Scas_550.957454416550.0
Scas_685.556053216230.0
Scas_657.2056954116200.0
Scas_455.2*53548916030.0
Scas_552.257254315840.0
YEL069C (HXT13)56453115440.0
YNR072W (HXT17)56453215360.0
YDL245C (HXT15)56752115080.0
YJR158W (HXT16)56752115010.0
YIL170W (HXT12)45742814550.0
Scas_634.1647142814320.0
Kwal_26.668041639513221e-180
AFR602W5585199451e-121
KLLA0E21021g5285169331e-120
Scas_600.12932648931e-117
Scas_716.535235268831e-113
Kwal_55.200682672398411e-110
YNL318C (HXT14)5405428641e-109
CAGL0M04103g5315278291e-104
Kwal_56.248415114767923e-99
Kwal_55.200642382237472e-96
Kwal_27.96785134637592e-94
Scas_624.57984796753e-79
CAGL0I03872g7624826542e-76
YDL138W (RGT2)7635156262e-72
CAGL0J09020g8565006268e-72
YDL194W (SNF3)8844896191e-70
Kwal_56.244697095326092e-70
ADR091W6645405896e-68
KLLA0F05181g7874875895e-67
Scas_701.448764735742e-64
Kwal_34.162613272745203e-61
Kwal_34.161905564884865e-54
KLLA0A11110g5514844847e-54
Kwal_33.149115704904832e-53
Sklu_2439.205714764734e-52
KLLA0F26246g5834824692e-51
AEL042C5474944645e-51
ADR139C5584804471e-48
YDR536W (STL1)5694744402e-47
KLLA0E00264g5114624222e-45
AFR343C5714794234e-45
Scas_637.96075584141e-43
Kwal_56.227245784864077e-43
Scas_581.65875353936e-41
YOL103W (ITR2)6094853859e-40
Kwal_27.116387234693843e-39
CAGL0I07447g5705553794e-39
KLLA0C12309g5694863794e-39
Sklu_2427.85784963795e-39
YDR497C (ITR1)5843553611e-36
CAGL0M01672g5475223582e-36
Sklu_2313.35783483565e-36
KLLA0A03223g6775133561e-35
Kwal_34.162661581553227e-35
ABR223C6244363471e-34
KLLA0D00374g5564843381e-33
KLLA0E25025g5564803291e-32
KLLA0E14696g4774483262e-32
AFL034W4744013244e-32
Kwal_14.11055224753158e-31
YDR387C5555233169e-31
KLLA0E08987g5665223123e-30
Scas_632.145535263113e-30
KLLA0F06853g5284233104e-30
YBR241C4883983085e-30
Sklu_2144.65274593008e-29
Kwal_55.212895375292945e-28
YGL104C (VPS73)4864792882e-27
KLLA0B14861g5875202893e-27
Kwal_27.128111811722623e-26
KLLA0E02970g5404132761e-25
Kwal_27.106646535172771e-25
CAGL0C01771g4853812722e-25
Kwal_33.129505664882733e-25
Sklu_2080.45234612706e-25
Scas_552.0d112772441e-24
Kwal_14.16255064962601e-23
KLLA0D00253g5845052564e-23
KLLA0B00264g5764982564e-23
YIL171W (HXT12)109882301e-22
KLLA0E01782g5724042521e-22
CAGL0K12716g4844282465e-22
Scas_597.54894102431e-21
KLLA0E06743g6674472432e-21
YFL040W5405022422e-21
Kwal_27.128151981672263e-21
YJR160C (MPH3)6025322387e-21
YDL247W (MPH2)6095322388e-21
Scas_716.725445042371e-20
Sklu_2375.16135522362e-20
AGL277W6713802343e-20
KLLA0D05379g4964392271e-19
Kwal_27.110796134972263e-19
Scas_652.124784012209e-19
YBR298C (MAL31)6145172201e-18
YGR289C (MAL11)6165562121e-17
KLLA0C19481g3903341814e-14
Kwal_27.113852222081293e-08
YDL199C6874371328e-08
KLLA0F13684g5712631282e-07
Scas_105.156271123e-07
KLLA0F10043g5282511131e-05
Kwal_47.189765342471112e-05
YML123C (PHO84)5874861103e-05
Scas_626.15705041094e-05
Sklu_2253.35231521077e-05
Kwal_56.237545891521042e-04
Sklu_2304.55652511022e-04
Sklu_1567.25691231013e-04
Scas_660.3568214996e-04
CAGL0J01375g564205970.001
Sklu_1959.3531158970.001
Scas_694.19581258930.003
Kwal_26.6669590121930.003
Kwal_33.15241580172910.005
Kwal_26.7984612198900.007
KLLA0C19459g149135850.008
AGR076C68690890.011
KLLA0E09614g585104870.017
Scas_713.17572253870.018
KLLA0A04631g57969860.024
CAGL0B02475g580229850.030
Scas_692.8625493810.087
KLLA0E03729g609195810.089
KLLA0E14652g639180810.095
CAGL0G08624g583165800.11
Kwal_33.15638535290790.16
CAGL0B02079g624216780.19
KLLA0F17776g55370770.25
Sklu_2348.2600165770.25
ADL258W534131770.25
Sklu_1110.165790770.26
AFR322C592164770.28
Kwal_14.158557069760.32
Scas_713.30630147760.34
Sklu_2183.3504288760.34
YMR088C56286760.35
YPR198W (SGE1)543146750.43
YIL120W (QDR1)563136740.54
Kwal_23.2794619165740.60
YCR023C611107740.61
Scas_705.2661480730.88
YDR119W768148720.99
Sklu_2394.9533163721.1
CAGL0M06281g542239721.1
KLLA0E14520g25199711.1
KLLA0C16852g457266711.2
Kwal_23.4824553257711.2
Kwal_14.728568138711.3
YPR156C (TPO3)622107711.3
YNL065W (AQR1)58686711.5
YHR048W514192701.6
YML116W (ATR1)542136701.6
KLLA0A10439g63477692.2
KLLA0E16313g600176692.4
Kwal_23.485360361692.8
YHL047C (ARN2)637197683.2
Kwal_33.1426856945683.6
Kwal_56.2229861061673.8
CAGL0J09944g592134673.8
CAGL0B02343g537136673.8
KLLA0E09856g630240674.5
CAGL0I10384g630165674.6
KLLA0C00220g62475674.6
Kwal_47.18919640182674.8
AGL069C59489665.0
YNR055C (HOL1)586104665.2
YHL040C (ARN1)62751665.3
ADR336C568104665.5
KLLA0D10615g45163657.8
Sklu_2083.159836648.6
KLLA0F03278g385209649.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR011W
         (532 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexos...  1061   0.0  
YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexos...   835   0.0  
Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement        826   0.0  
CAGL0D02662g complement(278099..279793) highly similar to sp|P23...   824   0.0  
CAGL0D02640g 274285..275979 highly similar to sp|P23585 Saccharo...   824   0.0  
CAGL0I00286g complement(20521..22188) highly similar to sp|P2358...   813   0.0  
Kwal_14.854                                                           790   0.0  
Sklu_2362.1 YDR342C, Contig c2362 924-2642                            749   0.0  
Scas_715.50                                                           737   0.0  
AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [16...   731   0.0  
Sklu_2376.5 , Contig c2376 9071-10810 reverse complement              729   0.0  
AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp...   727   0.0  
Scas_628.7                                                            726   0.0  
Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement        723   0.0  
Scas_658.24                                                           722   0.0  
Kwal_55.20075                                                         720   0.0  
YDR343C (HXT6) [1171] chr4 complement(1159598..1161310) High-aff...   716   0.0  
YDR342C (HXT7) [1170] chr4 complement(1154206..1155918) High-aff...   716   0.0  
YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and gluco...   710   0.0  
YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- ...   699   0.0  
YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose...   699   0.0  
CAGL0A02211g complement(224864..226522) highly similar to sp|P39...   697   0.0  
YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose ...   697   0.0  
KLLA0D13310g complement(1143027..1144730) gi|131828|sp|P18631|RA...   696   0.0  
CAGL0A01782g complement(170326..172032) highly similar to sp|P39...   695   0.0  
CAGL0A01826g complement(179321..180922) highly similar to sp|P38...   692   0.0  
CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomy...   691   0.0  
CAGL0A02233g complement(231128..232777) highly similar to sp|P39...   690   0.0  
Scas_541.6                                                            687   0.0  
YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of ...   682   0.0  
CAGL0A02321g complement(247500..249170) highly similar to sp|P32...   676   0.0  
YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose ...   675   0.0  
Scas_541.7                                                            674   0.0  
Sklu_2304.6 , Contig c2304 11341-13056 reverse complement             671   0.0  
YDR345C (HXT3) [1172] chr4 complement(1162947..1164650) Low-affi...   669   0.0  
Scas_658.23                                                           667   0.0  
YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affini...   667   0.0  
AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp...   664   0.0  
Scas_712.1                                                            663   0.0  
Kwal_55.19582                                                         662   0.0  
Kwal_56.22285                                                         660   0.0  
Kwal_26.6686                                                          649   0.0  
Scas_687.4                                                            647   0.0  
Scas_509.2                                                            644   0.0  
CAGL0A01804g complement(175488..177179) highly similar to sp|P32...   643   0.0  
Scas_550.9                                                            642   0.0  
Scas_685.5                                                            629   0.0  
Scas_657.20                                                           628   0.0  
Scas_455.2*                                                           622   0.0  
Scas_552.2                                                            614   0.0  
YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of t...   599   0.0  
YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexo...   596   0.0  
YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of th...   585   0.0  
YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexo...   582   0.0  
YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown fu...   565   0.0  
Scas_634.16                                                           556   0.0  
Kwal_26.6680                                                          513   e-180
AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH] compleme...   368   e-121
KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1 Kluyver...   363   e-120
Scas_600.1                                                            348   e-117
Scas_716.53                                                           344   e-113
Kwal_55.20068                                                         328   e-110
YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of ...   337   e-109
CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces c...   323   e-104
Kwal_56.24841                                                         309   3e-99
Kwal_55.20064                                                         292   2e-96
Kwal_27.9678                                                          296   2e-94
Scas_624.5                                                            264   3e-79
CAGL0I03872g 337985..340273 some similarities with sp|Q12300 Sac...   256   2e-76
YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose ...   245   2e-72
CAGL0J09020g 887145..889715 highly similar to sp|P10870 Saccharo...   245   8e-72
YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose...   243   1e-70
Kwal_56.24469                                                         239   2e-70
ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W (...   231   6e-68
KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromy...   231   5e-67
Scas_701.44                                                           225   2e-64
Kwal_34.16261                                                         204   3e-61
Kwal_34.16190                                                         191   5e-54
KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA Kluy...   191   7e-54
Kwal_33.14911                                                         190   2e-53
Sklu_2439.20 YDR536W, Contig c2439 31933-33648                        186   4e-52
KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces...   185   2e-51
AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH] (557191..5...   183   5e-51
ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH] (950171..9...   176   1e-48
YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexo...   174   2e-47
KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomy...   167   2e-45
AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C (...   167   4e-45
Scas_637.9                                                            164   1e-43
Kwal_56.22724                                                         161   7e-43
Scas_581.6                                                            155   6e-41
YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permea...   152   9e-40
Kwal_27.11638                                                         152   3e-39
CAGL0I07447g 716104..717816 highly similar to sp|P30606 Saccharo...   150   4e-39
KLLA0C12309g 1046848..1048557 highly similar to sp|P30606 Saccha...   150   4e-39
Sklu_2427.8 , Contig c2427 19304-21040                                150   5e-39
YDR497C (ITR1) [1312] chr4 complement(1443701..1445455) Myo-inos...   143   1e-36
CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces c...   142   2e-36
Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement        141   5e-36
KLLA0A03223g 290002..292035 some similarities with sp|P39932 Sac...   141   1e-35
Kwal_34.16266                                                         128   7e-35
ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1...   138   1e-34
KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillu...   134   1e-33
KLLA0E25025g complement(2219051..2220721) weakly similar to sp|P...   131   1e-32
KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7 Asperg...   130   2e-32
AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH] co...   129   4e-32
Kwal_14.1105                                                          125   8e-31
YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Membe...   126   9e-31
KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1 Kluyverom...   124   3e-30
Scas_632.14                                                           124   3e-30
KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromy...   124   4e-30
YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member o...   123   5e-30
Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement        120   8e-29
Kwal_55.21289                                                         117   5e-28
YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative ...   115   2e-27
KLLA0B14861g complement(1305927..1307690) gi|125935|sp|P07921|LA...   115   3e-27
Kwal_27.12811                                                         105   3e-26
KLLA0E02970g complement(278965..280587) similar to sgd|S0002795 ...   110   1e-25
Kwal_27.10664                                                         111   1e-25
CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces c...   109   2e-25
Kwal_33.12950                                                         109   3e-25
Sklu_2080.4 YBR241C, Contig c2080 4658-6229                           108   6e-25
Scas_552.0d                                                            99   1e-24
Kwal_14.1625                                                          104   1e-23
KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyc...   103   4e-23
KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyce...   103   4e-23
YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose ...    93   1e-22
KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181 ...   101   1e-22
CAGL0K12716g complement(1260169..1261623) similar to sp|P43562 S...    99   5e-22
Scas_597.5                                                             98   1e-21
KLLA0E06743g complement(612941..614944) similar to ca|CA5798|IPF...    98   2e-21
YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose tra...    98   2e-21
Kwal_27.12815                                                          92   3e-21
YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein w...    96   7e-21
YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose perm...    96   8e-21
Scas_716.72                                                            96   1e-20
Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement         96   2e-20
AGL277W [4035] [Homologous to NOHBY] complement(185070..187085) ...    95   3e-20
KLLA0D05379g complement(464200..465690) weakly similar to sp|P43...    92   1e-19
Kwal_27.11079                                                          92   3e-19
Scas_652.12                                                            89   9e-19
YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose pe...    89   1e-18
YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose...    86   1e-17
KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candi...    74   4e-14
Kwal_27.11385                                                          54   3e-08
YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member o...    55   8e-08
KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301 S...    54   2e-07
Scas_105.1                                                             48   3e-07
KLLA0F10043g complement(928691..930277) weakly similar to sp|P36...    48   1e-05
Kwal_47.18976                                                          47   2e-05
YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affin...    47   3e-05
Scas_626.1                                                             47   4e-05
Sklu_2253.3 , Contig c2253 3254-4825 reverse complement                46   7e-05
Kwal_56.23754                                                          45   2e-04
Sklu_2304.5 , Contig c2304 8691-10388                                  44   2e-04
Sklu_1567.2 YPR198W, Contig c1567 1150-2859                            44   3e-04
Scas_660.3                                                             43   6e-04
CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces c...    42   0.001
Sklu_1959.3 , Contig c1959 3851-5446 reverse complement                42   0.001
Scas_694.19                                                            40   0.003
Kwal_26.6669                                                           40   0.003
Kwal_33.15241                                                          40   0.005
Kwal_26.7984                                                           39   0.007
KLLA0C19459g 1746987..1747436 some similarities with ca|CA3241|I...    37   0.008
AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630) [...    39   0.011
KLLA0E09614g 853845..855602 highly similar to sp|P53389 Saccharo...    38   0.017
Scas_713.17                                                            38   0.018
KLLA0A04631g complement(415070..416809) similar to ca|CA1324|IPF...    38   0.024
CAGL0B02475g 236029..237771 highly similar to sp|P25297 Saccharo...    37   0.030
Scas_692.8                                                             36   0.087
KLLA0E03729g 349784..351613 similar to sgd|S0006360 Saccharomyce...    36   0.089
KLLA0E14652g 1302073..1303992 similar to sp|P38724 Saccharomyces...    36   0.095
CAGL0G08624g complement(811931..813682) similar to sp|P40474 Sac...    35   0.11 
Kwal_33.15638                                                          35   0.16 
CAGL0B02079g complement(191736..193610) similar to sp|P50080 Sac...    35   0.19 
KLLA0F17776g complement(1627198..1628859) similar to ca|CA1324|I...    34   0.25 
Sklu_2348.2 YIL121W, Contig c2348 2640-4442 reverse complement         34   0.25 
ADL258W [1483] [Homologous to ScYNL065W (AQR1) - SH; ScYIL121W -...    34   0.25 
Sklu_1110.1 YDR119W, Contig c1110 22-1995                              34   0.26 
AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C (...    34   0.28 
Kwal_14.1585                                                           34   0.32 
Scas_713.30                                                            34   0.34 
Sklu_2183.3 YCR098C, Contig c2183 6694-8208                            34   0.34 
YMR088C (YMR088C) [4046] chr13 complement(443413..445101) Member...    34   0.35 
YPR198W (SGE1) [5610] chr16 (934028..935659) Crystal violet resi...    33   0.43 
YIL120W (QDR1) [2556] chr9 (134414..136105) Member of the multid...    33   0.54 
Kwal_23.2794                                                           33   0.60 
YCR023C (YCR023C) [557] chr3 complement(158533..160368) Member o...    33   0.61 
Scas_705.26                                                            33   0.88 
YDR119W (YDR119W) [966] chr4 (688221..690527) Member of the 14-s...    32   0.99 
Sklu_2394.9 YHR048W, Contig c2394 13885-15486                          32   1.1  
CAGL0M06281g 651932..653560 similar to sp|P38125 Saccharomyces c...    32   1.1  
KLLA0E14520g complement(1279788..1280543) similar to sp|P38724 S...    32   1.1  
KLLA0C16852g 1471656..1473029 similar to sp|P25297 Saccharomyces...    32   1.2  
Kwal_23.4824                                                           32   1.2  
Kwal_14.728                                                            32   1.3  
YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine...    32   1.3  
YNL065W (AQR1) [4525] chr14 (503723..505483) Member of the multi...    32   1.5  
YHR048W (YHR048W) [2336] chr8 (204599..206143) Member of the mul...    32   1.6  
YML116W (ATR1) [3855] chr13 (38196..39824) Membrane transporter ...    32   1.6  
KLLA0A10439g complement(913342..915246) similar to sp|P38731 Sac...    31   2.2  
KLLA0E16313g complement(1450546..1452348) similar to sp|P36035 S...    31   2.4  
Kwal_23.4853                                                           31   2.8  
YHL047C (ARN2) [2242] chr8 complement(8298..10211) Triacetylfusa...    31   3.2  
Kwal_33.14268                                                          31   3.6  
Kwal_56.22298                                                          30   3.8  
CAGL0J09944g 974150..975928 similar to sp|P53943 Saccharomyces c...    30   3.8  
CAGL0B02343g complement(222130..223743) similar to sp|P13090 Sac...    30   3.8  
KLLA0E09856g complement(874102..875994) similar to sp|P36172 Sac...    30   4.5  
CAGL0I10384g 1016935..1018827 highly similar to sp|P53283 Saccha...    30   4.6  
KLLA0C00220g 13632..15506 similar to sp|P38724 Saccharomyces cer...    30   4.6  
Kwal_47.18919                                                          30   4.8  
AGL069C [4242] [Homologous to ScYNR055C (HOL1) - NSH] (578235..5...    30   5.0  
YNR055C (HOL1) [4638] chr14 complement(728424..730184) Membrane ...    30   5.2  
YHL040C (ARN1) [2247] chr8 complement(19085..20968) Protein invo...    30   5.3  
ADR336C [2077] [Homologous to ScYNR055C (HOL1) - NSH] (1299396.....    30   5.5  
KLLA0D10615g 903967..905322 similar to sp|P47159 Saccharomyces c...    30   7.8  
Sklu_2083.1 YKL217W, Contig c2083 424-2220                             29   8.6  
KLLA0F03278g 309127..310284 similar to sp|P40475 Saccharomyces c...    29   9.0  

>YMR011W (HXT2) [3975] chr13 (288078..289703) High-affinity hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1626 bp, 541
           aa]
          Length = 541

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/532 (97%), Positives = 521/532 (97%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60
           MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC
Sbjct: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG
Sbjct: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
           GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP
Sbjct: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
           TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM
Sbjct: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
           IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA
Sbjct: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV
Sbjct: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM
Sbjct: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA
Sbjct: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           IGFSYGYVFMGCL           CETKGLTLEEVNEMYVEGVKPWKSGSWI
Sbjct: 481 IGFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWI 532

>YFL011W (HXT10) [1671] chr6 (112339..113979) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1641 bp, 546 aa]
          Length = 546

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/505 (80%), Positives = 454/505 (89%)

Query: 28  ETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFK 87
             DE  +  ++   + ++P KPI AYWTV+ LCLMIAFGGF+FGWDTGTISGF+NQTDFK
Sbjct: 21  RKDEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGGFIFGWDTGTISGFINQTDFK 80

Query: 88  RRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVG 147
           RRFG+++ DG++ LSDVRTGLIVGIFNIGCA GGLTLGRLGD+YGR+IGLMCV+LVY+VG
Sbjct: 81  RRFGELQRDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRLGDIYGRKIGLMCVILVYVVG 140

Query: 148 IVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGI 207
           IVIQIASSDKWYQYFIGRI+SGMGVGG+AVLSPTLISE +PKH+RGTCVSFYQLMITLGI
Sbjct: 141 IVIQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEISPKHLRGTCVSFYQLMITLGI 200

Query: 208 FLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL 267
           FLGYCTNYGTK YSNS+QWRVPLGL FA+AIFM+ GM+MVPESPR+LVEKG+YE+A+RSL
Sbjct: 201 FLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMVPESPRYLVEKGKYEEARRSL 260

Query: 268 AKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQ 327
           AKSNKVT+ DP +V E DTI+AN+E ER  GNASW ELFSNKGAILPRVIMGI+IQSLQQ
Sbjct: 261 AKSNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFSNKGAILPRVIMGIVIQSLQQ 320

Query: 328 LTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSAS 387
           LTG NYFFYYGTTIFNAVGM+DSF+TSIVLG VNFASTFVALY VDKFGRRKCLL GSAS
Sbjct: 321 LTGCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFVALYIVDKFGRRKCLLWGSAS 380

Query: 388 MAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESY 447
           MAICFVIF+TVGVT L+P GKDQPSS++AGNVMIVFTC FIF FAI+WAPIAYVIVAE+Y
Sbjct: 381 MAICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFFIFSFAITWAPIAYVIVAETY 440

Query: 448 PLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCET 507
           PLRVKNRAMAIAVGANW+WGFLIGFFTPFIT +IGFSYGYVFMGCL           CET
Sbjct: 441 PLRVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGYVFMGCLIFSYFYVFFFVCET 500

Query: 508 KGLTLEEVNEMYVEGVKPWKSGSWI 532
           KGLTLEEVNEMY E +KPWKSG WI
Sbjct: 501 KGLTLEEVNEMYEERIKPWKSGGWI 525

>Sklu_2380.2 YMR011W, Contig c2380 4381-6099 reverse complement
          Length = 572

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/527 (75%), Positives = 458/527 (86%), Gaps = 2/527 (0%)

Query: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFG 66
           S+    + Q ++ ++    K   D+  ++ ++E+   E+P K ++ Y  V+CLCLM+AFG
Sbjct: 21  SKDSDSALQLNLQTSTPSNKASRDDFDLKPENEHF-PEIPQKKLSEYILVMCLCLMVAFG 79

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQM-KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLG 125
           GFVFGWDTGTISGFVN TDFKRRFG   +S+GTYYLS+VRTGLIV IFNIGCAFGGLTLG
Sbjct: 80  GFVFGWDTGTISGFVNMTDFKRRFGNYSQSEGTYYLSNVRTGLIVAIFNIGCAFGGLTLG 139

Query: 126 RLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISE 185
           RLGD+YGRR+GLMCVV VY+VGI+IQIA+ DKWYQYFIGRIISG+GVGGIAVLSPTLISE
Sbjct: 140 RLGDIYGRRLGLMCVVCVYVVGIIIQIATGDKWYQYFIGRIISGLGVGGIAVLSPTLISE 199

Query: 186 TAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGML 245
           TAPKH+RGTCV+FYQLMITLGIFLGYCTNYGTK Y+NSVQWRVPLG+ FA+AIFMIAGML
Sbjct: 200 TAPKHLRGTCVAFYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGMCFAWAIFMIAGML 259

Query: 246 MVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGEL 305
           +VPESPRFL+EKGR+E+A+RS+AKSNK+T+EDP + AE++ I A VE E+LAG+A+WGEL
Sbjct: 260 LVPESPRFLIEKGRFEEARRSIAKSNKLTVEDPGVSAEVELINAGVEAEKLAGSATWGEL 319

Query: 306 FSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFAST 365
           FS+KG IL RVIMG+MIQSLQQLTGNNYFFYYGTTIF AVGM DSFQTSIVLGIVNFAST
Sbjct: 320 FSSKGKILQRVIMGVMIQSLQQLTGNNYFFYYGTTIFQAVGMDDSFQTSIVLGIVNFAST 379

Query: 366 FVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTC 425
           FV L+TV+KFGRRKCLL GSASMA CFV+F++VGVT L+PNG+DQPSSK AGN MIVFTC
Sbjct: 380 FVGLWTVEKFGRRKCLLWGSASMASCFVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTC 439

Query: 426 LFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSY 485
            FIF FA +WAPIAYVIV+ESYPLRVKNRAMAI+VG+NWIWGFLIGFFTPFITSAI F Y
Sbjct: 440 FFIFCFATTWAPIAYVIVSESYPLRVKNRAMAISVGSNWIWGFLIGFFTPFITSAINFYY 499

Query: 486 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           GYVFMGCL           CETKGLTLEEVNEMY EGV PWKS SW+
Sbjct: 500 GYVFMGCLVFSYFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSDSWL 546

>CAGL0D02662g complement(278099..279793) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/538 (73%), Positives = 451/538 (83%), Gaps = 6/538 (1%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYT------NAELPAKPIAAYW 54
           MS+  +      ++ + +    +    + D+  ++ K           AE P KPI+AY+
Sbjct: 1   MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTADVSAMSPEAEAPPKPISAYF 60

Query: 55  TVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFN 114
           TVICLCLMIAFGGFVFGWDTGTISGFV QTDFKRRFGQ  +DG+YYLSDVRTGLIV IFN
Sbjct: 61  TVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAADGSYYLSDVRTGLIVAIFN 120

Query: 115 IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGG 174
           IGCA GGLTLGRLGDMYGRR+GLM V+ VY+VGIVIQI+S+  WYQYF+GRI+SG+GVGG
Sbjct: 121 IGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIVSGLGVGG 180

Query: 175 IAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNF 234
           IAVLSPTLISETAPKH+RGTCVSFYQLMITLGIFLGYCTNYGTK ++NS+QWRVPLGL F
Sbjct: 181 IAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWRVPLGLCF 240

Query: 235 AFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETE 294
           A+A+FM+ GM MVPESPRFLVEKGR+E+A+RSLA+SNKV+++DP + AE++ I A VE E
Sbjct: 241 AWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENISAGVEAE 300

Query: 295 RLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTS 354
           + AGNASWGELFS KG IL RV+MGIMIQSLQQLTG NYFFYYGTTIF AVG++DSFQTS
Sbjct: 301 KSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGLEDSFQTS 360

Query: 355 IVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSK 414
           I+LGIVNFASTFVALY VD+FGRRKCLL GS++MA+C VIF++VGV SLYPNGKDQPSS 
Sbjct: 361 IILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNGKDQPSST 420

Query: 415 AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFT 474
            AGNVMIVFTCL+IF FA +WAP AYVIVAE+YPLRVKNRAMAIAVG NWIWGFLIGFFT
Sbjct: 421 TAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWGFLIGFFT 480

Query: 475 PFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           PFIT+AI F YGYVFMGCL           CETKGLTLEEVNEMY EGV PWKS  W+
Sbjct: 481 PFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSAQWL 538

>CAGL0D02640g 274285..275979 highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 high-affinity
           hexose transporter, start by similarity
          Length = 564

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/538 (73%), Positives = 451/538 (83%), Gaps = 6/538 (1%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYT------NAELPAKPIAAYW 54
           MS+  +      ++ + +    +    + D+  ++ K           AE P KPI+AY+
Sbjct: 1   MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTADVSAMSPEAEAPPKPISAYF 60

Query: 55  TVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFN 114
           TVICLCLMIAFGGFVFGWDTGTISGFV QTDFKRRFGQ  +DG+YYLSDVRTGLIV IFN
Sbjct: 61  TVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAADGSYYLSDVRTGLIVAIFN 120

Query: 115 IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGG 174
           IGCA GGLTLGRLGDMYGRR+GLM V+ VY+VGIVIQI+S+  WYQYF+GRI+SG+GVGG
Sbjct: 121 IGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVGRIVSGLGVGG 180

Query: 175 IAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNF 234
           IAVLSPTLISETAPKH+RGTCVSFYQLMITLGIFLGYCTNYGTK ++NS+QWRVPLGL F
Sbjct: 181 IAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKTHTNSIQWRVPLGLCF 240

Query: 235 AFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETE 294
           A+A+FM+ GM MVPESPRFLVEKGR+E+A+RSLA+SNKV+++DP + AE++ I A VE E
Sbjct: 241 AWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARSNKVSMDDPIVTAEIENISAGVEAE 300

Query: 295 RLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTS 354
           + AGNASWGELFS KG IL RV+MGIMIQSLQQLTG NYFFYYGTTIF AVG++DSFQTS
Sbjct: 301 KSAGNASWGELFSTKGKILQRVVMGIMIQSLQQLTGCNYFFYYGTTIFKAVGLEDSFQTS 360

Query: 355 IVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSK 414
           I+LGIVNFASTFVALY VD+FGRRKCLL GS++MA+C VIF++VGV SLYPNGKDQPSS 
Sbjct: 361 IILGIVNFASTFVALYVVDRFGRRKCLLWGSSTMAVCMVIFASVGVKSLYPNGKDQPSST 420

Query: 415 AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFT 474
            AGNVMIVFTCL+IF FA +WAP AYVIVAE+YPLRVKNRAMAIAVG NWIWGFLIGFFT
Sbjct: 421 TAGNVMIVFTCLYIFCFATTWAPTAYVIVAETYPLRVKNRAMAIAVGFNWIWGFLIGFFT 480

Query: 475 PFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           PFIT+AI F YGYVFMGCL           CETKGLTLEEVNEMY EGV PWKS  W+
Sbjct: 481 PFITTAINFYYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSAQWL 538

>CAGL0I00286g complement(20521..22188) highly similar to sp|P23585
           Saccharomyces cerevisiae YMR011w HXT2 or sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 555

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/534 (76%), Positives = 456/534 (85%), Gaps = 12/534 (2%)

Query: 5   ATSRVESGSQQTSIHSTPIVQ------KLETDESPIQTKSEYTNAELPAKPIAAYWTVIC 58
           + S + S S       TP  +      +L+ DE+ IQ       AE+P KP+ AYWTV+C
Sbjct: 2   SQSAISSTSATDPERQTPETKLEGEDFQLKADEASIQ------GAEIPRKPLGAYWTVMC 55

Query: 59  LCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCA 118
           LCLMIAFGGFVFGWDTGTISGFV QTDFKRRFGQ  SDGTYYLS+VRTGLIV IFNIGCA
Sbjct: 56  LCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQRHSDGTYYLSNVRTGLIVAIFNIGCA 115

Query: 119 FGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVL 178
           FGGLTLGR GD+YGR+ GL+ VV VY+VGI+IQIAS DKWYQYFIGRIISG+GVGGIAVL
Sbjct: 116 FGGLTLGRTGDLYGRKKGLVIVVSVYVVGIIIQIASVDKWYQYFIGRIISGLGVGGIAVL 175

Query: 179 SPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAI 238
           SPTLISETAPKH+RGTCVSFYQLMITLGIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+
Sbjct: 176 SPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAL 235

Query: 239 FMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAG 298
           FMI GM MVPESPRFLVEKGR E+A+RS+A SNK++++DP +  E+DTI A VE ERLAG
Sbjct: 236 FMIGGMSMVPESPRFLVEKGRLEEARRSIAISNKLSMDDPGVTFELDTISAGVEAERLAG 295

Query: 299 NASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLG 358
           +ASWGELFSNKG ILPRVIMG+MIQSLQQLTGNNYFFYYGTTIF AVG++DSFQTSIVLG
Sbjct: 296 SASWGELFSNKGKILPRVIMGVMIQSLQQLTGNNYFFYYGTTIFKAVGLEDSFQTSIVLG 355

Query: 359 IVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGN 418
           IVNFASTFV L+TV++FGRR+CLL GSA+MA CFVIF++VGV SLYP+G+D  SSK AGN
Sbjct: 356 IVNFASTFVGLWTVERFGRRRCLLWGSATMAACFVIFASVGVKSLYPHGRDHASSKGAGN 415

Query: 419 VMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFIT 478
            MIVFTC FIF FA +WAPIAYVIV+E+YPLRVKNRAMAIAVG+NWIWGFLIGFFTPFIT
Sbjct: 416 CMIVFTCFFIFCFATTWAPIAYVIVSETYPLRVKNRAMAIAVGSNWIWGFLIGFFTPFIT 475

Query: 479 SAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           SAI FSYGYVFMGCL           CETKGLTLEEVN+MY EGV PWKS +W+
Sbjct: 476 SAINFSYGYVFMGCLVFSYFYVFFFVCETKGLTLEEVNDMYEEGVLPWKSPNWV 529

>Kwal_14.854
          Length = 570

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/525 (75%), Positives = 448/525 (85%), Gaps = 2/525 (0%)

Query: 9   VESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGF 68
           V S +   S   TP   KL  D    +T S   N E+P KP++ Y  V+CLCLM+AFGGF
Sbjct: 21  VSSPTDFDSQSRTP-SNKLSEDGFATKTTSPLENNEIPQKPLSEYILVMCLCLMVAFGGF 79

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRL 127
           VFGWDTGTISGFVN TDFKRRFG     +  Y LSDVRTGLIV IFNIGCA GGLTLGRL
Sbjct: 80  VFGWDTGTISGFVNMTDFKRRFGNFDVGEQKYVLSDVRTGLIVSIFNIGCAIGGLTLGRL 139

Query: 128 GDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETA 187
           GDMYGRR+GLM V+LVY+VGI+IQIASS+KWYQYFIGRI+SG+GVGGIAVLSPTLISETA
Sbjct: 140 GDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETA 199

Query: 188 PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMV 247
           PKH+RGTCVSFYQLMITLGIF+GYCTNYGTK YSN+VQW++PLGL F +AIFMIAGM+ V
Sbjct: 200 PKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAVQWKLPLGLCFLWAIFMIAGMIFV 259

Query: 248 PESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFS 307
           PESPR+L+EKG +E+AKRS+AKSNK+T+ED  ++AE++ I A VE E+LAGNASWGELFS
Sbjct: 260 PESPRYLIEKGNFEEAKRSIAKSNKLTVEDSGVLAEVELINAGVEAEKLAGNASWGELFS 319

Query: 308 NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFV 367
            KG IL RVIMG +IQSLQQLTGNNYFFYYGTTIF+AVGMKDSFQTSIVLG+VNFASTFV
Sbjct: 320 PKGKILQRVIMGCVIQSLQQLTGNNYFFYYGTTIFDAVGMKDSFQTSIVLGVVNFASTFV 379

Query: 368 ALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLF 427
            LYTV+++GRRKCLL GSA+M++CFV+F++VGVT LYPNGKD PSSK+AGN MI FTCLF
Sbjct: 380 GLYTVERYGRRKCLLWGSAAMSVCFVVFASVGVTKLYPNGKDMPSSKSAGNAMIFFTCLF 439

Query: 428 IFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGY 487
           IFFFA +WAPIAYVIV+E+YPLRVKNRAMA+AVG+NWIWGF IGF TPFITSAIGF YGY
Sbjct: 440 IFFFATTWAPIAYVIVSETYPLRVKNRAMAMAVGSNWIWGFAIGFGTPFITSAIGFYYGY 499

Query: 488 VFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           VFMGCL           CETKGLTLEEVNEMY EGV PWKS +W+
Sbjct: 500 VFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYQEGVLPWKSETWV 544

>Sklu_2362.1 YDR342C, Contig c2362 924-2642
          Length = 572

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/546 (66%), Positives = 433/546 (79%), Gaps = 14/546 (2%)

Query: 1   MSEFATSRVESGSQQTSIH-----------STPIVQKLETDESPIQTKSEYTNA--ELPA 47
           MS  A   +E+  Q T +            STP  +    D   ++   E T    E+PA
Sbjct: 1   MSTQAALELEAAGQDTPVDLHSNLSEVSQLSTPSNKASRDDLKDVRFPEEATEKVNEIPA 60

Query: 48  KPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSD-GTYYLSDVRT 106
           KP +AY TV  LCL +AFGGFVFGWDTGTISGFVNQTDFKRRFGQ     G YYLS+VRT
Sbjct: 61  KPTSAYITVCLLCLCVAFGGFVFGWDTGTISGFVNQTDFKRRFGQHNHKTGGYYLSNVRT 120

Query: 107 GLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRI 166
           GL+VGIFNIGCA GG+ L ++GD+YGRRIGLM V+LVY+V ++I IA+SDKWYQYFIGRI
Sbjct: 121 GLLVGIFNIGCAIGGIILSKIGDLYGRRIGLMSVILVYVVSVIISIAASDKWYQYFIGRI 180

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW 226
           ISG+GVGGIAVL+P LISETAPKH+RGT VS YQLMIT GIFLGYCTNYGTK+Y NSVQW
Sbjct: 181 ISGLGVGGIAVLAPMLISETAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYDNSVQW 240

Query: 227 RVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDT 286
           RVPLGL FA+A+F+IAGM+ VPESPR+LVE G+ E+A+RS+A+SNKVTIEDP + AE+D 
Sbjct: 241 RVPLGLGFAWALFVIAGMMFVPESPRYLVEVGKIEEARRSVARSNKVTIEDPGVQAEVDL 300

Query: 287 IMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVG 346
           I A VE E+L+G+ASW ELFS K  +L R+IMG M+Q LQQLTGNNYFFYYGTTIF +VG
Sbjct: 301 ITAGVEAEKLSGSASWSELFSTKTKVLQRLIMGAMLQCLQQLTGNNYFFYYGTTIFKSVG 360

Query: 347 MKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPN 406
           + DSFQTSIV+G+VNFASTFV +Y V+KFGRRKCLL G+ASM +C V++++VGVT L+PN
Sbjct: 361 LTDSFQTSIVIGVVNFASTFVGIYVVEKFGRRKCLLWGAASMMVCMVVYASVGVTRLWPN 420

Query: 407 GKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIW 466
           G+DQPSSK AGN MIVFTC +IF +A +WAPIA+V+ AES+PLRVK++ MAIA  +NWIW
Sbjct: 421 GEDQPSSKGAGNCMIVFTCFYIFCYATTWAPIAWVVTAESFPLRVKSKCMAIASASNWIW 480

Query: 467 GFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPW 526
           GFLI FFTPFITSAI F YGYVFMGCL            ETKGLTLEE+ E++ EGV PW
Sbjct: 481 GFLIAFFTPFITSAINFYYGYVFMGCLVFMYFYVFFFVPETKGLTLEEIQELWEEGVLPW 540

Query: 527 KSGSWI 532
           KS SW+
Sbjct: 541 KSASWV 546

>Scas_715.50
          Length = 559

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/511 (70%), Positives = 426/511 (83%), Gaps = 1/511 (0%)

Query: 22  PIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFV 81
           P  +++++ E  +  K +    E   KPI+AY+TVICLCLMIAFGGF+FGWD GTI GFV
Sbjct: 21  PDPKQIKSVED-VSLKVKTNENEGAPKPISAYFTVICLCLMIAFGGFIFGWDIGTIGGFV 79

Query: 82  NQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVV 141
            QTDFKRRFG++  +G YYLSDVRTGLIV  FN+GCAFGG+ LGRLGD YGR+IGL+CVV
Sbjct: 80  GQTDFKRRFGELNDEGEYYLSDVRTGLIVVTFNLGCAFGGIILGRLGDFYGRKIGLVCVV 139

Query: 142 LVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQL 201
            VY+VG+VIQI+S++ W QYFIGRI+SG+GVGGIAVLSPTLISE APKH+RG C+S YQL
Sbjct: 140 SVYVVGVVIQISSTNNWIQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGMCISLYQL 199

Query: 202 MITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYE 261
           MIT GIF+GYCTNYG+K Y+NS+QWR+PLGL FA+A+ M+ GM+MVPESPR+L+EKG++E
Sbjct: 200 MITGGIFVGYCTNYGSKSYTNSIQWRMPLGLGFAWALIMVLGMMMVPESPRYLIEKGKFE 259

Query: 262 DAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIM 321
           +AKRSLAKSNK T++DP ++ E D I A VE ER  GNASW ELFS KG +L RVIMGIM
Sbjct: 260 EAKRSLAKSNKTTVDDPIVLREFDVINAGVEAERAIGNASWAELFSTKGKVLQRVIMGIM 319

Query: 322 IQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCL 381
           +QSLQQLTG NYFFYYGTTIF AVGM DS+ TSIVLG+VNF+STF++L++V++FGRRKCL
Sbjct: 320 VQSLQQLTGCNYFFYYGTTIFQAVGMDDSYVTSIVLGVVNFSSTFISLWSVERFGRRKCL 379

Query: 382 LGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYV 441
           L GSASMA CFV+F+++GVT LYPNG DQP+SK+AGNVMIVF CLFIF FA+SWAPIA+V
Sbjct: 380 LWGSASMACCFVVFASMGVTKLYPNGMDQPTSKSAGNVMIVFACLFIFCFAVSWAPIAFV 439

Query: 442 IVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXX 501
           +VAESYP R+K RAMAIAV ANWIW F IGF TPFITSAI F YG+VF GCL        
Sbjct: 440 VVAESYPQRIKQRAMAIAVAANWIWNFAIGFCTPFITSAINFYYGFVFFGCLIFSFFYIF 499

Query: 502 XXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
              CETKGL+LEE NEMY EG  PWKS +WI
Sbjct: 500 FFVCETKGLSLEEFNEMYEEGTLPWKSDTWI 530

>AFL205C [2990] [Homologous to ScYHR094C - SH] (49039..50679) [1641
           bp, 546 aa]
          Length = 546

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/516 (67%), Positives = 416/516 (80%), Gaps = 6/516 (1%)

Query: 17  SIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGT 76
           S HS+    K   +E+      E    E+P KP +AY TV  LC+++AFGGF+FGWDTGT
Sbjct: 15  STHSSTASNKPSKEEN-----KESGLVEIPVKPASAYITVSLLCILVAFGGFIFGWDTGT 69

Query: 77  ISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIG 136
           ISGFVNQ+D+K RFG++   G YYLSD RTGLIV IFNIGCA GG+ L +  DMYGRRIG
Sbjct: 70  ISGFVNQSDYKNRFGELNESGDYYLSDNRTGLIVAIFNIGCAVGGIFLSKFADMYGRRIG 129

Query: 137 LMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCV 196
           LM V LVY++GIV+QI+S+DKWYQY IGR+ISG+GVGGIAVLSP LISET+PKH+RG  V
Sbjct: 130 LMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAVLSPMLISETSPKHLRGMLV 189

Query: 197 SFYQLMITLGIFLGYCTNYGTK-DYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLV 255
           S YQLMIT GIF+GYC NYGTK  Y +S QWR+PLGL+FA+AI MI GM++VPESPR+LV
Sbjct: 190 SCYQLMITAGIFVGYCANYGTKAKYEDSKQWRIPLGLSFAWAILMIGGMVLVPESPRYLV 249

Query: 256 EKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPR 315
           E  +YEDAKRSLA+SNKV ++DPSI AE D I A +E ER+AG+ASWGELFS K  IL R
Sbjct: 250 EVNKYEDAKRSLARSNKVPVDDPSIQAEFDNIHAGIELERMAGSASWGELFSTKSKILQR 309

Query: 316 VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKF 375
           VIMG+MIQSLQQLTGNNYFFYYGTTIF +VG++DSFQTSI+LG VNF STFVA++ V KF
Sbjct: 310 VIMGVMIQSLQQLTGNNYFFYYGTTIFKSVGLEDSFQTSIILGAVNFGSTFVAVWAVGKF 369

Query: 376 GRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISW 435
           GRR+ +L G+A+M +C VIF+++GVT L+PNG+DQPSSK AGNVMIVFTC++IF FA +W
Sbjct: 370 GRRRLMLAGAAAMTVCMVIFASIGVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFCFATTW 429

Query: 436 APIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXX 495
           API +VIV+E++PLRVK + MAIA  ANWIWGFLI FFTP IT+AI F+YGYVFMGCL  
Sbjct: 430 APIPFVIVSETFPLRVKAKGMAIATAANWIWGFLIAFFTPKITNAIKFNYGYVFMGCLIF 489

Query: 496 XXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
                     ETKGLTLEEV EM+ EGV PWKS SW
Sbjct: 490 AFFYMFFFVPETKGLTLEEVEEMWQEGVVPWKSESW 525

>Sklu_2376.5 , Contig c2376 9071-10810 reverse complement
          Length = 579

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/537 (69%), Positives = 432/537 (80%), Gaps = 9/537 (1%)

Query: 3   EFATSRVESGSQQTSIHSTPIVQKLET------DESPIQTKSEYTNAELPAKPIAAYWTV 56
           E   S+ ES  Q +  H++ I+   E       DE       +    +L  K  + Y  V
Sbjct: 19  EVTPSKSESFDQNS--HNSRIMNAPEAKGGQMGDEDEFDELQKAAEEQLAKKGTSEYLFV 76

Query: 57  ICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNI 115
              C+M+AFGGFVFGWDTGTISGFVN +DFKRRFGQ K S GTYYLSDVR GLIV IFNI
Sbjct: 77  SICCVMVAFGGFVFGWDTGTISGFVNMSDFKRRFGQYKHSTGTYYLSDVRVGLIVAIFNI 136

Query: 116 GCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGI 175
           GCA GG+ L ++G++YGRRIGLM VV++YI+GI+IQIAS DKWYQYFIGRIISG+GVGGI
Sbjct: 137 GCAIGGVVLSKIGEVYGRRIGLMAVVVIYIIGIIIQIASIDKWYQYFIGRIISGLGVGGI 196

Query: 176 AVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFA 235
            VLSP LISETAPKH+RGT ++ YQLMIT GIFLGYCTNYGTK+Y NSVQWRVPLGL FA
Sbjct: 197 TVLSPMLISETAPKHLRGTLIASYQLMITAGIFLGYCTNYGTKNYENSVQWRVPLGLCFA 256

Query: 236 FAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETER 295
           +AIFMI GML VPESPR+LVE G+ E+AKRS+A+SNKVTIEDP++  E+D I A VE E+
Sbjct: 257 WAIFMITGMLFVPESPRYLVEAGKIEEAKRSIARSNKVTIEDPAVQTEVDMICAGVEAEK 316

Query: 296 LAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSI 355
           LAG+ASW ELFS K  +L R+IMGIMIQSLQQLTG+NYFFYYGTTIF +VGM+DSF+TSI
Sbjct: 317 LAGSASWSELFSAKTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKSVGMEDSFETSI 376

Query: 356 VLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKA 415
           V+GIVNFASTF +LYTVDKFGRRKC+L G+++M  CFV+F++VGVT L+PNG+DQPSSK 
Sbjct: 377 VIGIVNFASTFFSLYTVDKFGRRKCMLWGASTMVACFVVFASVGVTRLWPNGQDQPSSKG 436

Query: 416 AGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTP 475
           AGN MIVFTC +IF FA +WAPIAYVIVAES+PLRVK++ MAIA  +NW+WGFLIGFFTP
Sbjct: 437 AGNCMIVFTCFYIFCFATTWAPIAYVIVAESFPLRVKSKGMAIATASNWLWGFLIGFFTP 496

Query: 476 FITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           FITSAI F YGYVFMGCL            ETKGLTLEEVNEM+ EGV PWKS SWI
Sbjct: 497 FITSAINFYYGYVFMGCLVFAYFYVFFFVPETKGLTLEEVNEMWEEGVLPWKSSSWI 553

>AFL207C [2988] [Homologous to ScAFL207C] (44349..45968) [1620 bp,
           539 aa]
          Length = 539

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/490 (70%), Positives = 408/490 (83%), Gaps = 1/490 (0%)

Query: 44  ELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSD 103
           ++P KP  AY TV  LC+ +AFGGF+FGWDTGTISGFVNQTDF+RRF Q+  +G YY S+
Sbjct: 32  DIPTKPATAYITVCLLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVNDEGGYYWSN 91

Query: 104 VRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFI 163
            R GLIV IFNIGCA GG+ L RLGDMYGRRIGLM V L+Y+VGI+IQI+S+ KWYQY I
Sbjct: 92  ARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCI 151

Query: 164 GRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKD-YSN 222
           GR+ISG+GVGGIAVLSP LISET+PKH+RGT VS YQLMIT GI LGYC NYGTK  Y +
Sbjct: 152 GRVISGLGVGGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKSRYDD 211

Query: 223 SVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVA 282
           S QWR+PLGL F +AIFMI GM  VPESPR+L+EK + E+AKRSLA SNKV ++DP+I+A
Sbjct: 212 SRQWRIPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDPAILA 271

Query: 283 EMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIF 342
           E++ I A VE ER+AG+ASWGELF+ +  IL RVIMG MIQSLQQLTGNNYFFYYGTTIF
Sbjct: 272 EVNNIQAGVELERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYYGTTIF 331

Query: 343 NAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTS 402
           ++VG++D+F+TSI+LG VNF STFVA+YTVD+FGRRKCLL G+A+MA+C VIF++VGVT 
Sbjct: 332 DSVGLEDAFKTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFASVGVTR 391

Query: 403 LYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGA 462
           L+PNG DQPSS+ AGN MIVFTCL+IFFFA +WAPIAYVIV+E++PLRVK + MAIA  A
Sbjct: 392 LWPNGPDQPSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMAIATAA 451

Query: 463 NWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEG 522
           NWIWGFLI FFTP+IT+AI F YGYVFMGCL            ETKGLTLEEV EM+ EG
Sbjct: 452 NWIWGFLIAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEEMWQEG 511

Query: 523 VKPWKSGSWI 532
           V PW+S SW+
Sbjct: 512 VVPWRSESWV 521

>Scas_628.7
          Length = 593

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/504 (70%), Positives = 408/504 (80%), Gaps = 2/504 (0%)

Query: 30  DESPIQTKSEYTNAELP--AKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFK 87
           D + I+ K E+     P  AKP A+Y+TVI LCL+IAFGGF+FGWDTGTISGFV QTDF 
Sbjct: 15  DSAQIEPKEEFIMDTEPSIAKPAASYFTVIILCLLIAFGGFIFGWDTGTISGFVAQTDFI 74

Query: 88  RRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVG 147
           +RFG  +SDG++ LSDVR GL+VGIFNIGC  GGL L   GD +GR+ GLM V  VY+VG
Sbjct: 75  KRFGTQQSDGSFALSDVRKGLMVGIFNIGCLLGGLFLAGAGDKWGRKPGLMLVAAVYVVG 134

Query: 148 IVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGI 207
           I+IQI SS KWYQYF+GRI+SGMGVGGIAVLSPTLISE APK +RGTC+S YQLMIT GI
Sbjct: 135 IIIQITSSTKWYQYFVGRIVSGMGVGGIAVLSPTLISEIAPKQLRGTCISLYQLMITGGI 194

Query: 208 FLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL 267
           FLGYC N+GTK Y+N+VQWR+PLGL FA+A FMI G+L VPESPR+L +KG+   AK SL
Sbjct: 195 FLGYCANFGTKRYNNAVQWRLPLGLGFAWAFFMIIGLLFVPESPRYLFKKGKISAAKHSL 254

Query: 268 AKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQ 327
           AKSNK T++D  +++E+D I A +E E  AGNASW ELFS K  I  RV MG+MIQSLQQ
Sbjct: 255 AKSNKTTVDDILVLSELDNIRAGIEAENNAGNASWKELFSLKNKIFQRVFMGVMIQSLQQ 314

Query: 328 LTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSAS 387
           LTG NYFFYYGTTIF AVGM DSF TSIVLG+VNFASTF+AL  V+  GRRKCLL GSAS
Sbjct: 315 LTGCNYFFYYGTTIFQAVGMDDSFVTSIVLGVVNFASTFIALGIVEWLGRRKCLLLGSAS 374

Query: 388 MAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESY 447
           MA CFVIF++VGVT L+PNGKDQP+SK AG+ MIVFTC+FIF FA +WAPI +VIVAESY
Sbjct: 375 MACCFVIFASVGVTRLWPNGKDQPTSKGAGDCMIVFTCIFIFCFATTWAPIGFVIVAESY 434

Query: 448 PLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCET 507
           PLRVK RAMAIA+GANWIWGFLIGFFTPFITSAI F YG+VFMGCL            ET
Sbjct: 435 PLRVKQRAMAIAIGANWIWGFLIGFFTPFITSAINFYYGFVFMGCLIFSFFYVFFFVRET 494

Query: 508 KGLTLEEVNEMYVEGVKPWKSGSW 531
           KGLTLEEV+EMY+E +KPWKS SW
Sbjct: 495 KGLTLEEVDEMYLENIKPWKSASW 518

>Sklu_2415.2 YJL214W, Contig c2415 2182-3897 reverse complement
          Length = 571

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/516 (66%), Positives = 418/516 (81%), Gaps = 3/516 (0%)

Query: 20  STPIVQKLETDESPIQTKSEYTN--AELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTI 77
           STP  +    D   ++ ++E T   AE+P KP +AY TV  +CL +AFGGFV GWDTGTI
Sbjct: 30  STPSNKASRADLDELKFQAEETEIVAEIPKKPASAYITVSIMCLCVAFGGFVVGWDTGTI 89

Query: 78  SGFVNQTDFKRRFGQM-KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIG 136
           SGFVNQTDFKRRFG+   S   YYLS+VR GLIV IFN+GCA GGL L +LGD+YGR IG
Sbjct: 90  SGFVNQTDFKRRFGEYSHSKDEYYLSNVRVGLIVSIFNVGCAVGGLVLSKLGDIYGRCIG 149

Query: 137 LMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCV 196
           LM V +VY+VGIVIQI+S DKWYQYFIGRI+SG+GVGG+ VL+P LISETAPKH+RGT +
Sbjct: 150 LMAVTIVYVVGIVIQISSVDKWYQYFIGRIVSGLGVGGVCVLAPMLISETAPKHLRGTLL 209

Query: 197 SFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVE 256
           + +QLM+T  IFLGYC NYGTK Y NSVQWRVPLGL FA+AI M+ GM  VPESPRFLV+
Sbjct: 210 ACWQLMVTFAIFLGYCANYGTKSYDNSVQWRVPLGLCFAWAIIMVVGMCFVPESPRFLVK 269

Query: 257 KGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRV 316
            GR EDAKRS+AKSNK+++EDP++ AE+D I A VE E+LAG++SWGELFS K  +  R+
Sbjct: 270 VGRVEDAKRSVAKSNKISVEDPAVQAEVDLIAAGVEVEKLAGSSSWGELFSKKTKVFQRL 329

Query: 317 IMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFG 376
           +M +MI SLQQL+G+NYFFYYGTTIF +VGM+DSF+TSIV+GI+NFASTF++LYT+DK G
Sbjct: 330 VMSVMINSLQQLSGDNYFFYYGTTIFKSVGMEDSFETSIVIGIINFASTFLSLYTLDKLG 389

Query: 377 RRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWA 436
           RR+ LL G+A M +C +I+++VGVT LYP+GKDQPSSK AGN MIVFTCL+IFFFA +W 
Sbjct: 390 RRRSLLWGAAIMTVCMLIYASVGVTRLYPDGKDQPSSKPAGNCMIVFTCLYIFFFANTWG 449

Query: 437 PIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXX 496
           P  YVI++ES+PLRVK++ M++A GAN++WGFLIGFFTPFITSAI F YGYVFMGCL   
Sbjct: 450 PTCYVIISESFPLRVKSKCMSVATGANYLWGFLIGFFTPFITSAINFYYGYVFMGCLVFS 509

Query: 497 XXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
                    ETKGLTLEEV EM+ EGV PWKS SW+
Sbjct: 510 YFYVFFFVPETKGLTLEEVEEMWHEGVLPWKSESWV 545

>Scas_658.24
          Length = 570

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/543 (65%), Positives = 423/543 (77%), Gaps = 13/543 (2%)

Query: 1   MSEFAT-------SRVESGSQQTSIHSTPIVQKLETDE----SPIQTKSEYTNAELPAKP 49
           MSE A        + +ES +   S+ STP  +    DE      I  +      E+P +P
Sbjct: 1   MSELAEQTPIEQETPIESATH--SVISTPSNKAERDDEKYGSDDIDAEVNPEVVEIPKRP 58

Query: 50  IAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLI 109
            +AY TV  +C+MIAFGGFVFGWDTGTISGFV QTDF RRFGQ   +GT+YLS VR GL+
Sbjct: 59  ASAYVTVSIMCIMIAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTHYLSKVRMGLM 118

Query: 110 VGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISG 169
           V IFNIGCAFGG+ L + GD+YGR++GL+ VV +YIVGIVIQIAS   WYQYFIGRIISG
Sbjct: 119 VSIFNIGCAFGGIILAKSGDIYGRKMGLIIVVCIYIVGIVIQIASVKAWYQYFIGRIISG 178

Query: 170 MGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVP 229
           +GVGGIAVLSP LISE +PKH+RGT VS YQLMIT GIFLGYCTNYGTK+YSNSVQWRVP
Sbjct: 179 LGVGGIAVLSPMLISEVSPKHMRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVP 238

Query: 230 LGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMA 289
           LGL FA+A+FMI GM  VPESPR+LVE G+ E+AKRS+A SNK++ +DP+++AE+D + A
Sbjct: 239 LGLCFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKISADDPAVLAEVDNVQA 298

Query: 290 NVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD 349
            VE E+LAGNASWGELF  K  I  R++MG MIQ LQQLTG+NYFFYYGT +F +VG++D
Sbjct: 299 GVEAEKLAGNASWGELFQTKNKIFQRLVMGCMIQCLQQLTGDNYFFYYGTIVFKSVGLED 358

Query: 350 SFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKD 409
           SFQTSIV+G+VNF STF ALYTVD+FGRR+CLL G+A+  +CFVI+++VGVT LYPNGKD
Sbjct: 359 SFQTSIVIGVVNFFSTFFALYTVDRFGRRRCLLWGAATTTVCFVIYASVGVTRLYPNGKD 418

Query: 410 QPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFL 469
           QPSSK AGN MIVFTC +IF FA +WAPI +VI +E++PLRVK++ M++A G NW+WGFL
Sbjct: 419 QPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVINSETFPLRVKSKCMSLAQGCNWLWGFL 478

Query: 470 IGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSG 529
           I FFTPFIT AI F YGYVFMGCL            ETKGLTLEEVN M+ EGV PWKS 
Sbjct: 479 ISFFTPFITGAINFYYGYVFMGCLCFSFFYVFFFVPETKGLTLEEVNTMWEEGVLPWKST 538

Query: 530 SWI 532
            W+
Sbjct: 539 EWV 541

>Kwal_55.20075
          Length = 571

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/531 (68%), Positives = 432/531 (81%), Gaps = 9/531 (1%)

Query: 8   RVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAE----LPAKPIAAYWTVICLCLMI 63
            V S   Q S  STP  +    D   ++    Y +AE    +P KP +AY TV+ LCL +
Sbjct: 18  EVRSAVSQGSQLSTPSNKASRDD---LKDAQFYEDAEKEVIIPKKPASAYITVVILCLCV 74

Query: 64  AFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLT 123
           AFGGFVFGWDTGTISGFV Q+DFKRRFGQ  S G +YLS+VRTGLIV IFNIGCAFGG+ 
Sbjct: 75  AFGGFVFGWDTGTISGFVAQSDFKRRFGQTNSKGQHYLSNVRTGLIVSIFNIGCAFGGIL 134

Query: 124 LGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
           L ++GD++GRRIGLM VV+VY+VGI+IQIAS DKWYQYFIGRIISG+GVGGIAVLSP LI
Sbjct: 135 LSKIGDVWGRRIGLMAVVVVYVVGIIIQIASQDKWYQYFIGRIISGLGVGGIAVLSPMLI 194

Query: 184 SETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAG 243
           SETAPKH+RGT V+ YQLMIT GIFLGYCTNYG K+YSNS+QWRVPLGL FA+A+FMI G
Sbjct: 195 SETAPKHLRGTLVACYQLMITCGIFLGYCTNYGVKNYSNSIQWRVPLGLCFAWALFMIGG 254

Query: 244 MLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWG 303
           M+ VPESPR+LVEKGR EDAK S+A+SNK+++EDPS+  E+D I A VE E+LAG+AS+ 
Sbjct: 255 MMFVPESPRYLVEKGRIEDAKVSIARSNKISVEDPSVQVEVDLISAGVEAEKLAGSASFK 314

Query: 304 ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFA 363
           ELFS K  +L R+IMGIM+QSLQQLTG+NYFFYYGT IF +VG+ DSFQTSI++GIVNFA
Sbjct: 315 ELFSAKTKVLQRLIMGIMLQSLQQLTGDNYFFYYGTIIFKSVGLNDSFQTSIIIGIVNFA 374

Query: 364 STFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP--SSKAAGNVMI 421
           STFV ++TV+KFGRR+CLL G+ASM +CFVI+++VGVT LYP+G + P  S+K AGN MI
Sbjct: 375 STFVGIFTVEKFGRRRCLLWGAASMVVCFVIYASVGVTRLYPDGANHPQNSNKGAGNCMI 434

Query: 422 VFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI 481
           VFTC +IF FA +WAPIAYV+V+ES+PLRVK++AMA+A  ANW+WGFLI FFTPFITSAI
Sbjct: 435 VFTCFYIFCFATTWAPIAYVVVSESFPLRVKSKAMALATAANWLWGFLIAFFTPFITSAI 494

Query: 482 GFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
            F YGYVFMGCL            ETKGLTLEEV E++ EGV PWKS SW+
Sbjct: 495 HFYYGYVFMGCLVFAYFYVFFFVPETKGLTLEEVQELWEEGVLPWKSTSWV 545

>YDR343C (HXT6) [1171] chr4 complement(1159598..1161310)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt7p [1713 bp, 570 aa]
          Length = 570

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/528 (68%), Positives = 428/528 (81%), Gaps = 5/528 (0%)

Query: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTN--AELPAKPIAAYWTVICLCLMIA 64
           S V+S S   S+ STP   K E DE     + E      E+P +P +AY TV  +C+MIA
Sbjct: 17  SAVDSASH--SVLSTP-SNKAERDEIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCIMIA 73

Query: 65  FGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTL 124
           FGGFVFGWDTGTISGF+NQTDF RRFG    DGT YLS VRTGLIV IFNIGCA GG+ L
Sbjct: 74  FGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVSIFNIGCAIGGIIL 133

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
            +LGDMYGR++GL+ VV++YI+GI+IQIAS +KWYQYFIGRIISG+GVGGIAVLSP LIS
Sbjct: 134 SKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLIS 193

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244
           E +PKH+RGT VS YQLMIT GIFLGYCTN+GTK+YSNSVQWRVPLGL FA+A+FMI GM
Sbjct: 194 EVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGM 253

Query: 245 LMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGE 304
             VPESPR+L E G+ E+AKRS+A SNKV ++DPS++AE++ ++A VE E+LAGNASWGE
Sbjct: 254 TFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNASWGE 313

Query: 305 LFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFAS 364
           LFS+K  +L R+IMG MIQSLQQLTG+NYFFYYGTTIF AVG+ DSF+TSIVLGIVNFAS
Sbjct: 314 LFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFAS 373

Query: 365 TFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFT 424
           TFV +Y V+++GRR CLL G+ASM  C V++++VGVT L+PNG+DQPSSK AGN MIVF 
Sbjct: 374 TFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFA 433

Query: 425 CLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFS 484
           C +IF FA +WAPI YV+V+E++PLRVK++AM+IA  ANW+WGFLIGFFTPFIT AI F 
Sbjct: 434 CFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFY 493

Query: 485 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           YGYVFMGCL            ETKGLTLEEVN M+ EGV PWKS SW+
Sbjct: 494 YGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWV 541

>YDR342C (HXT7) [1170] chr4 complement(1154206..1155918)
           High-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), nearly identical to Hxt6p [1713 bp, 570 aa]
          Length = 570

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/528 (68%), Positives = 428/528 (81%), Gaps = 5/528 (0%)

Query: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTN--AELPAKPIAAYWTVICLCLMIA 64
           S V+S S   S+ STP   K E DE     + E      E+P +P +AY TV  +C+MIA
Sbjct: 17  SAVDSASH--SVLSTP-SNKAERDEIKAYGEGEEHEPVVEIPKRPASAYVTVSIMCIMIA 73

Query: 65  FGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTL 124
           FGGFVFGWDTGTISGF+NQTDF RRFG    DGT YLS VRTGLIV IFNIGCA GG+ L
Sbjct: 74  FGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVSIFNIGCAIGGIIL 133

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
            +LGDMYGR++GL+ VV++YI+GI+IQIAS +KWYQYFIGRIISG+GVGGIAVLSP LIS
Sbjct: 134 SKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPMLIS 193

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244
           E +PKH+RGT VS YQLMIT GIFLGYCTN+GTK+YSNSVQWRVPLGL FA+A+FMI GM
Sbjct: 194 EVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIGGM 253

Query: 245 LMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGE 304
             VPESPR+L E G+ E+AKRS+A SNKV ++DPS++AE++ ++A VE E+LAGNASWGE
Sbjct: 254 TFVPESPRYLAEVGKIEEAKRSIAVSNKVAVDDPSVLAEVEAVLAGVEAEKLAGNASWGE 313

Query: 305 LFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFAS 364
           LFS+K  +L R+IMG MIQSLQQLTG+NYFFYYGTTIF AVG+ DSF+TSIVLGIVNFAS
Sbjct: 314 LFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLSDSFETSIVLGIVNFAS 373

Query: 365 TFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFT 424
           TFV +Y V+++GRR CLL G+ASM  C V++++VGVT L+PNG+DQPSSK AGN MIVF 
Sbjct: 374 TFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFA 433

Query: 425 CLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFS 484
           C +IF FA +WAPI YV+V+E++PLRVK++AM+IA  ANW+WGFLIGFFTPFIT AI F 
Sbjct: 434 CFYIFCFATTWAPIPYVVVSETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAINFY 493

Query: 485 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           YGYVFMGCL            ETKGLTLEEVN M+ EGV PWKS SW+
Sbjct: 494 YGYVFMGCLVFMFFYVLLVVPETKGLTLEEVNTMWEEGVLPWKSASWV 541

>YLR081W (GAL2) [3496] chr12 (290213..291937) Galactose and glucose
           permease (facilitated diffusion transporter), member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1725 bp, 574 aa]
          Length = 574

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/518 (66%), Positives = 410/518 (79%), Gaps = 4/518 (0%)

Query: 19  HSTPIVQKLETDESPI-QTKSEYTNA---ELPAKPIAAYWTVICLCLMIAFGGFVFGWDT 74
           H +   QK   DE    ++ SE + +   E+P KP++ Y TV  LCL +AFGGF+FGWDT
Sbjct: 30  HLSAQSQKYSNDELKAGESGSEGSQSVPIEIPKKPMSEYVTVSLLCLCVAFGGFMFGWDT 89

Query: 75  GTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRR 134
           GTISGFV QTDF RRFG    DGT+YLS+VRTGLIV IFNIGCAFGG+ L + GDMYGR+
Sbjct: 90  GTISGFVVQTDFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGGIILSKGGDMYGRK 149

Query: 135 IGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGT 194
            GL  VV VYIVGI+IQIAS +KWYQYFIGRIISG+GVGGIAVL P LISE APKH+RGT
Sbjct: 150 KGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISEIAPKHLRGT 209

Query: 195 CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFL 254
            VS YQLMIT GIFLGYCTNYGTK YSNSVQWRVPLGL FA+++FMI  + +VPESPR+L
Sbjct: 210 LVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWSLFMIGALTLVPESPRYL 269

Query: 255 VEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILP 314
            E  + EDAKRS+AKSNKV+ EDP++ AE+D IMA +E E+LAGNASWGELFS K  +  
Sbjct: 270 CEVNKVEDAKRSIAKSNKVSPEDPAVQAELDLIMAGIEAEKLAGNASWGELFSTKTKVFQ 329

Query: 315 RVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDK 374
           R++MG+ +Q  QQLTGNNYFFYYGT IF +VG+ DSF+TSIV+G+VNFASTF +L+TV+ 
Sbjct: 330 RLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVGLDDSFETSIVIGVVNFASTFFSLWTVEN 389

Query: 375 FGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAIS 434
            G RKCLL G+A+M  C VI+++VGVT LYP+GK QPSSK AGN MIVFTC +IF +A +
Sbjct: 390 LGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKSQPSSKGAGNCMIVFTCFYIFCYATT 449

Query: 435 WAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLX 494
           WAP+A+VI AES+PLRVK++ MA+A  +NW+WGFLI FFTPFITSAI F YGYVFMGCL 
Sbjct: 450 WAPVAWVITAESFPLRVKSKCMALASASNWVWGFLIAFFTPFITSAINFYYGYVFMGCLV 509

Query: 495 XXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
                      ETKGL+LEE+ E++ EGV PWKS  WI
Sbjct: 510 AMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSEGWI 547

>YHR092C (HXT4) [2382] chr8 complement(287131..288813) Moderate- to
           low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1683 bp, 560 aa]
          Length = 560

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/529 (67%), Positives = 420/529 (79%), Gaps = 4/529 (0%)

Query: 5   ATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTN--AELPAKPIAAYWTVICLCLM 62
           A S VES S   S  STP  +    D        E +N   E+P KP +AY TV   CLM
Sbjct: 20  ALSPVESDSN--SALSTPSNKAERDDMKDFDENHEESNNYVEIPKKPASAYVTVSICCLM 77

Query: 63  IAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGL 122
           +AFGGFVFGWDTGTISGFV QTDF RRFG    DGTYYLS VRTGLIV IFNIGCA GG+
Sbjct: 78  VAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSIFNIGCAIGGI 137

Query: 123 TLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTL 182
            L +LGDMYGR++GL+ VV++YI+GI+IQIAS +KWYQYFIGRIISG+GVGGIAVLSP L
Sbjct: 138 ILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPML 197

Query: 183 ISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIA 242
           ISE +PKHIRGT VS YQLMITLGIFLGYCTNYGTK Y+NSVQWRVPLGL FA+A+FMI 
Sbjct: 198 ISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGLGFAWALFMIG 257

Query: 243 GMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASW 302
           GM  VPESPR+LVE G+ E+AKRS+A SNKV+ +DP+++AE++ + A VE E+LAGNASW
Sbjct: 258 GMTFVPESPRYLVEVGKIEEAKRSIALSNKVSADDPAVMAEVEVVQATVEAEKLAGNASW 317

Query: 303 GELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNF 362
           GE+FS K  +  R+IMG MIQSLQQLTG+NYFFYYGTT+F AVG++DSF+TSIVLGIVNF
Sbjct: 318 GEIFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGLEDSFETSIVLGIVNF 377

Query: 363 ASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIV 422
           ASTFV ++ V+++GRR+CLL G+ASM  C V+F++VGVT L+PNGK   SSK AGN MIV
Sbjct: 378 ASTFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRLWPNGKKNGSSKGAGNCMIV 437

Query: 423 FTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIG 482
           FTC ++F FA +WAPI +V+ +E++PLRVK++ MAIA   NWIWGFLIGFFTPFI+ AI 
Sbjct: 438 FTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCMAIAQACNWIWGFLIGFFTPFISGAID 497

Query: 483 FSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
           F YGYVFMGCL            ETKGLTLEEVN ++ EGV PWKS SW
Sbjct: 498 FYYGYVFMGCLVFSYFYVFFFVPETKGLTLEEVNTLWEEGVLPWKSPSW 546

>YOL156W (HXT11) [4669] chr15 (25272..26975) Low-affinity glucose
           permease, member of the hexose transporter family of the
           major facilitator superfamily (MFS), may be involved in
           uptake of drugs [1704 bp, 567 aa]
          Length = 567

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/527 (63%), Positives = 410/527 (77%), Gaps = 18/527 (3%)

Query: 8   RVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGG 67
           + E G  + S++       L+ +E PI         +LP KP++AY TV  LCLMIAFGG
Sbjct: 29  KTEHGDSKNSLN-------LDANEPPI---------DLPQKPLSAYTTVAILCLMIAFGG 72

Query: 68  FVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRL 127
           F+FGWDTGTISGFVN +DF RRFGQ    GTYYLS VR GLIV IFNIGCA GG+ L ++
Sbjct: 73  FIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNIGCAIGGIVLSKV 132

Query: 128 GDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETA 187
           GD+YGRRIGL+ V  +Y+VGI+IQI S +KWYQYFIGRIISG+GVGGIAVLSP LISE A
Sbjct: 133 GDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVLSPMLISEVA 192

Query: 188 PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMV 247
           PKHIRGT V  YQLM T+GIFLGYCTNYGTK+Y N+ QWRV LGL FA+A FM++GM+ V
Sbjct: 193 PKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWATFMVSGMMFV 252

Query: 248 PESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFS 307
           PESPR+L+E G+ E+AKRSL+KSNKV+++DP+++ E DTI A +E E+LAGNASW EL S
Sbjct: 253 PESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEKLAGNASWSELLS 312

Query: 308 NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFV 367
            K  +  RV+MG+MIQSLQQLTG+NYFFYYGTTIF +VG+KDSFQTSI++G+VNF S+F+
Sbjct: 313 TKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVVNFFSSFI 372

Query: 368 ALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP--SSKAAGNVMIVFTC 425
           A+YT+++FGRR CLL G+ASM  CF +F++VGVT L+P G      +S+ AGN MIVFT 
Sbjct: 373 AVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGAGNCMIVFTM 432

Query: 426 LFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSY 485
            FIF FA +WA   YVIV+E++PLRVK+R MAIA  ANW+WGFLI FFTPFIT AI F Y
Sbjct: 433 FFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPFITGAINFYY 492

Query: 486 GYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           GYVF+GCL            ETKGLTLEEVN M++EGV  WKS SW+
Sbjct: 493 GYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWV 539

>CAGL0A02211g complement(224864..226522) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 552

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/524 (66%), Positives = 420/524 (80%), Gaps = 1/524 (0%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSE-YTNAELPAKPIAAYWTVICLCLMIAFGGF 68
           +  S+  S+ S    +    DE       E     E+P KP +AY ++   CL IAFGGF
Sbjct: 3   DQESRSQSVLSASNSKADREDEFKAYVDEEGQPMVEIPKKPASAYVSISIFCLFIAFGGF 62

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLG 128
           VFGWDTGTISGFV QTDF RR GQ +++GT+YLS VRTGL+V IFNIGCA GG+ L +LG
Sbjct: 63  VFGWDTGTISGFVAQTDFIRRLGQTRANGTHYLSKVRTGLVVSIFNIGCAIGGIVLSKLG 122

Query: 129 DMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAP 188
           DMYGR+IGL+ VV++YIVGIVIQIA+ DKWYQYFIGRIISG+GVGGIAVLSP LISE +P
Sbjct: 123 DMYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSP 182

Query: 189 KHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVP 248
           KH+RG+ VS YQLMIT GIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+FMI GM  VP
Sbjct: 183 KHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVP 242

Query: 249 ESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSN 308
           ESPR+L+E GR E+A+RS+A SNKV+ +DP++  E++ + A VE ERLAG+ASWGELFS 
Sbjct: 243 ESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVENVQAAVEAERLAGSASWGELFST 302

Query: 309 KGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVA 368
           K  +  R+IMGIMIQSLQQLTG+NYFFYYGTT+F AVG++DSF+TSIV+GIVNFASTFVA
Sbjct: 303 KTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFASTFVA 362

Query: 369 LYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFI 428
           LY VD+FGRR+CLL G+A+M  C V+F++VGVT L+PNG+DQPSSK AGN MIVFTC +I
Sbjct: 363 LYVVDRFGRRRCLLWGAAAMTACMVVFASVGVTRLWPNGQDQPSSKGAGNCMIVFTCFYI 422

Query: 429 FFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYV 488
           F FA +WAPI +V+ +E++PLRVK + MAIA  +NWIWGFLI FFTPFIT+AI F YGYV
Sbjct: 423 FCFATTWAPIPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFYYGYV 482

Query: 489 FMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           FMGCL            ETKGLTLEEVN ++ EGV PWKS +W+
Sbjct: 483 FMGCLCFSYFYVFFFIPETKGLTLEEVNTLWEEGVLPWKSPNWV 526

>YJL219W (HXT9) [2711] chr10 (19497..21200) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS), may play a role in drug uptake [1704 bp, 567 aa]
          Length = 567

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/523 (63%), Positives = 408/523 (78%), Gaps = 3/523 (0%)

Query: 13  SQQTSIHSTPIVQKLETD-ESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFG 71
           S   S+ + P V+    D ++ +   +     +LP KP++AY TV  LCLMIAFGGF+FG
Sbjct: 17  SNSNSVANAPSVKTEHNDSKNSLNLDATEPPIDLPQKPLSAYTTVAILCLMIAFGGFIFG 76

Query: 72  WDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMY 131
           WDTGTISGFVN +DF RRFGQ    GTYYLS VR GLIV IFNIGCA GG+ L ++GD+Y
Sbjct: 77  WDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNIGCAIGGIVLSKVGDIY 136

Query: 132 GRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHI 191
           GRRIGL+ V  +Y+VGI+IQI S +KWYQYFIGRIISG+GVGGIAVLSP LISE APK I
Sbjct: 137 GRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAVLSPMLISEVAPKQI 196

Query: 192 RGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESP 251
           RGT V  YQLM T+GIFLGYCTNYGTK+Y N+ QWRV LGL FA+  FM++GM+ VPESP
Sbjct: 197 RGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFAWTTFMVSGMMFVPESP 256

Query: 252 RFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGA 311
           R+L+E G+ E+AKRSL+KSNKV+++DP+++AE DTI A +E E+LAGNASW EL S K  
Sbjct: 257 RYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTIKAGIELEKLAGNASWSELLSTKTK 316

Query: 312 ILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYT 371
           +  RV+MG+MIQSLQQLTG+NYFFYYGTTIF +VG+KDSFQTSI++G+VNF S+F+A+YT
Sbjct: 317 VFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSIIIGVVNFFSSFIAVYT 376

Query: 372 VDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP--SSKAAGNVMIVFTCLFIF 429
           +++FGRR CLL G+ASM  CF +F++VGVT L+P G      +S+ AGN MIVFT  FIF
Sbjct: 377 IERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITSQGAGNCMIVFTMFFIF 436

Query: 430 FFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVF 489
            FA +WA   YVIV+E++PLRVK+R MAIA  ANW+WGFLI FFTPFIT AI F YGYVF
Sbjct: 437 SFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFFTPFITGAINFYYGYVF 496

Query: 490 MGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           +GCL            ETKGLTLEEVN M++EGV  WKS SW+
Sbjct: 497 LGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWV 539

>KLLA0D13310g complement(1143027..1144730)
           gi|131828|sp|P18631|RAG1_KLULA Kluyveromyces lactis
           Low-affinity glucose transporter, start by similarity
          Length = 567

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/507 (68%), Positives = 410/507 (80%), Gaps = 5/507 (0%)

Query: 28  ETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFK 87
           E D + ++  +E T   L  KP   Y  V   C+M+AFGGFVFGWDTGTISGFVNQTDF 
Sbjct: 38  EEDLNDLEKTAEET---LQQKPAKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFL 94

Query: 88  RRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVG 147
           RRFGQ K+DG++YLS+VRTGLIV IFNIGCA GG+ L  +GD +GRRIGL+ V+++Y++G
Sbjct: 95  RRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIG 154

Query: 148 IVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGI 207
           I+IQIAS DKWYQYFIGRIISG+GVGGI VLSP LISETAPKH+RGT VS YQLMIT GI
Sbjct: 155 IIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGI 214

Query: 208 FLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL 267
           FLGYCTNYGTK+YSNSVQWRVPLGL FA+AIFM+ GM+ VPES RFLVE  + E+A++SL
Sbjct: 215 FLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSL 274

Query: 268 AKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQ 327
           AK+NKV+I+DP +  E+  I +++E E+ AGNASWGEL + K ++  R +MGIMIQSLQQ
Sbjct: 275 AKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQ 334

Query: 328 LTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSAS 387
           LTG+NYFFYYGTTIF +VGM DSF+TSIVLGIVNFASTF ALYTVD FGRR CLL G   
Sbjct: 335 LTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVG 394

Query: 388 MAICFVIFSTVGVTSLYPNGKDQP--SSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAE 445
           M  C+V++++VGVT L+P+G D P  SSK AGN MIVF C +IF FA +WAPIAYV+++E
Sbjct: 395 MVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISE 454

Query: 446 SYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXC 505
           SYPLRVK +AMAIA  +NWIWGFLIGFFTPFITSAI F YGYVFMGC+            
Sbjct: 455 SYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVP 514

Query: 506 ETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           ETKGLTLEEVNEMY EGV PWKS SW+
Sbjct: 515 ETKGLTLEEVNEMYSEGVLPWKSSSWV 541

>CAGL0A01782g complement(170326..172032) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 568

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/523 (66%), Positives = 421/523 (80%), Gaps = 6/523 (1%)

Query: 11  SGSQQTSIHSTPIVQKLETDESPIQTKSEYTN-AELPAKPIAAYWTVICLCLMIAFGGFV 69
           S SQQ S  S       E D   ++ ++E T   ++P KP +AY TV   CL IAFGGFV
Sbjct: 25  SLSQQDSSAS-----PYENDVKKLEEEAEQTPIVDIPKKPASAYVTVSIFCLFIAFGGFV 79

Query: 70  FGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGD 129
           FGWDTGTISGFV QTDF RR GQ +++GT+YLS VRTGL+V IFNIGCA GG+ L +LGD
Sbjct: 80  FGWDTGTISGFVAQTDFIRRLGQKRANGTHYLSKVRTGLVVSIFNIGCAIGGVILSKLGD 139

Query: 130 MYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPK 189
           +YGR+ GL+ VV++Y+VGI+IQIA+ DKWYQYFIGRIISG+GVGGIAVLSP LISE +PK
Sbjct: 140 VYGRKPGLIIVVVIYVVGIIIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPK 199

Query: 190 HIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPE 249
           H+R T V+ YQLMITLGIFLGYCTN+GTK+YSNSVQWRVPLGL FA+AIFMI+GM  VPE
Sbjct: 200 HLRATLVACYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMISGMTFVPE 259

Query: 250 SPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNK 309
           SPRFLVEKGR EDAKRS+A SNKV+++DP++VAE+D++ A VE ERLAG+ASWGELFS K
Sbjct: 260 SPRFLVEKGRIEDAKRSIASSNKVSVDDPAVVAEVDSVQAAVEAERLAGSASWGELFSTK 319

Query: 310 GAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVAL 369
             I  R++MGIMIQSLQQLTG+NYFFYYGT +F AVG++DSF+TSIV+G+VNF STFV +
Sbjct: 320 TKIFQRLVMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVIGVVNFFSTFVGI 379

Query: 370 YTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIF 429
           + V +FGRR CLL G+A+M  C V+F++VGVT L+P+GK   SSK AGN MIVFTC +IF
Sbjct: 380 FLVGRFGRRTCLLWGAATMTACMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVFTCFYIF 439

Query: 430 FFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVF 489
            FA +WAP+A+VI +E++PLRVK + MA+A  +NWIWGFLI FFTPFIT AI F+YGYVF
Sbjct: 440 CFATTWAPLAFVICSETFPLRVKAKCMALAQASNWIWGFLISFFTPFITDAINFNYGYVF 499

Query: 490 MGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           MGCL            ETKGLTLEEVN M+ EGV PWK+  W+
Sbjct: 500 MGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKASQWV 542

>CAGL0A01826g complement(179321..180922) highly similar to sp|P38695
           Saccharomyces cerevisiae YHR096c HXT5, hypothetical
           start
          Length = 533

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/473 (71%), Positives = 397/473 (83%)

Query: 60  CLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAF 119
           C+M+AFGGFVFGWDTGTISGFVNQTDF RRFGQ +SDGTYYLS+VRTGLIV IFNIGCA 
Sbjct: 32  CIMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQQRSDGTYYLSNVRTGLIVAIFNIGCAI 91

Query: 120 GGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLS 179
           GG+TL +LGD++GRR+GL+ VV+VY +GIVIQIAS DKWYQYFIGRIISG+GVGGIAVLS
Sbjct: 92  GGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFIGRIISGLGVGGIAVLS 151

Query: 180 PTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIF 239
           P LISE +PK +RGT VS YQLMIT GIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+F
Sbjct: 152 PMLISEVSPKQLRGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALF 211

Query: 240 MIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGN 299
           MI G++ VPESPR+LVE G+ E+AKRSLA++NK T++ P ++ E+D   A+VE ERLAG+
Sbjct: 212 MIFGVMCVPESPRYLVEVGKLEEAKRSLARANKTTVDSPIVLLELDKYQASVEAERLAGS 271

Query: 300 ASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGI 359
           ASWGEL + K  +L R IMG+MIQSLQQLTG NYFFYYGTTIF AVG+ DSFQT+IVLG+
Sbjct: 272 ASWGELVTGKPQMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFRAVGLDDSFQTAIVLGV 331

Query: 360 VNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNV 419
           VNF STF ALYTVD +GRR CL+ G   M  C+V++++VGVT L+PNG+   SSK AGN 
Sbjct: 332 VNFVSTFYALYTVDHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNC 391

Query: 420 MIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITS 479
           MIVF C FIF FA +WAPIAYVIV+ESYPLR++ +AM+IA+ ANWIWGFLI FFTPFITS
Sbjct: 392 MIVFACFFIFCFATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWIWGFLIAFFTPFITS 451

Query: 480 AIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           AI F YGYVFMGC+            ETKGLTLEEVN+MY EGV PWKS SW+
Sbjct: 452 AINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLPWKSSSWV 504

>CAGL0A00737g 74767..76416 highly similar to sp|P39003 Saccharomyces
           cerevisiae YDR343c HXT6 or sp|P39004 Saccharomyces
           cerevisiae YDR342c HXT7, hypothetical start
          Length = 549

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/522 (67%), Positives = 413/522 (79%)

Query: 11  SGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVF 70
           S   Q++  ++    + E D      +      E+P KP +AY  +  LCL IAFGGFVF
Sbjct: 2   SEESQSAFSASNSKVEREEDFKAYADEDGQPMVEIPKKPASAYTLIFILCLFIAFGGFVF 61

Query: 71  GWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDM 130
           GWDTGTISGFV + DF +R GQ +++ TYYLS VRTGLIV IFNIGCA GG+ L + GDM
Sbjct: 62  GWDTGTISGFVAEEDFIKRLGQRRANNTYYLSKVRTGLIVSIFNIGCAIGGVVLSKFGDM 121

Query: 131 YGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKH 190
           YGR+IGL+ V++VYIVGIVIQIA+ DKWYQYFIGRI+SG+GVGGIAVLSP LISE +PKH
Sbjct: 122 YGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFIGRIVSGLGVGGIAVLSPMLISEVSPKH 181

Query: 191 IRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPES 250
           +RGT VS YQLM+T GIFLGYCTNYGTK+Y NSVQWRVPLGL FA+A+FMI GML VPES
Sbjct: 182 MRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSVQWRVPLGLCFAWALFMIGGMLCVPES 241

Query: 251 PRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKG 310
           PR+LVE G++E+A+RS+A SNK+T EDP++  E++ + A VE ERLAG+ASWGELFS K 
Sbjct: 242 PRYLVEVGKFEEARRSIAISNKLTPEDPAVTFELENVQAGVEAERLAGSASWGELFSTKT 301

Query: 311 AILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALY 370
            +L R+IMGIM+Q LQQLTG+NYFFYYGTT+F AVG++DSFQTSIV+GIVNFASTFVALY
Sbjct: 302 KVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVIGIVNFASTFVALY 361

Query: 371 TVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFF 430
            VD+FGRRKCLL G+ASM  C V+F++VGVT LYPNG DQPSSK AGN MIVFTC +IF 
Sbjct: 362 VVDRFGRRKCLLWGAASMTACMVVFASVGVTRLYPNGMDQPSSKGAGNCMIVFTCFYIFC 421

Query: 431 FAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFM 490
           FA +WAP  +VI +E++PLRVK + MAI   ANWIWGFLI FFTPFIT AI F YGYVFM
Sbjct: 422 FATTWAPTPWVINSETFPLRVKAKCMAICQAANWIWGFLIAFFTPFITGAINFYYGYVFM 481

Query: 491 GCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           GCL            ETKGLTLEEVN M+ EGV PWKS  WI
Sbjct: 482 GCLCFSYFYVFFFIPETKGLTLEEVNTMWEEGVLPWKSPDWI 523

>CAGL0A02233g complement(231128..232777) highly similar to sp|P39003
           Saccharomyces cerevisiae YDR343c HXT6 or sp|P39004
           Saccharomyces cerevisiae YDR342c HXT7, hypothetical
           start
          Length = 549

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/515 (67%), Positives = 415/515 (80%), Gaps = 9/515 (1%)

Query: 27  LETDESPIQTKSE---YTN------AELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTI 77
           L    S ++ + E   YT+       E+P KP +AY  +   CL IAFGGFVFGWDTGTI
Sbjct: 9   LSASNSKVEREDEFKAYTDEDGQPMVEIPKKPASAYVAISIFCLFIAFGGFVFGWDTGTI 68

Query: 78  SGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGL 137
           SGFV QTDF RR GQ +++GT+YLS VRTGLIV IFNIGCA GG+ L +LGD+YGR+IGL
Sbjct: 69  SGFVAQTDFIRRMGQTRANGTHYLSKVRTGLIVSIFNIGCAIGGVVLSKLGDVYGRKIGL 128

Query: 138 MCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVS 197
           + VV++YIVGIVIQIA+ DKWYQYFIGRIISG+GVGGIAVLSP LISE +PKH+RG+ VS
Sbjct: 129 ISVVVIYIVGIVIQIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMRGSLVS 188

Query: 198 FYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEK 257
            YQLMIT GIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+FMI GM  VPESPR+L+E 
Sbjct: 189 CYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLIEV 248

Query: 258 GRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVI 317
           GR E+A+RS+A SNKV+ +DP++  E++ + A VE ERLAG+ASWGELFS K  I  R+I
Sbjct: 249 GRVEEARRSIAISNKVSPDDPAVTFEVENVQAGVEAERLAGSASWGELFSTKTKIFQRLI 308

Query: 318 MGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGR 377
           MGIMIQSLQQLTG+NYFFYYGTT+F AVG++DSF+TSIV+GIVNFASTFVALY VD+FGR
Sbjct: 309 MGIMIQSLQQLTGDNYFFYYGTTVFKAVGLEDSFETSIVIGIVNFASTFVALYVVDRFGR 368

Query: 378 RKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAP 437
           R+CLL G+A+M  C V+F++VGVT LYP+G  QPSSK AGN MIVFTC +IF FA +WAP
Sbjct: 369 RRCLLWGAAAMTACMVVFASVGVTRLYPHGMKQPSSKGAGNCMIVFTCFYIFCFATTWAP 428

Query: 438 IAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXX 497
           I +V+ +E++PLRVK + MAIA  +NWIWGFLI FFTPFIT+AI F YGYVFMGCL    
Sbjct: 429 IPFVVNSETFPLRVKAKCMAIAQASNWIWGFLIAFFTPFITNAINFYYGYVFMGCLCFSY 488

Query: 498 XXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
                   ETKGLTLEEVN M+ EGV  WKS +W+
Sbjct: 489 FYVFFFIPETKGLTLEEVNTMWEEGVLAWKSPNWV 523

>Scas_541.6
          Length = 573

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/526 (65%), Positives = 417/526 (79%), Gaps = 2/526 (0%)

Query: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFG 66
           S VES S   S  STP  +    D      +     AE+P KP +AY TV  +C+MIAFG
Sbjct: 21  SPVESISN--SGMSTPSNKDDRDDVKEYVEEDPQIIAEIPKKPASAYVTVSIMCVMIAFG 78

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           GFVFGWDTGTISGFV QTDF +RFGQ  S+G +YLS VR GLIV IFNIGCA GG+ L +
Sbjct: 79  GFVFGWDTGTISGFVAQTDFLQRFGQHHSNGKHYLSKVRMGLIVSIFNIGCAVGGIILSK 138

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           LGD+YGR+IGL+ VV++Y++GI+IQIAS   WYQYFIGRIISG+GVGGIAVLSP LISE 
Sbjct: 139 LGDIYGRKIGLITVVVIYVIGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEV 198

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLM 246
           +PKH+RGT VS YQLMIT GIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+FMI GM  
Sbjct: 199 SPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIGGMTF 258

Query: 247 VPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELF 306
           VPESPRFLVE GR ++AKRS+A SNKV+++DP+++ E++T+ A VE E+LAGNASWGE+F
Sbjct: 259 VPESPRFLVEVGRIDEAKRSVAMSNKVSVDDPAVLGELETLQAGVEAEKLAGNASWGEIF 318

Query: 307 SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTF 366
             K  +L R+IMG MIQSLQQLTG+NYFFYYGTT+F +VGM+DSF+TSIVLGIVNFASTF
Sbjct: 319 QTKTKVLQRLIMGSMIQSLQQLTGDNYFFYYGTTVFTSVGMQDSFETSIVLGIVNFASTF 378

Query: 367 VALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCL 426
           V ++ V+++GRR CLL G+A+M  C V+F++VGVT L+PNGKD  +SK AGN MI FTC 
Sbjct: 379 VGIFLVERYGRRTCLLWGAATMTSCMVVFASVGVTRLWPNGKDGEASKGAGNCMICFTCF 438

Query: 427 FIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYG 486
           ++F FA +WAPI +V+ +E++PLRVK++ M+I  G NW+WGFLIGFFTPFIT AI F YG
Sbjct: 439 YLFCFATTWAPIPFVVNSETFPLRVKSKCMSITQGCNWLWGFLIGFFTPFITGAIDFYYG 498

Query: 487 YVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           YVFMGCL            ETKGLTLEEVN M+ EGV PWKS  W+
Sbjct: 499 YVFMGCLCFSYFYVFFFVPETKGLTLEEVNTMWEEGVLPWKSAEWV 544

>YHR096C (HXT5) [2384] chr8 complement(294671..296449) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1779 bp, 592 aa]
          Length = 592

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 403/514 (78%), Gaps = 7/514 (1%)

Query: 19  HSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTIS 78
           H  P   +LE  +  +       + +L  K  +    V   CLM+AFGGFVFGWDTGTIS
Sbjct: 56  HEGPPKDELEELQKEV-------DKQLEKKSKSDLLFVSVCCLMVAFGGFVFGWDTGTIS 108

Query: 79  GFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLM 138
           GFV QTDF RRFG  +++GT YLSDVRTGL+V IFNIGCA GG+ L +LGDMYGR+IGLM
Sbjct: 109 GFVRQTDFIRRFGSTRANGTTYLSDVRTGLMVSIFNIGCAIGGIVLSKLGDMYGRKIGLM 168

Query: 139 CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSF 198
            VV++Y +GI+IQIAS DKWYQYFIGRIISG+GVGGI VL+P LISE +PK +RGT VS 
Sbjct: 169 TVVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLRGTLVSC 228

Query: 199 YQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKG 258
           YQLMIT GIFLGYCTN+GTK+YSNSVQWRVPLGL FA++IFMI GM  VPESPR+LVE G
Sbjct: 229 YQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWSIFMIVGMTFVPESPRYLVEVG 288

Query: 259 RYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIM 318
           + E+AKRSLA++NK T + P +  EM+   +++E ERLAG+ASWGEL + K  +  R +M
Sbjct: 289 KIEEAKRSLARANKTTEDSPLVTLEMENYQSSIEAERLAGSASWGELVTGKPQMFRRTLM 348

Query: 319 GIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRR 378
           G+MIQSLQQLTG+NYFFYYGTTIF AVG++DSF+T+IVLG+VNF STF +LYTVD+FGRR
Sbjct: 349 GMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFETAIVLGVVNFVSTFFSLYTVDRFGRR 408

Query: 379 KCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPI 438
            CLL G   M  C+V++++VGVT L+PNG+DQPSSK AGN MIVF C +IF FA +WAP+
Sbjct: 409 NCLLWGCVGMICCYVVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPV 468

Query: 439 AYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXX 498
           AYV+++ESYPLRV+ +AM+IA   NWIWGFLI FFTPFITSAI F YGYVFMGC+     
Sbjct: 469 AYVLISESYPLRVRGKAMSIASACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYF 528

Query: 499 XXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
                  ETKGLTLEEVNEMY E V PWKS  WI
Sbjct: 529 YVFFFVPETKGLTLEEVNEMYEENVLPWKSTKWI 562

>CAGL0A02321g complement(247500..249170) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3 or sp|P42833
           Saccharomyces cerevisiae YNL318c HXT14, hypothetical
           start
          Length = 556

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/508 (64%), Positives = 393/508 (77%), Gaps = 6/508 (1%)

Query: 25  QKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQT 84
             L+ D    + K E  N +      +AY  V   C ++AFGGF+FGWDTGTISGFVNQT
Sbjct: 26  DDLDPDTLEKEAKIENPNGK------SAYIAVSISCALVAFGGFIFGWDTGTISGFVNQT 79

Query: 85  DFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVY 144
           DF RR G   +DGT YLS VRTGL+VGIFNIGCA GG+ L ++GD  GR+ GL+ VVL+Y
Sbjct: 80  DFIRRIGSKHADGTSYLSKVRTGLVVGIFNIGCAIGGVVLSKIGDTKGRKAGLVTVVLIY 139

Query: 145 IVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMIT 204
           IVGIVIQIA+ DKWYQYFIGRIISG+GVGGI+VLSPTLISE APK +RG+ VS YQ+MIT
Sbjct: 140 IVGIVIQIATIDKWYQYFIGRIISGLGVGGISVLSPTLISEVAPKELRGSLVSLYQIMIT 199

Query: 205 LGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAK 264
           LGIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+ MI GM  VPESPR+L+E G  + A+
Sbjct: 200 LGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALLMIGGMTFVPESPRYLIEAGDDDAAR 259

Query: 265 RSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQS 324
           +SL  +NK+  E P I  E   + A VE    AG ASW EL + K A+L R IMGIMIQS
Sbjct: 260 KSLCAANKLPAEHPFIEQEFTILKAKVEEANAAGTASWSELITGKPAMLRRTIMGIMIQS 319

Query: 325 LQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGG 384
           LQQLTG+NYFFYYGTT+F AVG++DSFQTSIV G+VNF STF++L+TVD+FGRR CLL G
Sbjct: 320 LQQLTGDNYFFYYGTTVFKAVGLEDSFQTSIVFGVVNFFSTFLSLFTVDRFGRRNCLLYG 379

Query: 385 SASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVA 444
           +A M  C+V++++VGVT L+PNG+   SSK AGN MIVF+C +IF FA +WAPIAYVI++
Sbjct: 380 AAGMVCCYVVYASVGVTRLWPNGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIAYVIIS 439

Query: 445 ESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXX 504
           ES+PLR+K +AM+IA  +NWIWGFLI FFTPFIT+AI F YGYVFMGC+           
Sbjct: 440 ESFPLRIKTKAMSIASASNWIWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFYVFFFV 499

Query: 505 CETKGLTLEEVNEMYVEGVKPWKSGSWI 532
            ET+GLTLEEV+EMY EGV PWKS  W+
Sbjct: 500 NETRGLTLEEVDEMYAEGVLPWKSSKWV 527

>YJL214W (HXT8) [2715] chr10 (26887..28596) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/541 (61%), Positives = 409/541 (75%), Gaps = 21/541 (3%)

Query: 13  SQQTSIHSTPIVQKLETDESP-IQTKSEYT------NAELPA-------------KPIAA 52
            ++T++   PI ++ E D  P I+  S  +      N +                KP +A
Sbjct: 3   DRKTNLPEEPIFEEAEDDGCPSIENSSHLSVPTVEENKDFSEYNGEEAEEVVVPEKPASA 62

Query: 53  YWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQM-KSDGTYYLSDVRTGLIVG 111
           Y TV  +CL +AFGGF+ GWDTGTISGFVNQTDF RRFG    S  TYYLS+VRTGLIV 
Sbjct: 63  YATVSIMCLCMAFGGFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRTGLIVS 122

Query: 112 IFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMG 171
           IFN+G A G L L +LGD+YGR +GL+ V++VY+VGIVIQIAS DKWYQYFIGRII+G+G
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAGIG 182

Query: 172 VGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLG 231
            G I+VL+P LISETAPKHIRGT ++ +QLM+T  IFLGYCTNYGTK YSNSVQWRVPLG
Sbjct: 183 AGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVPLG 242

Query: 232 LNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANV 291
           L FA+AI MI GM  VPESPRFLV+ G+ E AK S AKSNK++++DP++VAE+D ++A V
Sbjct: 243 LCFAWAIIMIGGMTFVPESPRFLVQVGKIEQAKASFAKSNKLSVDDPAVVAEIDLLVAGV 302

Query: 292 ETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSF 351
           E E   G ASW ELFS K  +  R+ M +MI SLQQLTG+NYFFYYGTTIF +VGM DSF
Sbjct: 303 EAEEAMGTASWKELFSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGMNDSF 362

Query: 352 QTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP 411
           +TSIVLGIVNFAS F +LY+VDK GRR+CLL G+A+M  C VI+++VGVT LYPNGK +P
Sbjct: 363 ETSIVLGIVNFASCFFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYPNGKSEP 422

Query: 412 SSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIG 471
           SSK AGN  IVFTC +IF F+ +W P+ YVI++E++PLRV+++ M++A  AN +WGFLIG
Sbjct: 423 SSKGAGNCTIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFLIG 482

Query: 472 FFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
           FFTPFITSAI F YGYVFMGCL            ETKGLTLEEV+EM+++GV PWKS SW
Sbjct: 483 FFTPFITSAINFYYGYVFMGCLAFSYFYVFFFVPETKGLTLEEVDEMWMDGVLPWKSESW 542

Query: 532 I 532
           +
Sbjct: 543 V 543

>Scas_541.7
          Length = 591

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/532 (62%), Positives = 409/532 (76%), Gaps = 12/532 (2%)

Query: 13  SQQTSIHSTPIVQ------------KLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60
           +++T   + PI Q               T E  +    +  +++L +KP    + V   C
Sbjct: 31  NEKTDAQTIPITQGSSVPRSQGTSNSFTTKEDQMSELQKEADSQLESKPRKDLFFVCLCC 90

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           +M++FGGF+FGWDTGTISGF+ QTDF RRFGQ +++GT+YLS VRTGLIV IFNIG A G
Sbjct: 91  IMVSFGGFIFGWDTGTISGFIRQTDFIRRFGQTRANGTHYLSTVRTGLIVSIFNIGAAIG 150

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
           G+TL + GDM+GRR+GL+ V+ +YIVGI+IQI S +KWYQYFIGRIISG+GVGGI VL+P
Sbjct: 151 GITLSKTGDMWGRRLGLITVIGIYIVGILIQITSFNKWYQYFIGRIISGLGVGGITVLAP 210

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
            LISE APK +RGT VS YQLMITLGIFLGYCTN+GTK+YSNSVQWRVPLGL FA+A+FM
Sbjct: 211 MLISEVAPKKLRGTMVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFM 270

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
           I+GM +VPESPR+LVE G+  +A+R LA+ NKV+ + P +  E++   ++VE ERLAGNA
Sbjct: 271 ISGMTLVPESPRYLVEVGKIAEARRGLARVNKVSEDSPLVQLELEKYESSVEAERLAGNA 330

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           SWGEL + K A+L R IMG+MIQSLQQLTG NYFFYYGTTIF AVG+ DSF+T+IVLG+V
Sbjct: 331 SWGELVTGKPAMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFQAVGLSDSFETAIVLGVV 390

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           NF STF ALY VD +GRR CLL G   M  C+V++++VGVT L+PNG + P+SK AGN M
Sbjct: 391 NFVSTFFALYFVDHYGRRLCLLWGCVGMVCCYVVYASVGVTRLHPNGMNNPTSKGAGNCM 450

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           IVF C FIF FA +WAPIAYV+ +E+YPLRV+ +AM+IA   NWIWGFLI FFTPFITSA
Sbjct: 451 IVFACFFIFCFATTWAPIAYVVTSETYPLRVRGKAMSIASACNWIWGFLISFFTPFITSA 510

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           I FSYGYVFMGC+            ETKGLTLEEVNEMY EGV PWKS SW+
Sbjct: 511 INFSYGYVFMGCMVFAFFFVFFFVPETKGLTLEEVNEMYEEGVLPWKSSSWV 562

>Sklu_2304.6 , Contig c2304 11341-13056 reverse complement
          Length = 571

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/526 (62%), Positives = 412/526 (78%), Gaps = 3/526 (0%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAE--LPAKPIAAYWTVICLCLMIAFGG 67
            S +  TS  STP  +    D   ++ ++E T     +P KP +AY TV  LC+ +AFGG
Sbjct: 20  HSLATATSHLSTPSNKAARDDLDDLKFQNEATELTTVMPQKPASAYITVCILCMCVAFGG 79

Query: 68  FVFGWDTGTISGFVNQTDFKRRFGQM-KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           FV GWD GTISGFVNQTDFKRRFG+   S   YYLS+VR GLIV IF+IG A G L L +
Sbjct: 80  FVSGWDVGTISGFVNQTDFKRRFGEYSHSKDEYYLSNVRVGLIVSIFSIGNAVGALVLSK 139

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           LGD+YGR +GLM V+LVY+VGIVIQI+S DKWYQYFIGRI++G+G GG+ VL+  LISET
Sbjct: 140 LGDVYGRCMGLMAVILVYVVGIVIQISSDDKWYQYFIGRIVAGLGGGGVGVLAQMLISET 199

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLM 246
           APKH+RGT ++ +Q+M+   I LGYCTNYGTK+YSNS+QWRVPLGL FA+AI MIAGM  
Sbjct: 200 APKHLRGTLLASWQVMVNCAILLGYCTNYGTKNYSNSIQWRVPLGLCFAWAIIMIAGMCF 259

Query: 247 VPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELF 306
           VPESPR+L++ G+ E+AKRSLA+SNK+T+EDP++  E+D I A +E E+LAG++SWG+L 
Sbjct: 260 VPESPRYLIQVGKIEEAKRSLARSNKLTVEDPAVQCEVDLIAAGIELEKLAGSSSWGDLL 319

Query: 307 SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTF 366
           S K  +  R++M I I SLQQLTG  YFFYYGTTIF +VGM+DSF+TSIV+G+VNF STF
Sbjct: 320 SKKTKVFQRLVMSITINSLQQLTGCGYFFYYGTTIFKSVGMEDSFETSIVIGVVNFVSTF 379

Query: 367 VALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCL 426
           V+LY +D+ GRRKCLL G+A M +C VI++TVGVTSLYP+G+DQPSSKAAGN MIVFTC 
Sbjct: 380 VSLYILDRLGRRKCLLMGAAVMTVCMVIYATVGVTSLYPDGEDQPSSKAAGNCMIVFTCF 439

Query: 427 FIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYG 486
           +IFFFA +W P  +V+++ES+PLRVK++ M++A  AN +WGFL+GFFTPFITSAI F YG
Sbjct: 440 YIFFFANTWGPGCFVVISESFPLRVKSKCMSVATAANGLWGFLVGFFTPFITSAINFYYG 499

Query: 487 YVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           YVFMGCL            ETKGLTLEEV EM+ EGV PWKSGSW+
Sbjct: 500 YVFMGCLVVSYFYVFFFVPETKGLTLEEVEEMWHEGVLPWKSGSWV 545

>YDR345C (HXT3) [1172] chr4 complement(1162947..1164650)
           Low-affinity hexose transporter, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/531 (64%), Positives = 413/531 (77%), Gaps = 6/531 (1%)

Query: 2   SEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCL 61
           SE + + + S S Q  + + P  +K   D+   +     TN   P     AY TV   C+
Sbjct: 14  SENSNADLPSNSSQ--VMNMP-EEKGVQDDFQAEADQVLTN---PNTGKGAYVTVSICCV 67

Query: 62  MIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGG 121
           M+AFGGFVFGWDTGTISGFV QTDF RRFG    DG+YYLS VRTGLIV IFNIGCA GG
Sbjct: 68  MVAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSIFNIGCAIGG 127

Query: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           + L +LGDMYGR++GL+ VV++YI+GI+IQIAS +KWYQYFIGRIISG+GVGGIAVLSP 
Sbjct: 128 IILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGVGGIAVLSPM 187

Query: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241
           LISE APK +RGT VS YQLMITLGIFLGYCTN+GTK+YSNSVQWRVPLGL FA+A+FMI
Sbjct: 188 LISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMI 247

Query: 242 AGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNAS 301
            GM  VPESPR+LVE G+ ++A+ SL+K NKV  + P I  E++ I A+VE  R AG+AS
Sbjct: 248 GGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSAS 307

Query: 302 WGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVN 361
           WGELF+ K A+  R +MGIMIQSLQQLTG+NYFFYYGTT+FNAVGM DSF+TSIV G+VN
Sbjct: 308 WGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMSDSFETSIVFGVVN 367

Query: 362 FASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMI 421
           F ST  +LYTVD+FGRR CLL G+  M  C+V++++VGVT L+PNG+   SSK AGN MI
Sbjct: 368 FFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMI 427

Query: 422 VFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI 481
           VF C +IF FA +WAPIAYV+++E++PLRVK++AM+IA  ANW+WGFLIGFFTPFIT AI
Sbjct: 428 VFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSIATAANWLWGFLIGFFTPFITGAI 487

Query: 482 GFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
            F YGYVFMGC+            ETKGLTLEEVN+MY EGV PWKS SW+
Sbjct: 488 NFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYAEGVLPWKSASWV 538

>Scas_658.23
          Length = 568

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/532 (63%), Positives = 409/532 (76%), Gaps = 6/532 (1%)

Query: 2   SEFATSRVESGSQQTSIHSTPI-VQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60
           S  + S +E  S  + + + P  ++K  +D+   +  +E  N   P     AY TV   C
Sbjct: 13  STSSNSNIEVDSNNSKVLNDPAGMEKNGSDD--YEQVTELVN---PNNGKGAYVTVSICC 67

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           +M+AFGGFVFGWDTGTISGFV QTDF RRFGQ   +GT YLS VR GLIV IFNIGCA G
Sbjct: 68  VMVAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTPYLSKVRMGLIVSIFNIGCAIG 127

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
           G+ L RLGD +GR++GL+ VV +YIVGI+IQIAS   WYQYFIGRIISG+GVGGIAVLSP
Sbjct: 128 GIVLARLGDTHGRKMGLIIVVCIYIVGIIIQIASVKAWYQYFIGRIISGLGVGGIAVLSP 187

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
            LISE APK +RGT VS YQLMITLGIFLGYCTNYGTK+YSNSVQWRVPLGL FA+A+FM
Sbjct: 188 MLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFM 247

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
           I GM  VPESPR+LVE G+ ++A+ SL+K NK   + P I  E++ I A+VE  R AG+A
Sbjct: 248 IGGMTFVPESPRYLVEAGKIDEARASLSKVNKTPGDHPFIQQELELIEASVEEARAAGSA 307

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           SWGELF+ K A+L R ++GIMIQSLQQLTG+NYFFYYGTT+F AVGM+DSF+TSIV GIV
Sbjct: 308 SWGELFTGKPAMLQRTMLGIMIQSLQQLTGDNYFFYYGTTVFTAVGMQDSFETSIVFGIV 367

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           N AST  +LYTVDKFGRR CLL G+  M  C+V++++VGVT L+PNG+   SSK AGN M
Sbjct: 368 NLASTCCSLYTVDKFGRRNCLLWGAVGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCM 427

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           I F C +IF FA +WAPIAYV+++E++PLRVK++AM++A  ANW+WGFLIGFFTPFIT A
Sbjct: 428 ICFACFYIFCFATTWAPIAYVVISETFPLRVKSKAMSVATAANWLWGFLIGFFTPFITGA 487

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           I F YGYVFMGC+            ETKGLTLEEVN+MY EGV PWKS SW+
Sbjct: 488 INFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNDMYSEGVVPWKSASWV 539

>YHR094C (HXT1) [2383] chr8 complement(290915..292627) Low-affinity
           hexose transporter, member of the hexose transporter
           family of the major facilitator superfamily (MFS),
           induced by glucose only at high concentration [1713 bp,
           570 aa]
          Length = 570

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/487 (67%), Positives = 389/487 (79%)

Query: 46  PAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVR 105
           P      Y TV   C+M+AFGGF+FGWDTGTISGFV QTDF RRFG    DG++YLS VR
Sbjct: 55  PNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVR 114

Query: 106 TGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGR 165
           TGLIV IFNIGCA GG+ L +LGDMYGRRIGL+ VV++Y +GI+IQIAS +KWYQYFIGR
Sbjct: 115 TGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGR 174

Query: 166 IISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQ 225
           IISG+GVGGI VLSP LISE AP  +RGT VS YQ+MITLGIFLGYCTN+GTK+YSNSVQ
Sbjct: 175 IISGLGVGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQ 234

Query: 226 WRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMD 285
           WRVPLGL FA+A+FMI GM+ VPESPR+LVE GR ++A+ SLAK NK   + P I  E++
Sbjct: 235 WRVPLGLCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELE 294

Query: 286 TIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAV 345
           TI A+VE  R AG ASWGELF+ K A+  R +MGIMIQSLQQLTG+NYFFYYGT +F AV
Sbjct: 295 TIEASVEEMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAV 354

Query: 346 GMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYP 405
           G+ DSF+TSIV G+VNF ST  +LYTVD+FGRR CL+ G+  M  C+V++++VGVT L+P
Sbjct: 355 GLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCYVVYASVGVTRLWP 414

Query: 406 NGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWI 465
           NG+DQPSSK AGN MIVF C +IF FA +WAPIAYV+++E +PLRVK++ M+IA  ANWI
Sbjct: 415 NGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVKSKCMSIASAANWI 474

Query: 466 WGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKP 525
           WGFLI FFTPFIT AI F YGYVFMGC+            ETKGL+LEEVN+MY EGV P
Sbjct: 475 WGFLISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLP 534

Query: 526 WKSGSWI 532
           WKS SW+
Sbjct: 535 WKSASWV 541

>AFL204C [2991] [Homologous to ScAFL204C] (51587..53194) [1608 bp,
           535 aa]
          Length = 535

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/517 (64%), Positives = 398/517 (76%), Gaps = 5/517 (0%)

Query: 21  TPIVQKLETDES---PIQTKSEYTNA-ELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGT 76
           TP   +L  D S   PI++K +  +      KP +AY      C M+AFGGF+FGWDTGT
Sbjct: 8   TPSKSELSGDGSNSHPIESKKDIVSVISTETKPFSAYIFACLCCFMVAFGGFIFGWDTGT 67

Query: 77  ISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIG 136
           ISGFV QTDF  RFGQ+   G Y LSD RTGLIV IFNIGCA GG+ L ++GD YGR+IG
Sbjct: 68  ISGFVKQTDFIARFGQLSPSGEYELSDDRTGLIVSIFNIGCAVGGIFLSKIGDAYGRKIG 127

Query: 137 LMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCV 196
           L  V  VY++GIVIQI++SDKWYQYF+GRIISG+GVGGIAVLSP LISET+PKH+RG+ V
Sbjct: 128 LATVTAVYVIGIVIQISASDKWYQYFVGRIISGLGVGGIAVLSPMLISETSPKHLRGSLV 187

Query: 197 SFYQLMITLGIFLGYCTNYGTK-DYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLV 255
           S YQLMIT GIFLGYCTNYGTK +Y++S QWR+PLGL FA+A+ MI GM  VPESPR+LV
Sbjct: 188 SCYQLMITAGIFLGYCTNYGTKTNYTDSRQWRIPLGLGFAWALLMIGGMAFVPESPRYLV 247

Query: 256 EKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPR 315
           E      A+ S+A++NKV  + P +  E++T+   +E E+LAG A   +LF+ K  I  R
Sbjct: 248 EAENLPKARMSIARANKVAEDHPIVEHELNTLQTAIELEKLAGKARIVDLFNVKKKIFQR 307

Query: 316 VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKF 375
           +I+GI IQSLQQL GNNYFFYYGTTIFNAVGM D F TSIVLGIVNF STF +LYTVDKF
Sbjct: 308 LIIGIFIQSLQQLIGNNYFFYYGTTIFNAVGMDDPFVTSIVLGIVNFGSTFFSLYTVDKF 367

Query: 376 GRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISW 435
           GRRKCL+ G+ +MAIC  IF++VGVT L+PNG+DQPSSK AGNVMIVFTC++IFFFA +W
Sbjct: 368 GRRKCLIWGAFAMAICMAIFASVGVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFFFATTW 427

Query: 436 APIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXX 495
           APIAYVI++E YPLRVK RAMA+A  ANWIWGFLI FFTP ITSAI F YGYVFMGCL  
Sbjct: 428 APIAYVIISEIYPLRVKARAMALATAANWIWGFLIAFFTPRITSAIKFCYGYVFMGCLIF 487

Query: 496 XXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
                     ETKGLTLE+V+EM+ EGV PW S SW+
Sbjct: 488 AFFYIFFFVPETKGLTLEDVDEMWQEGVVPWGSESWL 524

>Scas_712.1
          Length = 558

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/532 (62%), Positives = 404/532 (75%), Gaps = 3/532 (0%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60
           MSE      ++ S   S+HS      L+ D S ++T  ++   ++P KP +AY  V   C
Sbjct: 1   MSEENIPETDNLSASVSVHSNQ--DGLKKDLSDLETNEQHV-IDIPQKPASAYIAVCIFC 57

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           LM+AFGGF+ GWDTGTI GF+   DF  RFG   SDGT Y S+VRTGL+V IFNIGC  G
Sbjct: 58  LMVAFGGFISGWDTGTIGGFLAHPDFVGRFGSKHSDGTPYFSNVRTGLLVSIFNIGCCVG 117

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
            + LGRLGDMYGRRIG++  V++YIVGIVIQIAS DKWYQYFIGRI++G+G G IAVLSP
Sbjct: 118 AVFLGRLGDMYGRRIGIVLAVIIYIVGIVIQIASVDKWYQYFIGRIVAGLGSGTIAVLSP 177

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
            LISE +PKH+RGT VS YQLMIT GIFLGYC NYGTK Y+NS+QWRVPLGL FA+A+F+
Sbjct: 178 MLISEVSPKHLRGTLVSCYQLMITFGIFLGYCANYGTKKYNNSIQWRVPLGLCFAWALFL 237

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
           IA M  VPESPR+LVE G+ E+AKRS+A+SNKV+I+DP+ +AE++ I   VE+ER AG+A
Sbjct: 238 IAAMFFVPESPRYLVEAGKIEEAKRSVAQSNKVSIDDPATIAEVEIIQVAVESERAAGSA 297

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           SWGELF  K  +LPR IM +M+ +LQQLTG NYFFYYGT +FNAVGM DS++TSIV GIV
Sbjct: 298 SWGELFQTKTKVLPRTIMCVMVLALQQLTGCNYFFYYGTIVFNAVGMSDSYETSIVFGIV 357

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           NFASTFVALY VDKFGRR CLL G+A M  C V+F++VGV SL+P+G D PSSK AGN M
Sbjct: 358 NFASTFVALYVVDKFGRRTCLLWGAAGMVCCMVVFASVGVKSLHPHGDDGPSSKGAGNCM 417

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           IVF+C FIF FA SWAPI +VIV+ES+P ++K + MAI   +N +W F IGFFTPFIT A
Sbjct: 418 IVFSCFFIFCFATSWAPIPFVIVSESFPTKIKAKGMAIGTVSNQLWNFCIGFFTPFITGA 477

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           I F YGYVF+GCL            ETKGL LE+VN M+ EGV PWKS +W+
Sbjct: 478 IDFYYGYVFLGCLVFAYCYVFMFVPETKGLQLEDVNIMWEEGVLPWKSSAWV 529

>Kwal_55.19582
          Length = 567

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/530 (60%), Positives = 403/530 (76%), Gaps = 4/530 (0%)

Query: 5   ATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIA 64
           A +  +  S     H+  + +K   DE      ++   AELP KP +AY TV  LC++++
Sbjct: 14  AQTPTQGASSVVDSHTATVPKKFYMDEGNDGQMADM--AELPKKPASAYVTVSLLCVLVS 71

Query: 65  FGGFVFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGGLT 123
           FGGF+ GWDTG ++GFVN  DFKRRFG  K S   YYLS+VRTGL+V IF+ GCA GGLT
Sbjct: 72  FGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLVAIFSAGCALGGLT 131

Query: 124 LGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
           L +LGD++GRR+ LM VV VY+VG +IQI++SDKWYQYFIG+II G GVGG++VL+P LI
Sbjct: 132 LSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVLAPMLI 191

Query: 184 SETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAG 243
           SETAPKH+RGT +S YQLM+T GIFLGYC  Y T+ Y  S QWR+PLGL+F +A+ ++AG
Sbjct: 192 SETAPKHLRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPLGLSFLWALIIVAG 251

Query: 244 MLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWG 303
           M+ VPESPRFLVE GR E+A+RS+A SNK  +EDP+I AE+D I A+VE E+  G A W 
Sbjct: 252 MVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAASVEAEKAQGKARWA 311

Query: 304 ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFA 363
           ELFS K  +  R+I GI++QS  QLTG NYFFYYGTTIF ++G+ DSFQTSIVLG VNF 
Sbjct: 312 ELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLGTVNFF 371

Query: 364 STFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKD-QPSSKAAGNVMIV 422
           S+F+++YTVD FGRRKCLL G+A+M +C VIF++VGVTSL+P+G++   +SK AGNVMIV
Sbjct: 372 SSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENVGEASKPAGNVMIV 431

Query: 423 FTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIG 482
           FTCLFI FFA +WAPIAYV+VAES+PLRVK++ M+I+   NW+W FLIGFFTPFIT+AI 
Sbjct: 432 FTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFITNAIK 491

Query: 483 FSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           F YGYVFMGCL            ET GLTLEEV  +Y EG+  W+S +W+
Sbjct: 492 FYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSANWV 541

>Kwal_56.22285
          Length = 567

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/530 (60%), Positives = 402/530 (75%), Gaps = 4/530 (0%)

Query: 5   ATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIA 64
           A +  +  S     H+  + +K   DE      ++   AELP KP +AY TV  LC++++
Sbjct: 14  AQTPTQGASSVVDSHTATVPKKFYMDEGNDGQMADM--AELPKKPASAYVTVSLLCVLVS 71

Query: 65  FGGFVFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGGLT 123
           FGGF+ GWDTG ++GFVN  DFKRRFG  K S   YYLS+VRTGL+V IF+ GCA GGLT
Sbjct: 72  FGGFLPGWDTGIMAGFVNMDDFKRRFGTYKESTNEYYLSNVRTGLLVAIFSAGCALGGLT 131

Query: 124 LGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
           L +LGD++GRR+ LM VV VY+VG +IQI++SDKWYQYFIG+II G GVGG++VL+P LI
Sbjct: 132 LSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVLAPMLI 191

Query: 184 SETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAG 243
           S TAPKH+RGT +S YQLM+T GIFLGYC  Y T+ Y  S QWR+PLGL+F +A+ ++AG
Sbjct: 192 SLTAPKHVRGTLISCYQLMVTFGIFLGYCVVYATRKYDGSEQWRIPLGLSFLWALIIVAG 251

Query: 244 MLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWG 303
           M+ VPESPRFLVE GR E+A+RS+A SNK  +EDP+I AE+D I A+VE E+  G A W 
Sbjct: 252 MVFVPESPRFLVEVGRIEEARRSIASSNKTPVEDPAIQAEIDLIAASVEAEKAQGKARWA 311

Query: 304 ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFA 363
           ELFS K  +  R+I GI++QS  QLTG NYFFYYGTTIF ++G+ DSFQTSIVLG VNF 
Sbjct: 312 ELFSTKTKVFQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFQTSIVLGTVNFF 371

Query: 364 STFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKD-QPSSKAAGNVMIV 422
           S+F+++YTVD FGRRKCLL G+A+M +C VIF++VGVTSL+P+G++   +SK AGNVMIV
Sbjct: 372 SSFLSMYTVDAFGRRKCLLWGAAAMTVCMVIFASVGVTSLWPHGENVGEASKPAGNVMIV 431

Query: 423 FTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIG 482
           FTCLFI FFA +WAPIAYV+VAES+PLRVK++ M+I+   NW+W FLIGFFTPFIT+AI 
Sbjct: 432 FTCLFICFFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFFTPFITNAIK 491

Query: 483 FSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           F YGYVFMGCL            ET GLTLEEV  +Y EG+  W+S +W+
Sbjct: 492 FYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYEEGIPAWRSANWV 541

>Kwal_26.6686
          Length = 569

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/539 (59%), Positives = 402/539 (74%), Gaps = 13/539 (2%)

Query: 6   TSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNA----------ELPAKPIAAYWT 55
           TS  E+ +Q T + ++ IV    T   P +  +E               +  KP +AY T
Sbjct: 7   TSASETAAQGTPVGNSSIVDS-HTPTVPDKFYAEEPKGGDGFEPEFQPTIEKKPASAYLT 65

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDG-TYYLSDVRTGLIVGIFN 114
           V  LC++++FGGF+ GWDTG ++GFVN  DFK+RFG       TYYLS+VRTGL+V IF+
Sbjct: 66  VSLLCVLVSFGGFLPGWDTGIMAGFVNMDDFKQRFGSYNHKTETYYLSNVRTGLLVAIFS 125

Query: 115 IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGG 174
            GCAFGGLTL +LGD+YGRR+GLM V+++Y+VG +IQI++ DKWYQYFIG+II G GVGG
Sbjct: 126 AGCAFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGG 185

Query: 175 IAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNF 234
           ++VL+P LISETAPKH+RGT +S YQLM+T GIFLGYC  YGT+ Y++S QWR+P+GL F
Sbjct: 186 VSVLAPMLISETAPKHLRGTLISCYQLMVTFGIFLGYCAVYGTRKYNSSAQWRIPVGLCF 245

Query: 235 AFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETE 294
            +A+ +I GM  VPESPRFLVE GR E+AKRS+A+SNKV  E+  +  E+D I A VE E
Sbjct: 246 LWAMIIIGGMTFVPESPRFLVEVGRMEEAKRSVARSNKVDPEEVGVQIEIDLIAAGVEAE 305

Query: 295 RLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTS 354
           R  G ASWGELFS K  +L R+I GI++QS  QLTG NYFFYYGTTIF ++G+ DSF+TS
Sbjct: 306 RQQGKASWGELFSTKTKVLQRLITGILMQSFLQLTGENYFFYYGTTIFKSIGLTDSFETS 365

Query: 355 IVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKD-QPSS 413
           IVLGIVNFASTF+++Y VD FGRRKCLL G+A M  C V+F++VGVTSL+PNG++   +S
Sbjct: 366 IVLGIVNFASTFLSMYVVDAFGRRKCLLWGAAGMTACMVVFASVGVTSLWPNGENVGEAS 425

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFF 473
           K AGN MIVFTC FIF FA +WAPIAYV+VAES+PLRVK++ M+I+   NW+W FLIGFF
Sbjct: 426 KGAGNCMIVFTCFFIFCFATTWAPIAYVVVAESFPLRVKSKCMSISTAFNWLWQFLIGFF 485

Query: 474 TPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           TPFITSAI F YGYVFMGCL            ET GLTLEEV  +Y EG+ PW+S  W+
Sbjct: 486 TPFITSAIKFYYGYVFMGCLVAMFLYVFFFLPETSGLTLEEVQILYDEGIPPWRSADWV 544

>Scas_687.4
          Length = 610

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/539 (60%), Positives = 401/539 (74%), Gaps = 7/539 (1%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQK-LETDESPIQTKSEYTN---AELPAKPIAAYWTV 56
           MSE A +       QTS   + +    ++ +    +  SE  N    E+P KP +AY T+
Sbjct: 43  MSEVAENIASPEVPQTSGSQSVLSDNSVKAENESFKENSEDANEVVVEIPKKPASAYVTI 102

Query: 57  ICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIG 116
              C MI FGGF+ GWDTGTI GF+   D+ RRFGQ   +GT+Y S+VRTGL+V IFNIG
Sbjct: 103 SIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHYFSNVRTGLVVSIFNIG 162

Query: 117 CAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIA 176
             FG L LG L +  GR++ L+ VV++++VGI+IQIAS DKWYQYFIGRIISG+GVG I+
Sbjct: 163 GLFGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAIS 222

Query: 177 VLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAF 236
           + SP L+SE APKH+RGT  S YQLM+T GIFLG CTNYGTK+Y NSVQWRVPLGL+FA+
Sbjct: 223 IFSPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAW 282

Query: 237 AIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERL 296
            +FMIA M  VPESPR+LVE G+ E+AKRS+A SNKV+++DP++ AE+D I + VE ERL
Sbjct: 283 CLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERL 342

Query: 297 AGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIV 356
           AGNASWGELFS KG  + R+ M  M+Q LQQLTG NYFFYYGT IF AVGMKDS+QT+IV
Sbjct: 343 AGNASWGELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIV 402

Query: 357 LGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNG---KDQPSS 413
            GIVNFASTFVALY VD+FGRRKCL+ G+A+M  C+V++++VGVT LYP+G   KD  SS
Sbjct: 403 FGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSS 462

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFF 473
           K AGN MI F+C FIF FA +WAPI +V+V+ES+PLR+K + MA+A G NW W FLI FF
Sbjct: 463 KGAGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFF 522

Query: 474 TPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           TPFIT AI F YGYVFMGC+            E KGLTLEEVNE++ +GV PWKS  W+
Sbjct: 523 TPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWV 581

>Scas_509.2
          Length = 568

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/539 (60%), Positives = 399/539 (74%), Gaps = 7/539 (1%)

Query: 1   MSEFATSRVESGSQQTS-IHSTPIVQKLETDESPIQTKSEYTN---AELPAKPIAAYWTV 56
           MSE A +       QTS   S      ++ +    +  S+  N    E+P KP +AY T+
Sbjct: 1   MSEVAENTATPEVPQTSGTQSILSENSIKAENESFKENSDEGNEVVVEIPKKPASAYVTI 60

Query: 57  ICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIG 116
              C MI FGGF+ GWDTGTI GF+   D+ RRFGQ   +GT+Y S+VRTGL+V IFNIG
Sbjct: 61  SIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHKNGTHYFSNVRTGLVVSIFNIG 120

Query: 117 CAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIA 176
             FG L LG L +  GR++ L+ VV++++VGI+IQIAS DKWYQYFIGRIISG+GVG I+
Sbjct: 121 GLFGCLILGDLANRIGRKMALVAVVVIFMVGIIIQIASIDKWYQYFIGRIISGLGVGAIS 180

Query: 177 VLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAF 236
           + SP L+SE APKH+RGT  S YQLM+T GIFLG CTNYGTK+Y NSVQWRVPLGL+FA+
Sbjct: 181 IFSPMLLSEVAPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLSFAW 240

Query: 237 AIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERL 296
            +FMIA M  VPESPR+LVE G+ E+AKRS+A SNKV+++DP++ AE+D I + VE ERL
Sbjct: 241 CLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEAERL 300

Query: 297 AGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIV 356
           AGNASW ELFS KG  + R+ M  M+Q LQQLTG NYFFYYGT IF AVGMKDS+QT+IV
Sbjct: 301 AGNASWAELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQTAIV 360

Query: 357 LGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNG---KDQPSS 413
            GIVNFASTFVALY VD+FGRRKCL+ G+A+M  C+V++++VGVT LYP+G   KD  SS
Sbjct: 361 FGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKDTNSS 420

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFF 473
           K AGN MI F+C FIF FA +WAPI +V+V+ES+PLR+K + MA+A G NW W FLI FF
Sbjct: 421 KGAGNCMICFSCFFIFSFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNFLISFF 480

Query: 474 TPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           TPFIT AI F YGYVFMGC+            E KGLTLEEVNE++ +GV PWKS  W+
Sbjct: 481 TPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSPDWV 539

>CAGL0A01804g complement(175488..177179) highly similar to sp|P32466
           Saccharomyces cerevisiae YDR345c HXT3, start by
           similarity
          Length = 563

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/533 (61%), Positives = 403/533 (75%), Gaps = 7/533 (1%)

Query: 3   EFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKP---IAAYWTVICL 59
           +  + +  S S +   H +  + ++  ++       E+   E+ A P     A+  VI  
Sbjct: 6   DLISPQKSSSSNEVDSHESKYLNQVGKND----MADEFVQNEMIANPNTGKGAFVGVIIS 61

Query: 60  CLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAF 119
           C M+AFGGFVFGWDTGTISGFV Q DF  RFG    DGT YLS VRTGLIV IFNIGCA 
Sbjct: 62  CFMVAFGGFVFGWDTGTISGFVAQKDFIHRFGMKHPDGTEYLSKVRTGLIVSIFNIGCAI 121

Query: 120 GGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLS 179
           GG+ L +LGD  GR++GL+ VV++YIVGI+IQIAS +KWYQYFIGRIISG+GVGGI+VLS
Sbjct: 122 GGIILSKLGDTKGRKMGLVVVVVIYIVGIIIQIASINKWYQYFIGRIISGLGVGGISVLS 181

Query: 180 PTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIF 239
           P LISE AP  +RG+ VS YQLMITLGIFLGYCTN+GTK+Y+NSVQWRVPLGL FA+A+F
Sbjct: 182 PMLISEVAPSDLRGSLVSCYQLMITLGIFLGYCTNFGTKNYTNSVQWRVPLGLCFAWALF 241

Query: 240 MIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGN 299
           MI GM  VPESPR+LVE G+ E+A+ SLA+ NK + + P I  E+D I A+V+  R AG+
Sbjct: 242 MIGGMTFVPESPRYLVEAGQIEEARSSLARINKCSPDHPYIQQELDLIQASVDEARSAGS 301

Query: 300 ASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGI 359
           ASWGELF+ K A+  R +MGIMIQSLQQLTG+NYFFYYGT +F AVG++DSF+TSIV G+
Sbjct: 302 ASWGELFTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVFGV 361

Query: 360 VNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNV 419
           VNF ST  +L TVD+FGRR CLL G+  M  C+V++++VGVT L+P+G+   SSK AGN 
Sbjct: 362 VNFFSTCCSLLTVDRFGRRNCLLYGAIGMVCCYVVYASVGVTRLWPHGQGNGSSKGAGNC 421

Query: 420 MIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITS 479
           MIVF+C +IF FA +WAPIAYVI++E++PLR+K +AM+IA  ANW+WGFLI FFTPFIT+
Sbjct: 422 MIVFSCFYIFCFATTWAPIAYVIISETFPLRIKAKAMSIATAANWMWGFLIAFFTPFITN 481

Query: 480 AIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           AI F YGYVFMGC+            ETKGLTLEEVNEMY EGV PWKS  W+
Sbjct: 482 AINFYYGYVFMGCMVFAYFYVFFFVSETKGLTLEEVNEMYAEGVLPWKSSKWV 534

>Scas_550.9
          Length = 574

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 403/544 (74%), Gaps = 18/544 (3%)

Query: 7   SRVESGSQQTSIHSTPIVQK------------LETDESPIQTKSEYTN---AELPAKPIA 51
           S V   + +T+ +S+P V +            ++ +    +  SE  N    E+P KP +
Sbjct: 2   SDVAENTPETAENSSPEVPQTSGSQSVLSDNSIKAENESFKENSEDANDVVVEIPKKPAS 61

Query: 52  AYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVG 111
           AY T+   C MIAFGGF+ GWDTGTI GF+   D+ RRFGQ   DGT+Y S+VRTGL+V 
Sbjct: 62  AYVTISIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHHKDGTHYFSNVRTGLVVS 121

Query: 112 IFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMG 171
           IFNIG   G L LG L +  GR++ L+ VV++++VG++IQIAS +KWYQYFIGRIISG+G
Sbjct: 122 IFNIGGLIGCLVLGDLANRIGRKMALVAVVIIFMVGLIIQIASINKWYQYFIGRIISGLG 181

Query: 172 VGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLG 231
           VG I++ SP L+SE APKH+RGT  S YQLM+T+GIFLG CTNYGTK YSNSVQWRVPLG
Sbjct: 182 VGAISIFSPMLLSEVAPKHLRGTLGSMYQLMVTMGIFLGDCTNYGTKKYSNSVQWRVPLG 241

Query: 232 LNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANV 291
           L+FA+ +FMIA M  VPESPR+LVE G+ E+AKRS+A SN+V+I+DP++ AE+D I + V
Sbjct: 242 LSFAWCLFMIAAMFFVPESPRYLVEVGKVEEAKRSIATSNQVSIDDPAVQAEVDLISSGV 301

Query: 292 ETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSF 351
           E ERLAGNASW ELFS KG  + R+ M  M+Q LQQLTG NYFFYYGT IF AVGMKDS+
Sbjct: 302 EAERLAGNASWVELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSY 361

Query: 352 QTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNG---K 408
           QT+IV GIVNFASTFVALY VD+FGRRKCL+ G+A+M  C+V++++VGVT LYP+G   K
Sbjct: 362 QTAIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHK 421

Query: 409 DQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGF 468
           D  SSK AGN MI F+C FIF FA +WAPI +V+V+ES+PLR+K + MA+A G NW W F
Sbjct: 422 DTNSSKGAGNCMICFSCFFIFCFACTWAPICWVVVSESFPLRIKPKGMALANGCNWFWNF 481

Query: 469 LIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKS 528
           LI FFTPFIT AI F YGYVFMGC+            E KGLTLEEVNE++ +GV PWKS
Sbjct: 482 LISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKS 541

Query: 529 GSWI 532
             W+
Sbjct: 542 PDWV 545

>Scas_685.5
          Length = 560

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 388/532 (72%), Gaps = 7/532 (1%)

Query: 5   ATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNA--ELPAKPIAAYWTVICLCLM 62
           + +  E GSQ    +++    K E D    +  S   N   E+P K   AY T+  LC M
Sbjct: 2   SDAEHEQGSQSVLSNAS---AKAENDNDNFKDDSVEHNGYIEMPKKSAGAYATISILCCM 58

Query: 63  IAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGL 122
           I FGGF+ GWDTGTI GF+   DF RRFGQ + DGT+Y S+ RTGLIV IFN+G   G L
Sbjct: 59  IGFGGFIAGWDTGTIGGFMGHPDFMRRFGQKRRDGTHYFSNSRTGLIVSIFNLGGCIGCL 118

Query: 123 TLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTL 182
           TL  L    GR+  L+ VV++Y+VGIVI++AS +KWYQYFIGRIISGMGVG I++ SP L
Sbjct: 119 TLNNLAGRVGRKKALVIVVIIYMVGIVIEMASINKWYQYFIGRIISGMGVGAISIFSPML 178

Query: 183 ISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIA 242
           +SE +PKH+RGT  S YQLM+T GIFLG CTNYGT+   NS QWR PLGL+FA+A+FMIA
Sbjct: 179 LSEVSPKHLRGTLGSVYQLMVTFGIFLGDCTNYGTRHKHNSSQWRAPLGLSFAWALFMIA 238

Query: 243 GMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASW 302
           GM  VPESPR+L+E G+ E+AKRS+  SNK++ +DP++  E+D I+AN+E ERLAG+ASW
Sbjct: 239 GMSFVPESPRYLLEIGKVEEAKRSVGTSNKLSADDPAVQCEVDLILANIEAERLAGSASW 298

Query: 303 GELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNF 362
            ELFS KG  + R++M  ++QSLQQLTG NYFFYYG+T+F A  +KD ++T+IV GIVNF
Sbjct: 299 PELFSTKGKYVQRLLMCCVLQSLQQLTGINYFFYYGSTVFQAASLKDPYETAIVFGIVNF 358

Query: 363 ASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP--SSKAAGNVM 420
           ASTFVA Y VDKFGRRKCL+ G+A+M  CFV++++VGV  LYP G+     +SK AG+ M
Sbjct: 359 ASTFVAFYVVDKFGRRKCLMWGAAAMVCCFVVYASVGVKRLYPEGRKHKEITSKGAGDCM 418

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           IVF+C FIF FA + API +V+V+E++PL +K + MA+A G+NW+W FLI FFTPFIT A
Sbjct: 419 IVFSCFFIFSFACTLAPICWVVVSETFPLEIKPKGMALANGSNWLWNFLISFFTPFITGA 478

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           I F YGYVFMGC+            E KGLTLEEVNE++ EGV PWKS  W+
Sbjct: 479 IDFYYGYVFMGCILFAYFFVFFFVPEMKGLTLEEVNELWEEGVLPWKSPDWV 530

>Scas_657.20
          Length = 569

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/541 (58%), Positives = 394/541 (72%), Gaps = 10/541 (1%)

Query: 1   MSEFATSRV-------ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAY 53
           MSE A +         ++   Q+ I    I  + E+ +   +   E    E+P KP +AY
Sbjct: 1   MSEIAENNAIETPEVPQTSGSQSVISDNSIKAENESFKETSEDAQEVV-LEIPKKPASAY 59

Query: 54  WTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
            T+   C MIAFGGF+ GWDTGTI GF+   D+ RRFGQ   DG +Y S+VRTGLIV IF
Sbjct: 60  VTISIFCCMIAFGGFLSGWDTGTIGGFLAHPDYLRRFGQHHHDGKHYFSNVRTGLIVSIF 119

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
           NIG   G L LG L +  GR++ L+ V +++++G++IQIAS DKWYQYFIGRII G+GVG
Sbjct: 120 NIGGLIGCLVLGDLANRIGRKMALVAVTIIFMIGLIIQIASIDKWYQYFIGRIIGGVGVG 179

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
            I++ SP L+SE +PKH+RGT  S YQLM+T GIFLG CTNYGTK+Y NSVQWRVPLGL+
Sbjct: 180 AISIFSPMLLSEVSPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKNYDNSVQWRVPLGLS 239

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVET 293
           FA+ +FMIA M  VPESPR+LVE G+ E+AKRS+A SNKV+++DP++ AE+D I + VE 
Sbjct: 240 FAWCLFMIAAMFFVPESPRYLVEVGKIEEAKRSIATSNKVSMDDPAVQAEVDLISSGVEA 299

Query: 294 ERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQT 353
           ERLAGNASW ELFS KG  + R+ M  M+Q LQQLTG NYFFYYGT +F AVGM DS+QT
Sbjct: 300 ERLAGNASWAELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTIVFQAVGMSDSYQT 359

Query: 354 SIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP-- 411
           +IV GIVNFASTFVALY VD+FGRRKCL+ G+A+M  C+V++++VGV+ LYP G      
Sbjct: 360 AIVFGIVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVSRLYPEGLKHKDI 419

Query: 412 SSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIG 471
           +SK AGN MIVF+C FIF FA +WAPI +V+V+ES+PLRVK + MA+A G NW W FLI 
Sbjct: 420 TSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSESFPLRVKPKGMALANGCNWFWNFLIS 479

Query: 472 FFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
           FFTPFIT AI F YGYVFMGC+            E KGLTLEEVNE++ EGV PWKS  W
Sbjct: 480 FFTPFITGAINFCYGYVFMGCMVFAYFYVFFFVPEMKGLTLEEVNELWEEGVLPWKSPEW 539

Query: 532 I 532
           +
Sbjct: 540 V 540

>Scas_455.2*
          Length = 535

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/489 (61%), Positives = 383/489 (78%)

Query: 44  ELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSD 103
           ELP KP++ Y     L L +AFGGF+ GWDTGTISG V Q DF +RFG+ +S+G+++LS+
Sbjct: 21  ELPKKPLSDYIVACILSLAVAFGGFITGWDTGTISGIVAQEDFIQRFGERRSNGSHHLSN 80

Query: 104 VRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFI 163
            RTG+IV +FNIGCA GG+ L R+GD +GR+ GLM V+++YIVG+++QI++   WYQYFI
Sbjct: 81  ARTGIIVSLFNIGCAVGGIVLSRVGDKFGRKKGLMVVIVIYIVGVIVQISTQKAWYQYFI 140

Query: 164 GRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNS 223
           GR++SG+GVGGIAVL P LISE +PKH+RGTC+SFYQLMIT GIFLGYCTNYGTKDY+NS
Sbjct: 141 GRVVSGLGVGGIAVLCPMLISEISPKHLRGTCISFYQLMITAGIFLGYCTNYGTKDYNNS 200

Query: 224 VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAE 283
           VQWRVPLGL+FA+A+ MI  +  VPESPRFL E    E AKRS+AK + V+++DPS+  E
Sbjct: 201 VQWRVPLGLSFAWALIMIVILFFVPESPRFLCEINDPEKAKRSIAKIHNVSVKDPSVQTE 260

Query: 284 MDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFN 343
           +D IM+ VE+E+LAG+ASW EL S +  +  RVIMGIMI  LQQLTG+NYFFYYGT +F 
Sbjct: 261 VDLIMSGVESEKLAGSASWRELLSTRTKVRQRVIMGIMILMLQQLTGDNYFFYYGTIVFR 320

Query: 344 AVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSL 403
           +VG+ DSFQTSIV G+VNF STF ALYTVD  GRR  LL   A+M  C +I+S+VGVT L
Sbjct: 321 SVGLNDSFQTSIVFGVVNFFSTFFALYTVDNVGRRLMLLWAGAAMTACLIIYSSVGVTRL 380

Query: 404 YPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGAN 463
           +P+G+   SSK AGN MIVFT  +IF +A+SWAPI +V+VAESYP+RVK++ MA++  +N
Sbjct: 381 WPHGEGNGSSKGAGNCMIVFTSFYIFCYAMSWAPIPWVLVAESYPIRVKSKCMAVSAASN 440

Query: 464 WIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGV 523
           WIWGFLI FFTPFITS+I F YGYVF+GCL            ETKGL+LEE+  ++ EGV
Sbjct: 441 WIWGFLISFFTPFITSSINFYYGYVFVGCLVFSWFYVFFFIPETKGLSLEEIQTLWDEGV 500

Query: 524 KPWKSGSWI 532
            PWKS  W+
Sbjct: 501 APWKSAKWV 509

>Scas_552.2
          Length = 572

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/543 (59%), Positives = 399/543 (73%), Gaps = 11/543 (2%)

Query: 1   MSEFA-----TSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNA---ELPAKPIAA 52
           MSE A     T  V   S   S+ S   ++             E  N    E+P KP +A
Sbjct: 1   MSEVAENPATTPEVPENSGSQSVLSDHSIKDENDSFKENGENGEDANEAVVEIPKKPASA 60

Query: 53  YWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGI 112
           Y T+   C MI FGGF+ GWDTGTI GF+   D+ RRFGQ   DGT+Y S+VRTGL+V I
Sbjct: 61  YATISIFCCMIGFGGFISGWDTGTIGGFLAHPDYLRRFGQHHHDGTHYFSNVRTGLVVSI 120

Query: 113 FNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGV 172
           FNIG  FG L LG L +  GR++ L+ VV+++++GI+IQIAS +KWYQYFIGRIISG+GV
Sbjct: 121 FNIGGLFGCLILGDLANRIGRKMALVVVVIIFMIGIIIQIASINKWYQYFIGRIISGLGV 180

Query: 173 GGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGL 232
           G I++ SP L+SE +PKH+RGT  S YQLM+T GIFLG CTNYGTK YSNSVQWRVPLGL
Sbjct: 181 GAISIFSPMLLSEVSPKHLRGTLGSMYQLMVTAGIFLGDCTNYGTKKYSNSVQWRVPLGL 240

Query: 233 NFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVE 292
           +FA+ +FMIA M  VPESPR+LVE G+ E+AKRS+A SNKV+I+DP++  E+D I+A VE
Sbjct: 241 SFAWCLFMIAAMFFVPESPRYLVEVGKMEEAKRSIATSNKVSIDDPAVQGEVDLILAGVE 300

Query: 293 TERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQ 352
            ERLAGNASWGELFS KG  + R+ M  M+Q LQQLTG NYFFYYGT IF AVGMKDS+Q
Sbjct: 301 AERLAGNASWGELFSTKGKNIQRLFMCCMLQCLQQLTGCNYFFYYGTVIFQAVGMKDSYQ 360

Query: 353 TSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNG---KD 409
           T+IV G+VNFASTFVALY VD+FGRRKCL+ G+A+M  C+V++++VGVT LYP+G   KD
Sbjct: 361 TAIVFGVVNFASTFVALYVVDRFGRRKCLMWGAAAMVCCYVVYASVGVTRLYPDGIKHKD 420

Query: 410 QPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFL 469
             SSK AGN MI F+C FIF FA +WAPI +++V+E++PLR+K + MA+A G NW W FL
Sbjct: 421 TNSSKGAGNCMICFSCFFIFCFACTWAPICWIVVSEAFPLRIKPKGMALANGCNWFWNFL 480

Query: 470 IGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSG 529
           I FFTPFIT AI F YGYVFMGC+            E KGLTLEEVNE++ +GV PWKS 
Sbjct: 481 ISFFTPFITGAINFYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEVNELWEDGVLPWKSP 540

Query: 530 SWI 532
           +W+
Sbjct: 541 NWV 543

>YEL069C (HXT13) [1361] chr5 complement(21537..23231) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/531 (54%), Positives = 376/531 (70%), Gaps = 3/531 (0%)

Query: 5   ATSRVESGS--QQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLM 62
           A S ++S    +   IH  P V+K  +D           N E P + +  Y  +  LC  
Sbjct: 4   AQSSIDSDGDVRDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLLCYP 63

Query: 63  IAFGGFVFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGG 121
           I+FGGF+ GWD+G  +GF+N  +FK  FG  K S G YYLS+VR GL+V +F+IGCA GG
Sbjct: 64  ISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGG 123

Query: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           L   RL D  GRR+ ++ VVLVY+VG +IQI+S+ KWYQYF+G+II G+G GG +VL P 
Sbjct: 124 LIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPM 183

Query: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241
           L+SE AP  +RG  VS YQL +T GIFLGYC+ YGT+ Y N+ QWRVPLGL F +A+ +I
Sbjct: 184 LLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALIII 243

Query: 242 AGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNAS 301
            GML+VPESPR+L+E  R+E+A+ S+AK NKV+ EDP ++ + D I A V  +R  G AS
Sbjct: 244 IGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEAS 303

Query: 302 WGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVN 361
           W ELFS K  +L R+I GI++Q+  QLTG NYFF+YGTTIF +VG+ D F+TSIVLG VN
Sbjct: 304 WKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTVN 363

Query: 362 FASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMI 421
           F ST +A+  VDK GRRKCLL G+A M  C VIF+++GV  LYP+G+D PSSK AGN MI
Sbjct: 364 FFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMI 423

Query: 422 VFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI 481
           VFTC +IF FA +WAP+AY++VAES+P +VK+RAM+I+   NW+W FLIGFFTPFIT +I
Sbjct: 424 VFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGSI 483

Query: 482 GFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
            F YGYVF+GCL            ET GL+LEE+  +Y EG+KPWKS SW+
Sbjct: 484 HFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWV 534

>YNR072W (HXT17) [4655] chr14 (772654..774348) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1695 bp, 564 aa]
          Length = 564

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/532 (54%), Positives = 372/532 (69%), Gaps = 1/532 (0%)

Query: 2   SEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCL 61
           S   + R         IH  P V+K  +D           N E P + +  Y  +  LC 
Sbjct: 3   SSTESDRDIQDGPDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLLCY 62

Query: 62  MIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFG 120
            I+FGGF+ GWD+G  +GF+N  +FK  FG  K S G YYLS+VR GL+V +F+IGCA G
Sbjct: 63  PISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIG 122

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
           GL   RL D  GRR+ ++ VVLVY+VG +IQI+S+ KWYQYF+G+II G+G GG +VL P
Sbjct: 123 GLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCP 182

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
            L+SE AP  +RG  VS YQL +T GIFLGYC+ YGT+ Y N+ QWRVPLGL F + + +
Sbjct: 183 MLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTLII 242

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
           I GML+VPESPR+L+E  R+E+A+ S+AK NKV+ EDP ++ + D I A V  +R  G A
Sbjct: 243 IIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEA 302

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           SW ELFS K  +L R+I GI++Q+  QLTG NYFF+YGTTIF +VG+ D F+TSIVLG V
Sbjct: 303 SWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTV 362

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           NF ST +A+  VDK GRRKCLL G+A M  C VIF+++GV  LYP+G+D PSSK AGN M
Sbjct: 363 NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAM 422

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           IVFTC +IF FA +WAP+AY++VAES+P +VK+RAM+I+   NW+W FLIGFFTPFIT +
Sbjct: 423 IVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFITGS 482

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           I F YGYVF+GCL            ET GL+LEE+  +Y EG+KPWKS SW+
Sbjct: 483 IHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWV 534

>YDL245C (HXT15) [632] chr4 complement(11657..13360) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/521 (53%), Positives = 370/521 (71%), Gaps = 1/521 (0%)

Query: 13  SQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGW 72
           S    +H  P  +K  +D    +        + P +    Y  +  LC  ++FGGF+ GW
Sbjct: 17  SSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLIIYLLCYPVSFGGFLPGW 76

Query: 73  DTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMY 131
           D+G  +GF+N  +FK  FG  K S G YYLS+VR GL+V +F++GC+ GG+   RL D  
Sbjct: 77  DSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTL 136

Query: 132 GRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHI 191
           GRR+ ++ VVLVY+VG +IQI+S+ KWYQYF+G+II G+G GG +VL P L+SE AP  +
Sbjct: 137 GRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDL 196

Query: 192 RGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESP 251
           RG  VS YQL +T GIFLGYC+ YGT+ YSN+ QWR+P+GL F +A+ +I GML+VPESP
Sbjct: 197 RGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESP 256

Query: 252 RFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGA 311
           R+L+E  R+E+A  S+AK NKV+ EDP ++ + D I A V  +R  G ASW ELFS K  
Sbjct: 257 RYLIECERHEEACVSIAKINKVSPEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTK 316

Query: 312 ILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYT 371
           +L R+I GI++Q+  QLTG NYFF+YGTTIF +VG+ D F+TSIVLG VNF ST +A+  
Sbjct: 317 VLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMV 376

Query: 372 VDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFF 431
           VDK GRRKCLL G+ASM  C VIF+++GV  LYP+G+D PSSK AGN MIVFTC +IF F
Sbjct: 377 VDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCF 436

Query: 432 AISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMG 491
           A +WAP+AY++VAES+P +VK++AM+I+   NW+W FLIGFFTPFIT +I F YGYVF+G
Sbjct: 437 ATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVG 496

Query: 492 CLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           CL            ET GL+LEE+  +Y EG+KPWKS SW+
Sbjct: 497 CLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWV 537

>YJR158W (HXT16) [3048] chr10 (732355..734058) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1704 bp, 567 aa]
          Length = 567

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/521 (53%), Positives = 369/521 (70%), Gaps = 1/521 (0%)

Query: 13  SQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGW 72
           S    +H  P  +K  +D    +        + P +    Y  +  LC  ++FGGF+ GW
Sbjct: 17  SSAADVHVQPPGEKEWSDGFYDKEVINGNTPDAPKRGFLGYLIIYLLCYPVSFGGFLPGW 76

Query: 73  DTGTISGFVNQTDFKRRFGQMK-SDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMY 131
           D+G  +GF+N  +FK  FG  K S G YYLS+VR GL+V +F++GC+ GG+   RL D  
Sbjct: 77  DSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTL 136

Query: 132 GRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHI 191
           GRR+ ++ VVLVY+VG +IQI+S+ KWYQYF+G+II G+G GG +VL P L+SE AP  +
Sbjct: 137 GRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDL 196

Query: 192 RGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESP 251
           RG  VS YQL +T GIFLGYC+ YGT+ YSN+ QWR+P+GL F +A+ +I GML+VPESP
Sbjct: 197 RGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESP 256

Query: 252 RFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGA 311
           R+L+E  R+E+A  S+AK +KV+ EDP ++ + D I A V  +R  G ASW ELFS K  
Sbjct: 257 RYLIECERHEEACVSIAKIDKVSPEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTK 316

Query: 312 ILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYT 371
           +L R+I GI++Q+  QLTG NYFF+YGTTIF +VG+ D F+TSIVLG VNF ST +A+  
Sbjct: 317 VLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLGTVNFFSTIIAVMV 376

Query: 372 VDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFF 431
           VDK GRRKCLL G+ASM  C VIF+++GV  LYP+G+D PSSK AGN MIVFTC +IF F
Sbjct: 377 VDKIGRRKCLLFGAASMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIVFTCFYIFCF 436

Query: 432 AISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMG 491
           A +WAP+AY++VAES+P +VK++AM+I+   NW+W FLIGFFTPFIT +I F YGYVF+G
Sbjct: 437 ATTWAPVAYIVVAESFPSKVKSKAMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVG 496

Query: 492 CLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           CL            ET GL+LEE   +Y EG+KPWKS SW+
Sbjct: 497 CLVAMFLYVFFFLPETIGLSLEETQLLYEEGIKPWKSASWV 537

>YIL170W (HXT12) [2508] chr9 (19847..21220) Protein of unknown
           function [1374 bp, 457 aa]
          Length = 457

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/428 (65%), Positives = 345/428 (80%), Gaps = 2/428 (0%)

Query: 107 GLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRI 166
           GLIV IFNIGCA GG+ L ++GD+YGRRIGL+ V  +Y+VGI+IQI S +KWYQYFIGRI
Sbjct: 2   GLIVSIFNIGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRI 61

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW 226
           ISG+GVGGIAVLSP LISE APKHIRGT V  YQLM T+GIFLGYCTNYGTK+Y N+ QW
Sbjct: 62  ISGIGVGGIAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQW 121

Query: 227 RVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDT 286
           RV LGL FA+A FM++GM+ VPESPR+L+E G+ E+AK SL+KSNKV+++DP+++AE DT
Sbjct: 122 RVGLGLCFAWATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVSVDDPALLAEYDT 181

Query: 287 IMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVG 346
           I A +E E+LAGNASW EL S K  +  RV+MG++IQSLQQLTG+NYFFYYGTTIF +VG
Sbjct: 182 IKAGIEIEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSVG 241

Query: 347 MKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPN 406
           +KDSFQTSI++G+VNF S+F+A+YT+++FGRR CLL G+ASM  CF +F++VGVT L+P 
Sbjct: 242 LKDSFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQ 301

Query: 407 GKDQP--SSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANW 464
           G      +S+ AGN MIVFT  FIF FA +WA   +VIV+E++PLR K+R MAIA  ANW
Sbjct: 302 GSSHQDITSQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIATAANW 361

Query: 465 IWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVK 524
           +WGFLI FFTPFIT AI F YGYVF+GCL            ETKGLTLEEVN M++EGV 
Sbjct: 362 MWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVP 421

Query: 525 PWKSGSWI 532
            WKS SW+
Sbjct: 422 AWKSASWV 429

>Scas_634.16
          Length = 471

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/428 (65%), Positives = 340/428 (79%), Gaps = 4/428 (0%)

Query: 19  HSTPIVQKLETDESPIQT---KSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTG 75
           HS    Q  + D+  I+      E   AE+P KP +AY TV  LCLMIAFGG+V+GWDTG
Sbjct: 43  HSVLEAQSNKDDDEEIKNYGEDGEIAPAEMPKKPASAYVTVSILCLMIAFGGYVYGWDTG 102

Query: 76  TISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRI 135
           TISGFV QTD+ RR+GQ K DGTYYLS VRTGL++ IFNIGCA GGL   RLGDM+GRR 
Sbjct: 103 TISGFVAQTDYVRRYGQKKKDGTYYLSKVRTGLLLAIFNIGCAIGGLLWSRLGDMWGRRK 162

Query: 136 GLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTC 195
            L+ V  VY++G++I IA+   WYQYFIGRIISG+GVGGIAV SP LISE APKH+RGT 
Sbjct: 163 ALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLLISEVAPKHVRGTL 222

Query: 196 VSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLV 255
           VS YQLMITLGIFLGYCTN+GT++YSNSVQWRVPLGL FA+A+FMIA M  VPESPR+L+
Sbjct: 223 VSCYQLMITLGIFLGYCTNFGTRNYSNSVQWRVPLGLGFAWALFMIAAMFFVPESPRYLI 282

Query: 256 EKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPR 315
           E G+ E+AKRS+A+SN++T++DPS++AE++ + A VE ER AG+ASW ELF  KG IL R
Sbjct: 283 EVGQMEEAKRSVAQSNRLTVDDPSVIAEVEFLTAGVEAEREAGSASWMELFQTKGKILHR 342

Query: 316 VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKF 375
           VIMGIMIQ+LQQLTG NYFF+YGT IF ++GM D F+ S+V+GIVNFASTF A+Y VD+F
Sbjct: 343 VIMGIMIQTLQQLTGANYFFFYGTLIFASIGMNDGFKASVVIGIVNFASTFPAIYIVDRF 402

Query: 376 GRRKCLLGGSASMAICFVIFSTVGVTSLYPNG-KDQPSSKAAGNVMIVFTCLFIFFFAIS 434
           GRR CLL G+A M  C V+F++VGVT L+P+G ++  +SK AGN MI FTC FIF FA +
Sbjct: 403 GRRTCLLFGAAGMICCMVVFASVGVTRLHPDGDQNGVASKGAGNCMICFTCFFIFCFANT 462

Query: 435 WAPIAYVI 442
           WAP AYV+
Sbjct: 463 WAPCAYVM 470

>Kwal_26.6680
          Length = 416

 Score =  513 bits (1322), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 241/395 (61%), Positives = 305/395 (77%)

Query: 138 MCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVS 197
           M V++VY+VG +IQI +  KWY YFIG+II G GVGG++VLSP LISE +PKH+RGT VS
Sbjct: 1   MLVMIVYVVGAIIQITADRKWYHYFIGKIIYGWGVGGMSVLSPMLISEISPKHLRGTLVS 60

Query: 198 FYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEK 257
            +QLM+T GIFLGYC  YGT+ YS+S QWR+P+GL+F +AI ++ GM  VPESPR+LVE 
Sbjct: 61  CFQLMVTFGIFLGYCAVYGTRQYSDSAQWRIPVGLSFLWAIIIVTGMFFVPESPRYLVEA 120

Query: 258 GRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVI 317
            + E+AKRS+A++ K++++DP +  E D I+A VE +R  G ASWGELFS K  +L R+I
Sbjct: 121 NKVEEAKRSIARAFKLSVDDPEVQEETDLIVAGVEAQREQGEASWGELFSVKTKVLQRLI 180

Query: 318 MGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGR 377
            GI++QS  QLTG NYFFYYGTTIF+++G+ DSFQTSIVLG VN AS+F+++YTVD  GR
Sbjct: 181 TGILMQSFLQLTGENYFFYYGTTIFDSIGLTDSFQTSIVLGTVNLASSFISMYTVDALGR 240

Query: 378 RKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAP 437
           RKCLL G+A MAIC VIF++VGVTSL PNG D  +SK+AGN M+VF CLFI  FA +WAP
Sbjct: 241 RKCLLWGAAGMAICMVIFASVGVTSLRPNGPDGEASKSAGNCMVVFICLFILCFATTWAP 300

Query: 438 IAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXX 497
           I+YV+V+ES+PLRVK++ M+I+   NW+W FLI FFTPFIT AI F YGYVF GCL    
Sbjct: 301 ISYVVVSESFPLRVKSKCMSISTAFNWLWQFLISFFTPFITGAINFYYGYVFFGCLVAMF 360

Query: 498 XXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
                   ET GLTLEEV  +Y EGV  W+S SW+
Sbjct: 361 LYVFFFVPETGGLTLEEVQTLYDEGVPAWRSTSWV 395

>AFR602W [3794] [Homologous to ScYNL318C (HXT14 ) - NSH]
           complement(1523019..1524695) [1677 bp, 558 aa]
          Length = 558

 Score =  368 bits (945), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 193/519 (37%), Positives = 302/519 (58%), Gaps = 16/519 (3%)

Query: 13  SQQTSIHSTPIVQKLETDESPIQTKSEYTNAELP---AKPIAAYWTV--ICLCLMIAFGG 67
           ++  ++ +  +++  E +E  +   +  T+  +    A P+     V  +  CL +AF G
Sbjct: 39  TETKAMDTRSVLELKEKEEYGVYEAAGSTDRSISLSGASPVPEGSLVRPVLYCLSVAFCG 98

Query: 68  FVFGWDTGTISGFVNQTDFKRRFG-QMKSD-GTYYLSDVRTGLIVGIFNIGCAFGGLTLG 125
            +FGWD GTI G      F+   G +   D G +       GL++GIFNIGCA GGLT+ 
Sbjct: 99  IIFGWDLGTIGGISTMPSFQNTLGPRFNGDTGLHEFPGRLLGLLIGIFNIGCAIGGLTIA 158

Query: 126 RLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISE 185
           RLGD+ GR+I ++  +LVY VG+ +Q+ S   WY+YFIGR+I+G+ VG   VL P  +SE
Sbjct: 159 RLGDIKGRKIAILTSLLVYAVGMFVQLGSGHFWYRYFIGRLIAGLAVGATMVLVPMFLSE 218

Query: 186 TAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTK----DYSNSVQWRVPLGLNFAFAIFMI 241
            AP  IRG  +  YQ++I LGI LG   NY  K    D  +++ W+VP+     F + + 
Sbjct: 219 LAPVRIRGAMIVLYQVVICLGIALGSIVNYACKELVHDTLSNMTWKVPIFFQIGFTVLLS 278

Query: 242 AGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDT-IMANVETERLAGNA 300
             +L+ PES  FL  KG  E AKRS A  N ++ + P +   + + +  +++++ +  + 
Sbjct: 279 LALLITPESAEFLAMKGHLEKAKRSFAVMNGLSKDHPFVEERVASFVQVSMKSDDIEHSG 338

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
              E       +  R+ +G+ + +LQ L+G NYFFYYGTT+F  VG++D++ TSI++G V
Sbjct: 339 DRWEFIRGNPRLGLRLFIGVTVMALQMLSGVNYFFYYGTTLFRFVGIEDAYVTSIIIGCV 398

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           +   TF+ +Y V++ GR+ CLL G+  M IC  +++ +G  +L    KD  ++K  G VM
Sbjct: 399 DLLGTFIGVYIVERLGRKICLLSGATGMFICMTVYACLGSFAL----KDDSNNKTVGAVM 454

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           I FTC+F+ FFA +  P++ V+++E +P+R K  +MAI    NW+  FLI F TP +T A
Sbjct: 455 IFFTCVFVMFFAATSGPVSMVVMSEIFPIRTKVMSMAICTSVNWLVNFLIAFVTPDVTDA 514

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           I + +G+VF GCL            ETKGLT E+V+ +Y
Sbjct: 515 INYRFGFVFSGCLLFSIVFFIYLVPETKGLTHEQVDAIY 553

>KLLA0E21021g 1870154..1871740 gi|32400014|emb|CAE00632.1
           Kluyveromyces lactis hexose transporter 3, hypothetical
           start
          Length = 528

 Score =  363 bits (933), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 199/516 (38%), Positives = 294/516 (56%), Gaps = 23/516 (4%)

Query: 14  QQTSIHSTPIVQKLETDESPIQTKSE-YTNAELPAKPIAAYWTVICLCLMIAFGGFVFGW 72
           +  S+ +   +  L +  S   TKS      +LP KPI        LCL  +F GF+FGW
Sbjct: 21  EMVSLTNYSAIGSLTSQLSQNDTKSGGIEQKKLPLKPI-------LLCLATSFAGFIFGW 73

Query: 73  DTGTISGFVNQTDFKRRFGQM--KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDM 130
           D GTI G  N   F+  FG     S  T+Y   +  GLIV IFNI CA GGL L ++ D+
Sbjct: 74  DVGTIGGITNMVSFQNFFGTNFDSSSNTHYFPKLLIGLIVSIFNISCALGGLFLVKIADI 133

Query: 131 YGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKH 190
            GR+ G+   + +Y +G +I       W+ +F  R ISG+GVG  AV+ P  I+E+AP +
Sbjct: 134 NGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFISGLGVGATAVMIPMFIAESAPIN 193

Query: 191 IRGTCVSFYQLMITLGIFLGYCTNY---GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMV 247
           IRG  V  YQLMITLGI LG   NY    T   +++  W++P+GL   +A  +  G+  +
Sbjct: 194 IRGAMVVLYQLMITLGILLGNVINYCCRSTLHETDNATWKIPVGLGNVWAAIVALGVHFM 253

Query: 248 PESPRFLVEK-GRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA---SWG 303
           PESP FL ++ G    AK + A  N + ++DP + + +  +M + + E    N    S  
Sbjct: 254 PESPVFLTKRLGSALKAKAAFAHMNNLDVDDPIVDSHIRKMMESADAEVSTHNDMKNSRF 313

Query: 304 ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFA 363
           E    +  +  R+ +GIM+ + QQL+G NYFFYYGTT+FN+VG++D + TSI+L  VNF 
Sbjct: 314 EFILGQPRLGFRLFIGIMVMAFQQLSGANYFFYYGTTLFNSVGIEDPYLTSILLSSVNFI 373

Query: 364 STFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVF 423
           STF  +Y V+K GR+ CL+ GSA M  C  ++++VG  +L        S + +G +M+ F
Sbjct: 374 STFFGIYLVEKLGRKACLILGSAGMFTCMSVYASVGSFAL------NKSPQNSGAIMVTF 427

Query: 424 TCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGF 483
           TC++I FFA +  P+++V+++E +P R K  +MA+    NW+  F I   TP++T  IGF
Sbjct: 428 TCVYIMFFACTSGPVSFVVISELFPSRTKAISMAVCTSINWLCNFFISLCTPYVTDKIGF 487

Query: 484 SYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
            +G+VF GCL            ETK  T E+V+ +Y
Sbjct: 488 KFGFVFAGCLFVSFWFFTFLLKETKNKTPEQVDALY 523

>Scas_600.1
          Length = 293

 Score =  348 bits (893), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 203/264 (76%), Gaps = 3/264 (1%)

Query: 272 KVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGN 331
           KV+++DP++ AE D I + +E ERLAGNASWGELFS KG ++ R++M  M+Q LQQLTG 
Sbjct: 1   KVSVDDPAVQAECDLITSGIEAERLAGNASWGELFSTKGKVVQRLLMCCMLQCLQQLTGC 60

Query: 332 NYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAIC 391
           NYFFYYGT IF AVG+KDS+QT+IV GIVNFASTFVA Y VD +GRRKCL+ G+A+M  C
Sbjct: 61  NYFFYYGTVIFQAVGLKDSYQTAIVFGIVNFASTFVAFYVVDHYGRRKCLMWGAAAMVCC 120

Query: 392 FVIFSTVGVTSLYPNG---KDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYP 448
           +V++++VGVT LYP+G   KD  SSK AGN MIVF+C FIF FA +WAPI +V+V+ES+P
Sbjct: 121 YVVYASVGVTRLYPDGIKHKDTNSSKGAGNCMIVFSCFFIFSFACTWAPICWVVVSESFP 180

Query: 449 LRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETK 508
           L++K + MA+A G NW W FL+ FFTPFIT AI F YGYVFMGC+            E K
Sbjct: 181 LKIKPKGMALANGCNWFWNFLVSFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPEMK 240

Query: 509 GLTLEEVNEMYVEGVKPWKSGSWI 532
           GLTLEEV+E++ EGV PWKS  W+
Sbjct: 241 GLTLEEVDELWQEGVLPWKSPDWV 264

>Scas_716.53
          Length = 523

 Score =  344 bits (883), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/526 (38%), Positives = 297/526 (56%), Gaps = 26/526 (4%)

Query: 9   VESGSQQTSIHSTPIVQKLETDESPI--QTKSEYTNAEL---PAKPIAAYWTVICLCLMI 63
           ++S    TSI ST  + +  + E PI    K    N E      K   +  T + +CL I
Sbjct: 8   LDSNEHTTSITST--MSRSSSQEVPIALTKKRNLGNEETILQENKKNPSLITPMLICLAI 65

Query: 64  AFGGFVFGWDTGTISGFVNQTDFKRRFG--QMKSDGTYYLSDVRTGLIVGIFNIGCAFGG 121
           +FGGF+FGWD GTI G  N + FK RFG  Q +  GT +   +  GLI+GIFN+    GG
Sbjct: 66  SFGGFLFGWDIGTIGGIANMSSFKERFGTRQDQGKGTKHFPGLLIGLIIGIFNLSAGVGG 125

Query: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           + L + GD +GR+      + +Y +G+++Q+  +  W+Q FIGR+I G+ +GGI V+ P 
Sbjct: 126 VALAKCGDWWGRKRATYFFIFIYSIGLLVQLIHNRAWFQIFIGRLICGLAIGGINVIVPM 185

Query: 182 LISETAPKHIRGTCVSFYQLMITLGIFLG-----YCTNYGTKDYSNSVQWRVPLGLNFAF 236
            ISE AP  +RG+ V+FYQL IT GI +G      C N  ++ + N   W++PLGL F +
Sbjct: 186 FISEIAPLRVRGSMVTFYQLKITFGILVGNITVFLCHNGFSRSHQNEA-WQIPLGLGFVW 244

Query: 237 AIFMIAGMLMVPESPRFL-VEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETER 295
           A  +I G+   PES ++L ++K R++ A  S A+ N ++  D   +  ++ +    E +R
Sbjct: 245 AFIVILGLYNSPESAQYLGIKKERWDAALMSTARMNNLSTGDIRAINIVEEMQRRAEQDR 304

Query: 296 LAGNASWG--ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQT 353
           L  ++     E    K  +  R+ +GIM+   QQL+G NYFFYYGTTIF  VG+ D + T
Sbjct: 305 LEKSSRRNIFEFIFGKPKLGLRLFIGIMLMIFQQLSGINYFFYYGTTIFAKVGLNDPYTT 364

Query: 354 SIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSS 413
           +I+L  VNF +TF  +Y V+   RR  L+ GS  M  C +I+S++G  +L  +G      
Sbjct: 365 AIILSSVNFVATFFGIYFVEALRRRTSLVFGSIGMFCCMMIYSSMGSFALNTDG------ 418

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFF 473
              G  MIV TC++I  FAI+  P+  V+V+E YP+R K  +MA    ANWI  FLI F 
Sbjct: 419 --TGITMIVVTCVYIALFAITLGPVTIVLVSELYPMRTKAMSMATCSFANWIMNFLITFL 476

Query: 474 TPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           TP IT+ IGF YGYVF  CL            ETK  T  E++ M+
Sbjct: 477 TPLITAQIGFKYGYVFAVCLFFSTCFDWTTVPETKNKTPTEIDNMF 522

>Kwal_55.20068
          Length = 267

 Score =  328 bits (841), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/239 (65%), Positives = 187/239 (78%), Gaps = 2/239 (0%)

Query: 296 LAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSI 355
           +AG ASW EL + K  +L R I GIMI SLQQLTG+NYFFYYGTTIFNAVG+KDSFQTSI
Sbjct: 1   MAGKASWAELITGKPQMLKRTINGIMIMSLQQLTGDNYFFYYGTTIFNAVGLKDSFQTSI 60

Query: 356 VLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP--SS 413
           +LGIVNF ST ++LYTVDKFGRR CL+ G+  M  C+ ++++VGVT LYP+G +    +S
Sbjct: 61  ILGIVNFVSTSLSLYTVDKFGRRNCLIYGAIGMIACYTVYASVGVTRLYPDGANHKDVTS 120

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFF 473
           K AGNV+I F C +IF FA +WAPIAYV+++E+YPLRVK RAM++A  ANW+WGFLI FF
Sbjct: 121 KGAGNVLICFACFYIFCFATTWAPIAYVLISETYPLRVKGRAMSLASAANWLWGFLISFF 180

Query: 474 TPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           TPFITSAI F YGYVFMGC+            ETKGLTLEEVNEMY EGV PWKS +W+
Sbjct: 181 TPFITSAINFYYGYVFMGCMVFAVFYVFFLIPETKGLTLEEVNEMYAEGVLPWKSANWV 239

>YNL318C (HXT14) [4295] chr14 complement(38706..40328) Member of the
           hexose transporter family of the major facilitator
           superfamily (MFS) [1623 bp, 540 aa]
          Length = 540

 Score =  337 bits (864), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/542 (35%), Positives = 305/542 (56%), Gaps = 41/542 (7%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60
           +S F  + +++G  +        ++ L+  E  I+ ++   +        A+    + LC
Sbjct: 14  ISHFHNNELDAGRGR---DYNVTIKYLDDKEENIEGQAAKISHN------ASLHIPVLLC 64

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQ---MKSDGTYY-----LSDVRTGLIVGI 112
           L+I+ GGF+FGWD GTI G  N   F+ +FG    +  D T +     L+D++ GLI+ I
Sbjct: 65  LVISLGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGLIISI 124

Query: 113 FNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGV 172
           FNI C  G LTL ++GD  GR+ G+   ++VY +GI IQI S  +WY   +GR ++G+GV
Sbjct: 125 FNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVTGIGV 184

Query: 173 GGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY----GTKDYSNSVQWRV 228
           G   VL P  +SE +P  IRG+ VS YQL++T GI +G   N+      KD + ++ W++
Sbjct: 185 GVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNIAWQL 244

Query: 229 PLGLNFAFAIFMIAGMLMVPESPRFLVE-KGRYEDAKRSLAKSNKVTIEDPSIVAEMDTI 287
           PL L + +AI +   ++ VPESP++L + K     AK S A+ N +   D  ++  +D +
Sbjct: 245 PLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEFIDDL 304

Query: 288 MANV----------ETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYY 337
           + N           + + L    ++ E    K  +  R+I+G+MI + QQL+G NYFFYY
Sbjct: 305 LENNYNNEETNNESKKQSLVKRNTF-EFIMGKPKLWLRLIIGMMIMAFQQLSGINYFFYY 363

Query: 338 GTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFST 397
           GT++F  VG+KD + TSI+L  VNF ST + +Y V+K+G + CLL GS ++    + ++T
Sbjct: 364 GTSVFKGVGIKDPYITSIILSSVNFLSTILGIYYVEKWGHKTCLLYGSTNLLFYMMTYAT 423

Query: 398 VGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMA 457
           VG       G++   S     V+I+ TC FIF+FAI+  P+ +V+V+E +PLR +  +MA
Sbjct: 424 VGTF-----GRETDFSNI---VLIIVTCCFIFWFAITLGPVTFVLVSELFPLRTRAISMA 475

Query: 458 IAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNE 517
           I    NW++ FLI   TP I S I F  GY+F  CL            ET+    +E+N+
Sbjct: 476 ICTFINWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALIIFSWILVPETRKKNEQEINK 535

Query: 518 MY 519
           ++
Sbjct: 536 IF 537

>CAGL0M04103g 452677..454272 similar to sp|P42833 Saccharomyces
           cerevisiae YNL318c HXT1 hexose transport protein,
           hypothetical start
          Length = 531

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/527 (35%), Positives = 286/527 (54%), Gaps = 21/527 (3%)

Query: 10  ESGSQQTSIHSTPIVQKLE-TDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGF 68
            S ++  ++++    Q  + + +S + T       EL  K I  +   + LC +I+FGG 
Sbjct: 13  SSPTENYTLNTAETRQSFQLSGKSEVNTIPGEKYEELKMKYIRQHTKAVVLCCLISFGGM 72

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKS--DGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           + GWD GT+ G      F   FG   +       LS+++ GL + IFNIGCA GG+   R
Sbjct: 73  ILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSAKELSNMKRGLYISIFNIGCALGGIMFSR 132

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           L +  GRR+G++  +  Y + + +Q+ S+  +      R + G+ VG I+VL P  +SE+
Sbjct: 133 LSNTVGRRVGILTAIAKYTLVLTVQLFSNGNFILLLASRFVLGVTVGAISVLVPMFVSES 192

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTK------DYSNSVQWRVPLGLNFAFAIFM 240
           AP  IRG  V  YQL ITLGI  G   NY T       D  N++ W++P+   + +A  +
Sbjct: 193 APIKIRGALVVVYQLAITLGILFGNILNYMTNKHLSMVDPMNNMAWKIPMLFGYLWAAIV 252

Query: 241 IAGMLMVPESPRFLVE-KGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMA--NVETERLA 297
             G  + PES  FL + +  YE AK S +  N +++ D   +  ++ ++   +V  E   
Sbjct: 253 AVGACITPESVHFLAKIRNDYESAKISYSIMNNISVFDHETIDYVNNLLVKQDVYNENDL 312

Query: 298 GNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVL 357
            N  + E    K     R+++GIM+ + QQL+G NYFFYYGT++F +VG+KD++ T+I+L
Sbjct: 313 RNHKF-EFLYGKPKYGKRLLIGIMVMAFQQLSGINYFFYYGTSLFKSVGIKDTYATAIIL 371

Query: 358 GIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAG 417
             VNF STF  +Y V+  GRR  L+ GS  M IC + +++ G  SL    KD  S     
Sbjct: 372 SSVNFISTFAGIYLVESLGRRSTLIYGSFGMFICMIFYASFGTLSL---RKDLLSF---- 424

Query: 418 NVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFI 477
            V+I+ TCLFI  FAI+  P+++V+VAE +P R ++ +M+I    NW+  F I   TP I
Sbjct: 425 -VLIIVTCLFISIFAITIGPVSFVVVAELFPTRTRSVSMSICSSFNWLVNFAIALATPVI 483

Query: 478 TSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVK 524
            + IGF YG+ F GCL            ETK  T EE++ M+   +K
Sbjct: 484 INRIGFLYGFFFAGCLLLATGFEAFFVPETKNKTEEEIDYMFQNNLK 530

>Kwal_56.24841
          Length = 511

 Score =  309 bits (792), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 171/476 (35%), Positives = 274/476 (57%), Gaps = 18/476 (3%)

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           L +AFGG +FG+DTGTISG +     K  F    +D  ++ +   T LI  I + G  FG
Sbjct: 27  LFVAFGGILFGYDTGTISGILAMDHVKTTF----TDRGHFTAG-ETSLITSILSAGTFFG 81

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
            ++   + D  GRR GL+   +++ +G+++Q+A++ +     +GR+I+G+GVG ++ + P
Sbjct: 82  SMSAPLVSDNLGRRYGLIVSTVIFTIGVILQVAATTQEL-LIVGRVIAGVGVGVLSAIVP 140

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
              SE APK IRG  VS YQ  IT+G+ L  C N GT   ++S  +R+PL + F +AI M
Sbjct: 141 LYQSEAAPKWIRGAVVSAYQWAITIGLLLAACVNQGTHARNDSGSYRIPLAIQFLWAIIM 200

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
             GM  +PESPRF V+KG+  +A  +L++   +  +DP++ AE++ I+AN   E+  G+ 
Sbjct: 201 FIGMCFLPESPRFYVKKGKVPEALSALSRLRGLPKDDPAVEAELEEILANYNYEKSFGST 260

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           +  + F        R+ +GI IQ+LQQLTG N+ FYYGT  F   G+++ F   +++ IV
Sbjct: 261 TVWDCFRPANHQSKRMFIGIAIQALQQLTGINFIFYYGTQFFQHSGIRNPFVIQLIMNIV 320

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           N   T   +  ++  GRR  LL G+  M +  +I ++VG T+L       P S AA   +
Sbjct: 321 NVIFTIPGIALIELAGRRNLLLWGAIGMCVSEIIVASVG-TAL-------PDSTAANKTL 372

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFIT-- 478
           I F+C FI  FA +W P+A+V++ E YPLRV+ +++A    +NW++ F I + TP++   
Sbjct: 373 IAFSCTFIASFAATWGPLAWVVIGEIYPLRVRGKSVAFCTASNWLFNFAIAYATPYLVDE 432

Query: 479 --SAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSWI 532
             + +     +++ GC             ETKGLTLE+V+E++  G     S  +I
Sbjct: 433 DRANLQSKVFFIWGGCTFLCFIFVYFCVYETKGLTLEQVDELFDSGASARTSKRFI 488

>Kwal_55.20064
          Length = 238

 Score =  292 bits (747), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 144/223 (64%), Positives = 171/223 (76%), Gaps = 3/223 (1%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAE--LPAKPIAAYWTVICLCLMIAFGG 67
           + GS  +++ + P   KL  +ES  +  +   +AE  L  K    +  V   C+M+AFGG
Sbjct: 17  DQGSHGSNVMNAP-AAKLHREESHDEIDALKKDAEEQLANKKSGDFVFVSLCCIMVAFGG 75

Query: 68  FVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRL 127
           FVFGWDTGTISGFV QTDFKRRFGQ  S G +YLS+VRTGL+V IFNIGCA GG+ LG+L
Sbjct: 76  FVFGWDTGTISGFVAQTDFKRRFGQTNSKGEHYLSNVRTGLMVSIFNIGCAIGGIVLGKL 135

Query: 128 GDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETA 187
           G++YGRR+GL  VV++Y VGI+IQIAS DKWYQYFIGRIISG+GVG I VLSP LISE +
Sbjct: 136 GEVYGRRLGLTIVVVIYAVGIIIQIASIDKWYQYFIGRIISGLGVGAITVLSPMLISEVS 195

Query: 188 PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPL 230
           PKH+RGT VS YQ M+T GIFLGYC NYGTK YSNSVQWRVPL
Sbjct: 196 PKHLRGTLVSCYQFMVTGGIFLGYCANYGTKTYSNSVQWRVPL 238

>Kwal_27.9678
          Length = 513

 Score =  296 bits (759), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 165/463 (35%), Positives = 266/463 (57%), Gaps = 18/463 (3%)

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           L +AFGG +FG+DTGTISG +     K+ F    +   ++ +D  T LI  I + G   G
Sbjct: 26  LFVAFGGILFGYDTGTISGVLAMDYVKQHF----TSRGHFTAD-ETSLITAILSAGTFCG 80

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
            +      D  GRR+GL+   +++ VG+V+Q+A++ +      GR+I+G GVG ++ + P
Sbjct: 81  AILAPLASDTIGRRLGLILSTIIFTVGVVLQVAATGQ-DLLIAGRVIAGAGVGVLSAIVP 139

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
              SE +PK IRG  VS YQ  IT+G+ L  C N GT    +S  +R+PL L   +A+ +
Sbjct: 140 LYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLALQLLWALIL 199

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
             GM+++PESPRF + K +  +A+R+L+K   +  E  ++ AE++ I+AN + E   G+ 
Sbjct: 200 FIGMVILPESPRFYIMKEKVPEARRALSKLRGLPEEHCAVEAELEEIVANYKFESSFGSN 259

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV 360
           S  + F      L R+++GI +Q LQQLTG N+ FYYGT  F   G+KD F   +++ +V
Sbjct: 260 SVWDCFKPANHQLKRILIGIAVQGLQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVV 319

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
           N   T   +  V+  GRR  LL G+  M +  +I + VG T+L       P S +A   +
Sbjct: 320 NVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVG-TAL-------PDSFSANKTL 371

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           I F+C FI  FA +W P+A+V+V E +PLRV+ +++A+   +NW++ F I + TP++  +
Sbjct: 372 IAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATPYLVDS 431

Query: 481 ----IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
               +     +++ GC             ETKGLTLE++++++
Sbjct: 432 EHANLQSKVFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLF 474

>Scas_624.5
          Length = 798

 Score =  264 bits (675), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/479 (33%), Positives = 255/479 (53%), Gaps = 25/479 (5%)

Query: 63  IAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGL 122
           +A GGF+FG+DTG I+   +    K           ++ ++ +  ++V   ++G  FG L
Sbjct: 119 VAVGGFLFGYDTGLINSLTDMAYVKSHLAP----NHHFFTNEQMSIVVSFLSLGTFFGAL 174

Query: 123 TLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           T   + D YGR+  +M    +++ +G  +Q+ASS  W    IGR++SG+G+G I+ + P 
Sbjct: 175 TAPVIADSYGRKATIMFSTAVIFSIGNSLQVASSG-WKLLIIGRVVSGLGIGLISAVVPL 233

Query: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241
             +E A K++RG  +S YQ  ITLG+ +    + GT+  +N   +R+P+GL + ++ F+ 
Sbjct: 234 YQAEAAKKNLRGAIISTYQCAITLGLLVSSAVSQGTQHINNPASYRIPIGLQYVWSSFLA 293

Query: 242 AGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNAS 301
            GM+ +PESPR+ V K   + A +SL+    V I+DP ++ E+  I A  + E   G +S
Sbjct: 294 IGMIFLPESPRYYVMKDDIDRAAKSLSFLRGVPIQDPRLLEELVEIKATYDYEASFGPSS 353

Query: 302 WGELF---SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLG 358
             + F    N+   + R+  GI IQ+ QQ +G N+ FYYG T F+  G+  S+  S++  
Sbjct: 354 IWDCFKSSENRPKQVLRMFTGIAIQTFQQFSGINFIFYYGVTFFSKTGVNKSYMVSLITY 413

Query: 359 IVNFASTFVALYTVDKFGRRKCLL-GGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAG 417
            VN A     ++ V+  GRRK LL GG    A  FVI + VG          +  S  A 
Sbjct: 414 AVNVAFNIPGMFLVEYLGRRKILLFGGIVVTASNFVI-AGVGC---------RMDSVVAN 463

Query: 418 NVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFI 477
            VMI F CLFI  F+ +W+   +VI AE YPL V+++  AI   ANW+  F+    TP+I
Sbjct: 464 KVMIAFICLFIASFSATWSGAVWVISAELYPLGVRSKCTAICAAANWLVNFICALITPYI 523

Query: 478 T-----SAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
                 S +G +  +++                ET GLTLEE++E+Y E    + S +W
Sbjct: 524 VNSGSESTMGANIFFIWGSLNALGVVCVFFTVYETSGLTLEEIDELYRESANCFGSIAW 582

>CAGL0I03872g 337985..340273 some similarities with sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2 or sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3, hypothetical
           start
          Length = 762

 Score =  256 bits (654), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/482 (32%), Positives = 257/482 (53%), Gaps = 25/482 (5%)

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           L +A GGF++G+DTG I+   +    K       S    + +  +  ++V   ++G   G
Sbjct: 121 LFVAVGGFLYGYDTGLINSITDMKYVKEHIAPNHS----FFTTTQISMLVSFLSLGTFVG 176

Query: 121 GLTLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLS 179
            L    + D+YGR+  ++   ++++ +G  +Q+A+        +GR+ISG+G+G I+ + 
Sbjct: 177 ALIAPWISDIYGRKSTIIFSTMIIFSIGNSLQVAAG-GLALLIVGRVISGIGIGIISAVV 235

Query: 180 PTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIF 239
           P   +E A KH+RG  ++ YQL ITLG+ +    + GT+  +    +RVP+GL + +++ 
Sbjct: 236 PLYQAEAAQKHMRGAIITTYQLAITLGLLVSSAVSQGTESINAPSSYRVPIGLQYVWSVV 295

Query: 240 MIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGN 299
           +  GM+ +PESPR+ + K   E+A RSL+    +++EDP ++ E+  I AN + E   G 
Sbjct: 296 LGVGMVFLPESPRYYIMKDEIEEAARSLSFLRGISLEDPRLLEELVEIKANYDYESSFGP 355

Query: 300 ASWGELF---SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIV 356
            S  + F     +   + R+  GI IQ+ QQ +G N+ FYYG   FN  G+K S+  S V
Sbjct: 356 VSIWDCFRSSEQRPKQVLRMFTGISIQAFQQFSGINFIFYYGVYFFNKTGIKSSYLVSFV 415

Query: 357 LGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAA 416
              VN A     ++ +D  GRRK L+ G  +M  C  I + VGV++          S  +
Sbjct: 416 TYAVNVAFNIPGMFLIDYLGRRKVLIFGGIAMTACNFIIAIVGVSA---------KSIVS 466

Query: 417 GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPF 476
            NVMI F C+FI  F+ +W  + +VI AE +PL V+++  AI   ANW+  F+    TP+
Sbjct: 467 NNVMIAFICVFIAAFSSTWGGVVWVISAELFPLGVRSKCTAICAAANWLVNFVCALMTPY 526

Query: 477 I-------TSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSG 529
           I       TS++G    +++                ET+GLTLEE+NE+YV    P+ S 
Sbjct: 527 IVDTGSNYTSSMGTKIYFIWGSLNALGTIVAYLTVYETRGLTLEEINELYVNSPTPFASN 586

Query: 530 SW 531
            W
Sbjct: 587 EW 588

>YDL138W (RGT2) [730] chr4 (213352..215643) Low-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of high glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2292 bp, 763 aa]
          Length = 763

 Score =  245 bits (626), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/515 (31%), Positives = 266/515 (51%), Gaps = 25/515 (4%)

Query: 29  TDESPIQTKSEYTNAELPAKPIAAYWTVICLC--LMIAFGGFVFGWDTGTISGFVNQTDF 86
           T+  P    +  T + L ++P+     V+ +   + +A GGF+FG+DTG I+   +    
Sbjct: 70  TNNEPAGDGAIETTSILLSQPLPLRSNVMSVLVGIFVAVGGFLFGYDTGLINSITDMPYV 129

Query: 87  KRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLM-CVVLVYI 145
           K       S    Y +  +  ++V   ++G  FG L    + D YGR+  +M    +++ 
Sbjct: 130 KTYIAPNHS----YFTTSQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFSTAVIFS 185

Query: 146 VGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITL 205
           +G  +Q+AS        +GR+ISG+G+G I+ + P   +E A K++RG  +S YQ  IT+
Sbjct: 186 IGNSLQVASG-GLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQWAITI 244

Query: 206 GIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKR 265
           G+ +    + GT   +    +R+P+GL + ++  +  GM+ +PESPR+ V K     A +
Sbjct: 245 GLLVSSAVSQGTHSKNGPSSYRIPIGLQYVWSSILAVGMIFLPESPRYYVLKDELNKAAK 304

Query: 266 SLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELF---SNKGAILPRVIMGIMI 322
           SL+    + IEDP ++ E+  I A  + E   G ++  + F    N+   + R+  GI I
Sbjct: 305 SLSFLRGLPIEDPRLLEELVEIKATYDYEASFGPSTLLDCFKTSENRPKQILRIFTGIAI 364

Query: 323 QSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL 382
           Q+ QQ +G N+ FYYG   FN  G+ +S+  S +   VN A +   +Y VD+ GRR  LL
Sbjct: 365 QAFQQASGINFIFYYGVNFFNNTGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRRPVLL 424

Query: 383 GGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVI 442
            G   MAI  ++ + VGV+     GK   +SK    +MI F CLFI  F+ +W  + +V+
Sbjct: 425 AGGVIMAIANLVIAIVGVSE----GKTVVASK----IMIAFICLFIAAFSATWGGVVWVV 476

Query: 443 VAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFI------TSAIGFSYGYVFMGCLXXX 496
            AE YPL V+++  AI   ANW+  F     TP+I      TS++G    +++ G     
Sbjct: 477 SAELYPLGVRSKCTAICAAANWLVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVA 536

Query: 497 XXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
                    ET+GLTLEE++E++ +      S  W
Sbjct: 537 VIVVYFAVYETRGLTLEEIDELFRKAPNSVISSKW 571

>CAGL0J09020g 887145..889715 highly similar to sp|P10870
           Saccharomyces cerevisiae YDL194w SNF3 or sp|Q12300
           Saccharomyces cerevisiae YDL138w RGT2, start by
           similarity
          Length = 856

 Score =  245 bits (626), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 161/500 (32%), Positives = 258/500 (51%), Gaps = 28/500 (5%)

Query: 43  AELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLS 102
           AE P K   ++   I +   +A GGF+FG+DTG I+  V+     R   +  +      +
Sbjct: 108 AEPPQK--QSHMMSIVVGAFVAVGGFLFGYDTGLINSIVDM----RYVRENIAPNHVGFT 161

Query: 103 DVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQY 161
             +  ++V   ++G   G L+   + D YGR+  +M    +V+ +G  +Q+ + +   Q 
Sbjct: 162 AQQLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLGNSLQVGAHN--IQL 219

Query: 162 FI-GRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDY 220
            I GR+ISG+GVG ++ + P   +E A K +RG  +S YQ  IT G+ +    + GT + 
Sbjct: 220 LIAGRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVSQGTHNR 279

Query: 221 SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSI 280
           +++  +R+P+GL + +A  + AGML +PESPR+ V + + + A +SL+    V I D  +
Sbjct: 280 NDASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQSLSFLRGVPIHDSGL 339

Query: 281 VAEMDTIMANVETERLAGNASWGELF-SNKGAILP--RVIMGIMIQSLQQLTGNNYFFYY 337
           + E+  I A  + E   G  ++ + F SNK       R+  GI IQ+ QQ +G N+ FYY
Sbjct: 340 LEELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQAFQQFSGINFIFYY 399

Query: 338 GTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFST 397
           G + FN  G+++S+  S++   VN   +   ++ V+ FGRR  LL G A M +   I + 
Sbjct: 400 GVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLYGGAIMTLSNFIIAI 459

Query: 398 VGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMA 457
           VG ++          S  A  VMI F CLFI  FA +W  + +VI AE YPL V+ +  A
Sbjct: 460 VGSST---------QSVVANKVMIAFICLFIASFAATWGGVVWVISAELYPLGVRAKCTA 510

Query: 458 IAVGANWIWGFLIGFFTPFITSA------IGFSYGYVFMGCLXXXXXXXXXXXCETKGLT 511
           I   ANW+  F+  F TP+I         IG    +++                ET+GLT
Sbjct: 511 ICAAANWLINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGILVVYFTVYETRGLT 570

Query: 512 LEEVNEMYVEGVKPWKSGSW 531
           LEE++E+Y +      S  W
Sbjct: 571 LEEIDELYTKSPNGIVSAKW 590

>YDL194W (SNF3) [679] chr4 (111581..114235) High-affinity glucose
           sensor responsible for induction of gene expression in
           the presence of low glucose, member of the glucose
           sensor subfamily of the hexose transporter family of the
           major facilitator superfamily (MFS) [2655 bp, 884 aa]
          Length = 884

 Score =  243 bits (619), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 151/489 (30%), Positives = 252/489 (51%), Gaps = 26/489 (5%)

Query: 43  AELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLS 102
           +E P K   +    IC+ + +A GGF+FG+DTG I+   +    K          T    
Sbjct: 86  SEPPQK--QSMMMSICVGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPNHDSFTAQ-- 141

Query: 103 DVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQY 161
             +  ++V   ++G  FG LT   + D YGR+  ++   + ++ +G  +Q+ +       
Sbjct: 142 --QMSILVSFLSLGTFFGALTAPFISDSYGRKPTIIFSTIFIFSIGNSLQVGAGGITL-L 198

Query: 162 FIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYS 221
            +GR+ISG+G+G I+ + P   +E   K +RG  +S YQ  IT G+ +    + GT   +
Sbjct: 199 IVGRVISGIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHARN 258

Query: 222 NSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIV 281
           ++  +R+P+GL + ++ F+  GM  +PESPR+ V K + ++A +SL+    V + D  ++
Sbjct: 259 DASSYRIPIGLQYVWSSFLAIGMFFLPESPRYYVLKDKLDEAAKSLSFLRGVPVHDSGLL 318

Query: 282 AEMDTIMANVETERLAGNASWGELF---SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYG 338
            E+  I A  + E   G++++ + F    ++     R+  GI +Q+ QQ +G N+ FYYG
Sbjct: 319 EELVEIKATYDYEASFGSSNFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYG 378

Query: 339 TTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTV 398
              FN  G+ +S+  S +   VN       L+ V+ FGRRK L+ G   M I   I + V
Sbjct: 379 VNFFNKTGVSNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIVAIV 438

Query: 399 GVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAI 458
           G +           + AA  VMI F CLFI  F+ +W  + +VI AE YPL V+++  AI
Sbjct: 439 GCSL---------KTVAAAKVMIAFICLFIAAFSATWGGVVWVISAELYPLGVRSKCTAI 489

Query: 459 AVGANWIWGFLIGFFTPFI------TSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTL 512
              ANW+  F+    TP+I      TS++G    +++                ETKGLTL
Sbjct: 490 CAAANWLVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVYETKGLTL 549

Query: 513 EEVNEMYVE 521
           EE++E+Y++
Sbjct: 550 EEIDELYIK 558

>Kwal_56.24469
          Length = 709

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 264/532 (49%), Gaps = 25/532 (4%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFV 69
           E   Q+++I       + E D     +  E T    P++P ++  +++ + + +A GGF+
Sbjct: 45  EKNVQESNIGEVGSNVESEDDRHIGLSNLESTLFLRPSRPQSSLMSIL-VGVFVAVGGFL 103

Query: 70  FGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGD 129
           +G+DTG I+        K  F + K   T         ++V   ++G  FG L    + D
Sbjct: 104 YGYDTGLINNITEMKYVKTHFAENKQQFTAK----EMSILVSFLSLGTFFGALVAPFMSD 159

Query: 130 MYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAP 188
            +GR+  ++     V++VG  +Q+A++       IGR+ SG+GVG I+ + P   SE A 
Sbjct: 160 TWGRKTTIIFSTFFVFMVGNSLQVAANGTTL-LVIGRVFSGVGVGFISAVVPLYQSEAAQ 218

Query: 189 KHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVP 248
           K +RG  +S YQ  IT G+ +    + GT +  +   +R+P+GL F ++  +  GM+ +P
Sbjct: 219 KRVRGAIISTYQWAITWGLLVSSAVSQGTHNRMDPSSYRIPIGLQFVWSCILGFGMIFLP 278

Query: 249 ESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELF-S 307
           ESPR+ V K + + A +SLA    V  +D  ++ E+  I AN + E   G+ S+ + F S
Sbjct: 279 ESPRYYVLKDQLDRAAKSLAFLRGVPEDDSGLLEELVEIKANYDYEMSFGSFSYLDCFRS 338

Query: 308 NKGAILPRVIM--GIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFAST 365
           +K     R+ M  GI IQ+ QQL+G N+ FYYG   F+  G+ DS+  S V   VN    
Sbjct: 339 SKSRTKQRLRMLTGIAIQAFQQLSGINFIFYYGVNFFSKSGVGDSYLVSFVTYAVNVGFN 398

Query: 366 FVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTC 425
              L+ V+  GRRK L+ G   M     + + VG             S  A  +MI F C
Sbjct: 399 IPGLFLVEYMGRRKVLIFGGVLMTAANFVIAIVGCVE---------RSVIADKIMIAFVC 449

Query: 426 LFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFI------TS 479
           +FI  F+ +W    + I AE YPL V+++  AI   +NW+  F+    TP+       TS
Sbjct: 450 VFIASFSATWGGCVWAISAELYPLGVRSKCTAICAASNWLVNFICAMITPYFIHTGAHTS 509

Query: 480 AIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
           ++G    +++ G              ET+GLTLEE++ +Y      + S SW
Sbjct: 510 SLGTKVFFIWGGLNAIGVVVVYLTVYETRGLTLEEIDLLYRLSPNCFTSDSW 561

>ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W
           (RGT2) - SH] complement(872925..874919) [1995 bp, 664
           aa]
          Length = 664

 Score =  231 bits (589), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 158/540 (29%), Positives = 270/540 (50%), Gaps = 26/540 (4%)

Query: 2   SEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCL 61
           S+   S+  +  +  S +  P++     D+S   +  E T  E PA   +   +++ + +
Sbjct: 41  SDEKHSKGCNDQKNASHYEQPVMVTDLRDDSEGFSIQE-TELERPAMRQSNKMSIL-VGI 98

Query: 62  MIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGG 121
            +A GGF++G+DTG I+     +  K+ F     + T     +   ++V   ++G   G 
Sbjct: 99  FVAVGGFLYGYDTGLINSITEMSFVKKHFAPNHVNFT----SMEMSILVSFLSLGTFIGA 154

Query: 122 LTLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
           L    L D YGR+  ++    ++++ G ++Q+ S+        GR+ SG+ VG I+V+ P
Sbjct: 155 LAAPLLADSYGRKSTVIFSTFIMFLEGTLLQV-SATSMALLVAGRVASGVAVGLISVVVP 213

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
               E A K  RG  +  YQ  IT G+ +    + GT   +++  +R+P+ L + + I +
Sbjct: 214 LYQGEAAQKWCRGAIICTYQWAITWGLLVSSAVSQGTYLRNDASSYRIPIALQYVWCIIL 273

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
            +GML++PESPR+ V + + + A  SL+    V  +D  ++ E+  I AN + E    ++
Sbjct: 274 GSGMLLLPESPRYYVLRDQLDKAALSLSFLRGVPHDDAGLLEELVEIKANYDYEMSLKSS 333

Query: 301 SWGELF---SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVL 357
           S+ + F    ++     R++ GI++Q+ QQ +G N+ FYYG   F++ G+  S+  S V 
Sbjct: 334 SYLDCFRTSEHRPKQQIRMLSGILLQAFQQFSGINFIFYYGVNFFSSTGISKSYLVSFVT 393

Query: 358 GIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAG 417
             VN       L+ V+  GRRK LL G   M I   I + VGV++          S  A 
Sbjct: 394 YAVNVVFNIPGLFLVEYAGRRKLLLVGGVLMTISNFIIAIVGVST---------DSVIAK 444

Query: 418 NVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFI 477
            VMIVF C+FI  F+ +W  + +V+ AE YPL V+++  AI   +NW+  F+    TP++
Sbjct: 445 KVMIVFICMFIAAFSATWGGVVWVMSAEMYPLGVRSKCAAICAASNWLVNFVCAMITPYL 504

Query: 478 ------TSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
                 TS +G +  +V+                ET GLTLEE+NE+Y        S +W
Sbjct: 505 IDISSYTSRLGSTIFFVWGSLNAIGVMVVYLTVYETSGLTLEEINELYRRCPSSLASCAW 564

>KLLA0F05181g 510384..512747 gi|2440082|emb|CAA75114.1 Kluyveromyces
           lactis putative glucose sensor, start by similarity
          Length = 787

 Score =  231 bits (589), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 150/487 (30%), Positives = 244/487 (50%), Gaps = 26/487 (5%)

Query: 57  ICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIG 116
           I + + +A GGF+FG+DTG I+         ++F   K+    + +  +  ++V   ++G
Sbjct: 90  ILVGMFVAVGGFLFGYDTGLINNISEMPYVNQKFAPNKN----HFTTPQISILVSFLSLG 145

Query: 117 CAFGGLTLGRLGDMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGI 175
              G L    + D YGR+  ++    +V+++G  +Q+A+        +GR++SGM VG I
Sbjct: 146 TFIGALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAAGSMTI-LVVGRVLSGMSVGLI 204

Query: 176 AVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFA 235
           +   P   SE A K +RG  +S YQ  IT G+ +    + GT    ++  +++P+GL + 
Sbjct: 205 SAAVPLYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIPIGLQYI 264

Query: 236 FAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETER 295
           ++  +  G+L +PESPR+ V K R + A +SL+    V  +D  ++ E+  I A  + E 
Sbjct: 265 WSFLLGVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPEDDSGLLEELVEIKATYDYEM 324

Query: 296 LAGNASWGELFSNKGAILP---RVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQ 352
             G  S+ + F +  +      R++ GI +Q+ QQ++G N+ FYYG   FN  G+ +S+ 
Sbjct: 325 SFGKISYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSGVSESYL 384

Query: 353 TSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPS 412
            S V   VN A     L+ V+  GRRK LL G   M I   I + VG+ +          
Sbjct: 385 VSFVTYAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIVGLAT---------D 435

Query: 413 SKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGF 472
           S  A  VMI F CLFI  F+ +W    +VI AE YPL V+ +  AI   +NW+  F+   
Sbjct: 436 SMVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAASNWLINFICAL 495

Query: 473 FTPFI--------TSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVK 524
            TP+I         ++IG    +V+                ET GL+LEE++E+Y +   
Sbjct: 496 ITPYIMHIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLEEIDELYKKSSS 555

Query: 525 PWKSGSW 531
              S  W
Sbjct: 556 GINSIEW 562

>Scas_701.44
          Length = 876

 Score =  225 bits (574), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 149/473 (31%), Positives = 237/473 (50%), Gaps = 24/473 (5%)

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLG 128
           +FG+DTG I+     T+       +  +   + ++ +  + V   ++G  FG LT     
Sbjct: 116 LFGYDTGLINSI---TEMDYVLTHLTPNHREFTTE-QLSITVSFLSLGTFFGALTAPVFA 171

Query: 129 DMYGRRIGLM-CVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETA 187
           D YGR++ +M   ++++ VG  +Q+A+ +      +GR+ISG G+G I+ + P   +E A
Sbjct: 172 DNYGRKVTIMISTLIIFSVGNSLQVAA-NGIVLLIVGRVISGFGIGIISAVVPLYQAEAA 230

Query: 188 PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMV 247
            K +RG  +S YQ  IT G+ +      GT +   +  +R+P+GL + ++  +  GM+ +
Sbjct: 231 HKSLRGAIISTYQWAITWGLLVSSAVAQGTHNRHGASSYRIPIGLQYIWSFILAFGMIFL 290

Query: 248 PESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNAS-WGELF 306
           PESPR+ V K + + A  SL+   +V I+D  ++ E+  I A  + E   G+   W    
Sbjct: 291 PESPRYYVLKDQLDKAAESLSFLRRVPIQDSGLLEELVEIKATYDYECSFGSTHFWDCFI 350

Query: 307 SNKGAILPRVIM--GIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFAS 364
           S+K     ++ M  GI IQ+ QQ +G N+ FYYG   FN  G+ +S+  S +   VN   
Sbjct: 351 SSKTRPKQKLRMFTGIAIQAFQQFSGINFIFYYGVNFFNKTGVDNSYLVSFITYAVNVIF 410

Query: 365 TFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFT 424
               +  V+  GRRK LL G   M +   I + VG T           S  A  VMI F 
Sbjct: 411 NIPGMVLVEFIGRRKVLLIGGILMLMSNFIVAIVGSTV---------ESVVADKVMIAFI 461

Query: 425 CLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFI------T 478
           CLFI  F+ +W  + +VI AE YPL V+++  AI   ANW+  F+    TP+I      T
Sbjct: 462 CLFIASFSATWGGVVWVISAELYPLGVRSKCTAICAAANWLVNFICCLITPYIVDTGSHT 521

Query: 479 SAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKSGSW 531
           S++G    Y++                ETKGLTLE+++E+Y        S  W
Sbjct: 522 SSMGTKIYYIWGSLNVLGVIVVYFTVYETKGLTLEQIDELYSRASNSINSTKW 574

>Kwal_34.16261
          Length = 327

 Score =  204 bits (520), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 163/274 (59%), Gaps = 13/274 (4%)

Query: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFG 66
           SR  SG   ++     I Q+L  +   ++ + +++  +         W V+  C  I+F 
Sbjct: 19  SRRNSGLDHSNKDLNHIAQRLSVN---MEVREKFSLRDQS-------WDVVLSCFGISFT 68

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSD-GTYYLSDVRTGLIVGIFNIGCAFGGLTLG 125
           GF FG+DTGTI G  N   + RRFG +  + G Y+++    G++V  F+IGC  GG T+ 
Sbjct: 69  GFFFGYDTGTIGGITNMQAWLRRFGHLDVESGEYHMATALVGIVVSAFHIGCIIGGFTIA 128

Query: 126 RLGDMYGRRIGLMCVVLVYIVGIVIQI-ASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           RL D  GRRI +    ++Y++GI IQ+ A  DKWYQ+ IGR+++G+ VG  AVLSP L+S
Sbjct: 129 RLADHLGRRIPIAIACIIYMIGISIQMSAGQDKWYQFMIGRMVTGLTVGANAVLSPMLLS 188

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKD-YSNSVQWRVPLGLNFAFAIFMIAG 243
           E AP  IRG  V+FYQ+ +T GI +GY   Y TK  YS+   WR+PL   F F++ ++  
Sbjct: 189 EIAPPGIRGLFVNFYQVNVTHGILVGYIVVYATKSTYSDDRMWRLPLIGGFVFSMIILPL 248

Query: 244 MLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED 277
           +   PESPR+L+++ R+EDAK   A+   + ++ 
Sbjct: 249 LARAPESPRYLIKRCRFEDAKCVFARLRGIDLKQ 282

>Kwal_34.16190
          Length = 556

 Score =  191 bits (486), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 137/488 (28%), Positives = 225/488 (46%), Gaps = 29/488 (5%)

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           L+    G +FG+D  ++S  +   +++  FG        Y      G I G  + G   G
Sbjct: 34  LVACISGLMFGFDISSMSSMIGTPEYREHFG--------YPGSTAQGGITGAMSGGSLLG 85

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
            L      D +GRR+ L     ++I G +IQ A+ ++     +GR+I GMGVG  + ++P
Sbjct: 86  SLVSPNFTDAFGRRVSLHLCAALWIAGAIIQCAAQNRG-MLIVGRVIGGMGVGFGSSVAP 144

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
              SE AP +IRGT    +Q  +TLGI + +   YG      +  +R+  G+     + +
Sbjct: 145 VYCSEVAPPNIRGTVCGLFQFSVTLGIMILFYVGYGCHFIHGTAAFRITWGVQIVPGLAL 204

Query: 241 IAGMLMVPESPRFLVEKGRYEDAKRSLAK-SNKVTIEDPSIVAEMDTIMANVETERLAGN 299
           +     +PESPR+L    R+E+A   +A+      ++DP +  +++ I   V  ++ A  
Sbjct: 205 LVAAFFLPESPRWLANNDRWEEASEVVARIGANGDVDDPRVQIQLEEIKEQVILDQQALG 264

Query: 300 ASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDS--FQTSIVL 357
             +  LF  K   L ++++G+  Q  QQL G N   YY   IF   G   S    +  + 
Sbjct: 265 FGYRHLFREK--TLNKIVVGVCAQMWQQLCGMNVMMYYIVYIFQMAGYSGSRVLVSGSIQ 322

Query: 358 GIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLY----PNGKDQ--- 410
            ++N   T  AL+ VDK GRR  L+ G   M I   +F   G+ + Y    PNG +    
Sbjct: 323 YVLNVVMTIPALFLVDKVGRRPVLIVGGIFMFIW--LFVVAGLLANYTVPSPNGFEGDET 380

Query: 411 -----PS-SKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANW 464
                PS +K+A   +I  + LF+  FA SW    ++  +E +    + R  A+    NW
Sbjct: 381 VRIRIPSYNKSAAKGVIAASYLFVCSFAPSWGIGIWIYCSEIFNNMERARGSALCTSVNW 440

Query: 465 IWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVK 524
            + F +  F P     I +    +F                ETKG TLEE+++M+ + V 
Sbjct: 441 GFNFALALFVPSAFRNISWKTYIIFGVFSVVLTIQTFLMFPETKGKTLEEIDQMWADHVP 500

Query: 525 PWKSGSWI 532
            WK+ S++
Sbjct: 501 AWKTASYV 508

>KLLA0A11110g 964084..965739 gi|1346290|sp|P49374|HGT1_KLULA
           Kluyveromyces lactis High-affinity glucose transporter,
           start by similarity
          Length = 551

 Score =  191 bits (484), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 136/484 (28%), Positives = 225/484 (46%), Gaps = 33/484 (6%)

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           G +FG+D  ++S  +    +K  F    S        +  G I      G   G L    
Sbjct: 39  GLMFGFDIASMSSMIGTDVYKDYFSNPDS--------LTYGGITASMAGGSFLGSLISPN 90

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
             D +GR++ L     ++I+G ++Q A+ D+     +GR+ISGMG+G  +  +P   SE 
Sbjct: 91  FSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEI 149

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLM 246
           +P  IRGT    +Q  +T+GI + +   YG      +  +R+  GL     + ++ G+  
Sbjct: 150 SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF 209

Query: 247 VPESPRFLVEKGRYEDAKRSLAKSNKVT---IEDPSIVAEMDTIMANVETERLAGNASWG 303
           +PESPR+L    R+E+   SL  +N V    + +  +  +++ I   V  +  A N  + 
Sbjct: 210 IPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK 267

Query: 304 ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVN 361
           +LF  K   LP+ I+G+  Q  QQL G N   YY   IFN  G     +   S +  ++N
Sbjct: 268 DLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLN 325

Query: 362 FASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYP-------NGKDQ---- 410
              T  AL+ +DKFGRR  L+ G   M     +FS  G+ + Y        NG D     
Sbjct: 326 VVMTIPALFLIDKFGRRPVLIIGGIFMFTW--LFSVAGILATYSVPAPGGVNGDDTVTIQ 383

Query: 411 -PSSK-AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGF 468
            PS   +A N +I  + LF+ FFA +W    ++  +E +    + +  A++   NW + F
Sbjct: 384 IPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF 443

Query: 469 LIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKS 528
            +  F P     I +    +F                ETKG TLEE+++M+V+ +  W++
Sbjct: 444 ALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRT 503

Query: 529 GSWI 532
            ++I
Sbjct: 504 ANYI 507

>Kwal_33.14911
          Length = 570

 Score =  190 bits (483), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 149/490 (30%), Positives = 236/490 (48%), Gaps = 42/490 (8%)

Query: 57  ICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGI---- 112
           I L  +I F   +FG+D G +SG +   +F   F           SD RT L+ G     
Sbjct: 24  ITLTSVIGFS--LFGYDQGLMSGLITGEEFNSEFPATGG------SDRRTKLVQGAVTAC 75

Query: 113 FNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWY---QYFIGRIISG 169
           + IGC FG L +   G+  GR+  ++   L+ I+G VI  A+    +   Q+ +GR+++G
Sbjct: 76  YEIGCFFGSLFVMFRGEQSGRKPLVIVGALLTIIGTVISTAAFGPHWGLGQFVVGRVMTG 135

Query: 170 MGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVP 229
           +G G      P   SE +    RG  V+    MI +G  + Y  ++G     +SVQWR P
Sbjct: 136 VGTGLNTSTIPVWQSEMSKPENRGILVNLEGSMIAVGTMIAYWIDFGLSYVGSSVQWRFP 195

Query: 230 LGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMA 289
           + +   FA+F++AG+  +P+SPR+L+ +GR +DA   LAK + + I+D +IVAE   I  
Sbjct: 196 VAMQIFFALFLLAGIWELPDSPRWLMSRGRRDDALYVLAKLDDLPIDDDAIVAEATAIQD 255

Query: 290 NVETERLAGNASWGELFS-NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIF-NAVGM 347
            V   R     S  +LF+  K   L R ++    Q  QQ TG N   YY T +F  ++G+
Sbjct: 256 AVNRFRHE-KRSVKDLFTGGKTQNLQRALIASSTQFFQQFTGCNAAIYYSTVLFKESIGL 314

Query: 348 KDSFQTSIVLGIVNFAS-----TFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTS 402
               +  ++LG V FA+     T  + + V+  GRRK  L G+   AI F I      T 
Sbjct: 315 TG--KLPLILGGV-FATIYTMFTIPSFFLVETLGRRKLFLLGATGQAISFTI------TF 365

Query: 403 LYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGA 462
                 D   +K A   + +F C    FF +S   + ++   E   +RV++   A++   
Sbjct: 366 ACLTKDDAEVAKGAAVGLFLFIC----FFGMSLLSLPWIYPPEIASMRVRSATNALSTCT 421

Query: 463 NWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXX-XXXCETKGLTLEEVN----E 517
           NW+  F +  FTP      G+   Y+F   +             ET G +LEE++    +
Sbjct: 422 NWLCNFAVVMFTPIFIDDTGYGC-YLFFAVMNYIYIPVIFFFYPETAGRSLEEIDIIFAK 480

Query: 518 MYVEGVKPWK 527
            YV+G++PW+
Sbjct: 481 SYVDGIQPWR 490

>Sklu_2439.20 YDR536W, Contig c2439 31933-33648
          Length = 571

 Score =  186 bits (473), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 141/476 (29%), Positives = 230/476 (48%), Gaps = 33/476 (6%)

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMK--SDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           +FG+D G +SG +   +F   F      SD   + + V+ G +   + +GC FG L +  
Sbjct: 35  LFGYDQGLMSGIITGKEFNSEFPATHKVSDHDRHATVVQ-GAVTSCYELGCFFGSLFVMF 93

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWY---QYFIGRIISGMGVGGIAVLSPTLI 183
            G+  GR+  ++   L+ +VG VI  A+    +   Q+ IGR+I+G+G G      P   
Sbjct: 94  RGEHIGRKPLVIFGALLTVVGTVISTAAFGPHWGLGQFVIGRVITGIGTGMNTSTIPVWQ 153

Query: 184 SETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAG 243
           SE +    RG  V+    +I +G  + Y  ++G    ++SVQWR P+ +   FA+ ++ G
Sbjct: 154 SEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVNSSVQWRFPVAMQIFFALLLLVG 213

Query: 244 MLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWG 303
           ++ +P+SPR+L+ +GR E+A   L K + +   D  I+AE   I   V   R     S  
Sbjct: 214 IVQLPDSPRWLMSQGRREEAMYVLGKLDGLDPNDDQILAEATVIQDAVNRFRHQ-KRSVK 272

Query: 304 ELFS-NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNF 362
           +LF+  KG    R ++    Q  QQ TG N   YY T +FN   +K  ++ S++LG V  
Sbjct: 273 DLFTGGKGQNFQRALIAASTQFFQQFTGCNAAIYYSTVLFNET-IKLDYRLSLILGGV-- 329

Query: 363 ASTFVALYTVDKF------GRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAA 416
            ST  AL+T+  F      GRRK  L G+   AI F I     +        D  +  A 
Sbjct: 330 FSTIYALFTIPSFFLIESLGRRKLFLIGATGQAISFTITFACLI--------DDTTQNAK 381

Query: 417 GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPF 476
           G  + +F  LFI FF ++   + ++   E   +RV++   A++   NW+  F +  FTP 
Sbjct: 382 GAAVGLF--LFISFFGVALLSLPWIYPPEIASMRVRSSTNALSTCTNWLCNFAVVMFTPI 439

Query: 477 ITSAIGFSYGYVFMGCLXXXXXXXX-XXXCETKGLTLEEVN----EMYVEGVKPWK 527
                G+   Y+F   +             ET G +LEE++    + +V+G +PW+
Sbjct: 440 FIQDAGWGC-YLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIFAKSHVDGTRPWR 494

>KLLA0F26246g 2432209..2433960 similar to sp|P39932 Saccharomyces
           cerevisiae YDR536w STL1 member of the sugar permease
           family, start by similarity
          Length = 583

 Score =  185 bits (469), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 147/482 (30%), Positives = 225/482 (46%), Gaps = 30/482 (6%)

Query: 62  MIAFGGF-VFGWDTGTISGFVNQTDFKRRFGQMK--SDGTYYLSDVRTGLIVGIFNIGCA 118
           + A  GF +FG+D G +SG +    F   F   K  SD   + + V+ G +   + +GC 
Sbjct: 29  ITAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKETSDDDRHATVVQ-GAVTSCYELGCF 87

Query: 119 FGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIAS-SDKWY--QYFIGRIISGMGVGGI 175
           FG L +   G+  GR+  ++   L+ IVG VI  A+  D W   Q+ IGR+I+G+G G  
Sbjct: 88  FGSLFVMMRGEKIGRKPLIIFGALLTIVGAVISTAAFGDHWGLGQFVIGRVITGLGTGMN 147

Query: 176 AVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFA 235
               P   SE +    RG  V+    +I +G  + Y  ++G      SVQWR P+ +   
Sbjct: 148 TSTIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDTSVQWRFPVAMQIF 207

Query: 236 FAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETER 295
           FAI ++ G++ +P+SPR+LV +GR E+A   L K + +   D  IVAE+ TI   V   +
Sbjct: 208 FAILLMIGIVQLPDSPRWLVAQGRREEAMYVLGKLDDLDPNDDQIVAEVSTIQDAVNRFK 267

Query: 296 LAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSI 355
               +    L   KG  L R ++    Q  QQ TG N   YY T +F    +K   + S+
Sbjct: 268 HQKRSMKELLHGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFKKT-IKLEDRLSL 326

Query: 356 VLGIVNFA-----STFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQ 410
           VLG V FA     ST  + + ++  GRRK  + G+      F+I     V     N K  
Sbjct: 327 VLGGV-FATIYALSTIPSFFLIETLGRRKLFMLGAFGQGCSFLITFACLVHDTTQNAK-- 383

Query: 411 PSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLI 470
                 G  + +F  LFI FF +S   + ++   E   +RV++   A +   NW+  F +
Sbjct: 384 ------GAAVGLF--LFIVFFGMSILSLPWIYPPEIASMRVRSMTNAFSTCTNWLCNFAV 435

Query: 471 GFFTPFITSAIGFSYGYVFMGCLX-XXXXXXXXXXCETKGLTLEEVN----EMYVEGVKP 525
             FTP      G+   Y+F  C+             ET G TLEE++    + Y +    
Sbjct: 436 VMFTPIFIQDAGWGC-YLFFACINFLYLPVIFFFYPETAGRTLEEIDIIFAKSYTDKTAA 494

Query: 526 WK 527
           W+
Sbjct: 495 WR 496

>AEL042C [2464] [Homologous to ScYOL156W (HXT11) - SH]
           (557191..558834) [1644 bp, 547 aa]
          Length = 547

 Score =  183 bits (464), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 125/494 (25%), Positives = 229/494 (46%), Gaps = 29/494 (5%)

Query: 54  WTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           + V  + ++    G +FG+D  ++S   +   +K  F         + +++  G I    
Sbjct: 26  YNVYLVAVVACISGMMFGFDISSMSSMQDFEPYKDYFK--------HPNELTQGGITASM 77

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
             G   G +    + D +GRR+ L     ++I+G V+Q A+ ++    F+GRI++G+GVG
Sbjct: 78  AAGSLLGSILSPGISDAFGRRVSLHMCSSLWIIGAVLQTAAQNQ-AMLFVGRIVAGLGVG 136

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             + ++P   +E +P  IRG     +QL +T+GI + +   YG+   ++   +RV   + 
Sbjct: 137 FGSSVAPVYTAEVSPPKIRGAVGGLFQLSVTVGILVMFLIGYGSVSLNSVASFRVAWSMQ 196

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNK-VTIEDPSIVAEMDTIMANVE 292
               + ++    ++PESPR+L   GR+++    + K  + V + D  +   ++ I   V 
Sbjct: 197 LVPGVVLLLATFLLPESPRWLANHGRWDETTLVVEKVGRSVNVSDEELRIHINEIRERVA 256

Query: 293 TERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDS 350
            + +A + ++ +LF  K     ++ +G+  Q  QQL G N   YY   +F   G     +
Sbjct: 257 LDEMARDFTYADLFRRKTQ--RKIFIGMAAQMWQQLCGMNVMMYYIVHVFKMAGFSGNQN 314

Query: 351 FQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLY----PN 406
             +SIV  ++N   T  +L+ VD+ GRR  L+ G   M     +++  G+ + Y    PN
Sbjct: 315 LVSSIVQYVLNVGMTIPSLFLVDRAGRRPVLIIGGVLMFTW--LYAVAGILATYSVPRPN 372

Query: 407 GKD---------QPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMA 457
           G +          P   +A   +IV + LF+  FA +W    +V  AE +    + R  A
Sbjct: 373 GVEGNTTVRIEIPPERSSAAKAVIVCSYLFVCSFAPTWGIGIWVYCAEIFNNIERARGSA 432

Query: 458 IAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNE 517
           +    NW + F +  F P     I +    +F                ETKG TLEE++E
Sbjct: 433 LCTSVNWAFNFALAMFVPTAFKNITWRTYIIFGTFSVALTIHAFLSFPETKGKTLEEIDE 492

Query: 518 MYVEGVKPWKSGSW 531
           M+   +  W++ S+
Sbjct: 493 MWDAHIPAWRTASY 506

>ADR139C [1880] [Homologous to ScYDR536W (STL1) - NSH]
           (950171..951847) [1677 bp, 558 aa]
          Length = 558

 Score =  176 bits (447), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 129/480 (26%), Positives = 224/480 (46%), Gaps = 26/480 (5%)

Query: 62  MIAFGGF-VFGWDTGTISGFVNQTDFKRRF-GQMKSDGTYYLSDVRTGLIVGIFNIGCAF 119
           + A  GF +FG+D G +SG +N   F   F   ++       + V  G +   + +GC F
Sbjct: 25  ITAVTGFSLFGYDQGLLSGLINGEQFNHEFPATLEQGDNDRHATVVQGAVTSCYELGCFF 84

Query: 120 GGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIAS-SDKWY--QYFIGRIISGMGVGGIA 176
           G L +   G+  GR+  ++   L+ I+G V+ +A+  + W   Q+ IGR+++G+G G   
Sbjct: 85  GSLYVMVDGERRGRKPLIIMGSLLTILGTVVSVAAFREHWGLGQFVIGRVVTGLGTGLNT 144

Query: 177 VLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAF 236
              P   SE +    RG  V+    +I +G  + Y  ++G     +SVQWR P+ +   F
Sbjct: 145 STIPVWQSEMSKPKNRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIVF 204

Query: 237 AIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERL 296
           A+ ++ G++ +PESPR+L+  GR  ++K  L K + +   D S++AE   I   V   + 
Sbjct: 205 AVLLLVGIVQLPESPRWLMAHGRTAESKYVLGKLDNLDPSDDSVLAEAAAIEDAVNRFKH 264

Query: 297 AGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIV 356
              +    L   +G  L R ++    Q  QQ TG N   YY T +F+   +   ++ S++
Sbjct: 265 EKRSLKDALTGGRGQNLQRTLVACSTQFFQQFTGCNAAIYYSTVLFHKT-INLEYRLSLI 323

Query: 357 LG----IVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPS 412
           LG     V   +T  + + ++  GRRK  L G+      F    T+    L  + K+   
Sbjct: 324 LGGVFSTVYTLATIPSFFLIETVGRRKLFLIGALGQGFSF----TITFACLINDTKNNAK 379

Query: 413 SKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGF 472
             A G        LFI FF ++   + ++   E   ++V++   A++   NW+  F +  
Sbjct: 380 GAAVG------LFLFIIFFGMTILSLPWIYPPEISSMKVRSITNAMSTCTNWLCNFAVVM 433

Query: 473 FTPFITSAIGFSYGYVFMGCLX-XXXXXXXXXXCETKGLTLEEVNEMY----VEGVKPWK 527
           FTP      G+   Y+F   +             ET G +LEE++ +Y    V+G + W+
Sbjct: 434 FTPIFIHEAGWGC-YLFFAVMNFLYVPIIFFFYPETAGRSLEEIDIIYAKSFVDGTQAWR 492

>YDR536W (STL1) [1346] chr4 (1507992..1509701) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1710 bp, 569 aa]
          Length = 569

 Score =  174 bits (440), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/474 (27%), Positives = 219/474 (46%), Gaps = 29/474 (6%)

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKSDGTY-YLSDVRTGLIVGIFNIGCAFGGLTLGRL 127
           +FG+D G ++  +    F   F   K +G +   + V  G     + +GC  G L +   
Sbjct: 41  LFGYDQGLMASLITGKQFNYEFPATKENGDHDRHATVVQGATTSCYELGCFAGSLFVMFC 100

Query: 128 GDMYGRRIGLMCVVLVYIVGIVIQIASSDKWY---QYFIGRIISGMGVGGIAVLSPTLIS 184
           G+  GR+  ++   ++ I+G VI   +   ++   Q+ IGR+++G+G G      P   S
Sbjct: 101 GERIGRKPLILMGSVITIIGAVISTCAFRGYWALGQFIIGRVVTGVGTGLNTSTIPVWQS 160

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244
           E +    RG  V+     I  G  + Y  ++G    ++SVQWR P+ +   FA+F++A M
Sbjct: 161 EMSKAENRGLLVNLEGSTIAFGTMIAYWIDFGLSYTNSSVQWRFPVSMQIVFALFLLAFM 220

Query: 245 LMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGE 304
           + +PESPR+L+ + R E+A+  +   +     D  ++ E+  +   V   +   + S   
Sbjct: 221 IKLPESPRWLISQSRTEEARYLVGTLDDADPNDEEVITEVAMLHDAVNRTKHEKH-SLSS 279

Query: 305 LFSN-KGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFA 363
           LFS  +   L R ++    Q  QQ TG N   YY T +FN   +K  ++ S+++G V FA
Sbjct: 280 LFSRGRSQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFNKT-IKLDYRLSMIIGGV-FA 337

Query: 364 -----STFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGN 418
                ST  + + ++K GRRK  L G+   A+ F    T+    L    K+     A G 
Sbjct: 338 TIYALSTIGSFFLIEKLGRRKLFLLGATGQAVSF----TITFACLVKENKENARGAAVG- 392

Query: 419 VMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFIT 478
                  LFI FF +S   + ++   E   ++V+    A +   NW+  F +  FTP   
Sbjct: 393 -----LFLFITFFGLSLLSLPWIYPPEIASMKVRASTNAFSTCTNWLCNFAVVMFTPIFI 447

Query: 479 SAIGFSYGYVFMGCLXXXXX-XXXXXXCETKGLTLEEVN----EMYVEGVKPWK 527
              G+   Y+F   +             ET G +LEE++    + Y +G +PW+
Sbjct: 448 GQSGWG-CYLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIFAKAYEDGTQPWR 500

>KLLA0E00264g 15302..16837 weakly similar to sp|P54854 Saccharomyces
           cerevisiae YDL245c HXT15, start by similarity
          Length = 511

 Score =  167 bits (422), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 126/462 (27%), Positives = 220/462 (47%), Gaps = 27/462 (5%)

Query: 71  GWDTGTISGFVNQTDFKRRFGQMKSD-GTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGD 129
           G+D    +       F  +FGQ  +  G Y +  V    +     IG AFG +    +  
Sbjct: 57  GFDNQGFATIQAMDSFIEKFGQYDAQTGAYAIPPVFLSFLNSFQYIGFAFGLVCGSIVSS 116

Query: 130 MYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPK 189
            +GR+I ++ + L  ++   I I S+ K  Q    R+++ + +G    + P   +E  P 
Sbjct: 117 RFGRKICVLSMSLYALITATIGITSNSKE-QILSARVLNYVFIGMEMAVIPVFQAEIVPP 175

Query: 190 HIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPE 249
           + RG  V  +QL + +G  + +     T     +  WR+PLGL + F   + + ++ +PE
Sbjct: 176 NTRGFFVGAFQLSLNIGGLVIHIITNSTAHIDGTSSWRIPLGLYYIFPSVIASLVMFIPE 235

Query: 250 SPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNK 309
           SPR+L+ KG+ E+A RSL +    TI +  I+ E ++I+++VE E+    + + ELF+  
Sbjct: 236 SPRWLILKGKKEEAMRSLVRLRNGTIYESEIINEYESIISSVEAEK-QEKSKYTELFT-- 292

Query: 310 GAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVAL 369
           G    R ++ I+    QQ+TG  +   YGT    ++   D FQ SIV  +V   +  + L
Sbjct: 293 GTNKRRTLIVILANIFQQVTGQAFASQYGTIFIKSLNTVDPFQMSIVSSVVAIVAVIIVL 352

Query: 370 YTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIF 429
              D+FGR+K L+ GS   AI  ++   +G   +         + A  N ++    +  F
Sbjct: 353 LFTDEFGRKKFLVIGSVIQAIALLVMGGLGTGDV---------TTAKKNGIVATMMINSF 403

Query: 430 FFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPF--------ITSAI 481
            + ISWAP++YVI +E    R++++  A+ +  N ++ F+  F  P+        + S +
Sbjct: 404 AYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPYLLSKPYANLQSKV 463

Query: 482 GFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGV 523
           GF Y     G              E +GL+LEE+   +V  V
Sbjct: 464 GFIY-----GAFTVLSVVFSYYLPECRGLSLEEIESNFVNKV 500

>AFR343C [3535] [Homologous to ScYOL103W (ITR2) - SH; ScYDR497C
           (ITR1) - SH] (1060729..1062444) [1716 bp, 571 aa]
          Length = 571

 Score =  167 bits (423), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 135/479 (28%), Positives = 223/479 (46%), Gaps = 25/479 (5%)

Query: 54  WTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           W ++ L  + +  GF+FG+DTG IS  +           + +D  + L+      I    
Sbjct: 64  WFIVMLTFVASLSGFLFGYDTGYISSALQS---------VGTDLGHQLTYRDKEYITSAT 114

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
           ++G     L  G   D++GRR  +M   ++++VG V+Q+A+ + W Q  +GR++ G G+G
Sbjct: 115 SLGALIAALGAGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFW-QMVVGRLVMGFGIG 173

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             +++SP  ISE APK IRG       L +T G  + Y    G +   +   WR+ +G++
Sbjct: 174 FGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKHG--WRILVGIS 231

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVET 293
              A+      + +P++PRF V KGR EDA   L ++  V  E   I  +++ ++   +T
Sbjct: 232 MLPAVLQFVSFIFLPDTPRFYVMKGRLEDAANVLERT-YVGAERALIDRKIEELVLLNKT 290

Query: 294 --ERLAGNASWGELFS--NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD 349
              R   +  W  + +     A L  +I+   +Q +QQ  G N   Y+   IF+ VG KD
Sbjct: 291 IPGRTVFHRVWNTIVAIHTVPANLRALIIACGLQGIQQFCGWNSLMYFSGDIFSLVGFKD 350

Query: 350 SFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL----GGSASMAICFVIFSTVGVTSLYP 405
               SIV+   NF  T VA + +DK GRR  LL    G + +M +C + F  +       
Sbjct: 351 PVAVSIVVAATNFIFTLVAFFAIDKIGRRIILLIGLPGMTTAMTVCAIAFHYIKTEVDGE 410

Query: 406 NGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWI 465
             K    S A G V+++F  ++  F+A+    + +   +E +P  V+    + A   NW 
Sbjct: 411 KLKPVGESNAWGIVVVIFIIVYAAFYALGIGTVPWQ-QSELFPQPVRGVGTSFATATNWA 469

Query: 466 WGFLIG--FFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEG 522
              +I   F T F       ++G+ F G              E  GL LEEV  +  +G
Sbjct: 470 GSMVIASTFLTMFKNITPTATFGF-FAGISVISLVAVYLCYPELSGLELEEVQFVLKDG 527

>Scas_637.9
          Length = 607

 Score =  164 bits (414), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 157/558 (28%), Positives = 252/558 (45%), Gaps = 67/558 (12%)

Query: 4   FATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKP-------------- 49
           +  ++  S S Q+++       + + +    +T  E  N  +  KP              
Sbjct: 44  YEITKDTSSSTQSNLIVEGTQSRQDINSFDHETDDENENDRIVIKPVNDEDDTSVIITFN 103

Query: 50  --IAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQ--TDFKRRFGQMKSDGTYYLSDVR 105
             I+A+  +I L  + +  GF+FG+DTG IS  +    TD   +           LS   
Sbjct: 104 QGISAF--IITLTFVASISGFMFGYDTGYISSALVSIGTDLDNKV----------LSYGD 151

Query: 106 TGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGR 165
             +I    ++G        G   D++GRR  LM   +++++G ++QI ++ K++Q  +GR
Sbjct: 152 KEIITAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQI-TAHKFWQMAVGR 210

Query: 166 IISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQ 225
           +I G GVG  +++SP  ISE APK IRG       L +T G  + Y    G    +N   
Sbjct: 211 LIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNG-- 268

Query: 226 WRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED--PSIVAE 283
           WR+ +GL+    +   +  L +P++PR+ V KGRY+DAK  L +S K   +D     V E
Sbjct: 269 WRILVGLSLIPTVLQFSFFLFLPDTPRYYVMKGRYDDAKSVLHRSYKGASDDIIERKVEE 328

Query: 284 MDTIMANVETERLAGNASWGELFSNKGAILPRV-------IMGIMIQSLQQLTGNNYFFY 336
           +  +  ++E + +       + F N    L RV       I+   +Q++QQ TG N   Y
Sbjct: 329 LRELNHSIEGKNIP------QRFWNTVKELHRVPSNFRALIIACGLQAIQQFTGWNSLMY 382

Query: 337 YGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL----GGSASMAICF 392
           +  TIF  VG  +S   SI++   NF  T VA + +DK GRR  LL    G + S+ +C 
Sbjct: 383 FSGTIFETVGFSNSSAVSIIVSGTNFIFTLVAFFAIDKIGRRYILLIGLPGMTGSLTVCA 442

Query: 393 VIFSTVGVTSLYPNGKDQPSSKAA----GNVMIVFTCLFIFFFAISWAPIAYVIVAESYP 448
           + F  +G+      G D   S +     G V+IVF  +F  F+A+    + +   +E +P
Sbjct: 443 IAFHFIGIRF---EGNDAVVSHSGFTAWGIVIIVFIIVFAAFYALGIGTVPWQ-QSELFP 498

Query: 449 LRVKNRAMAIAVGANWIWGFLIG--FFTPF--ITSAIGFSYGYVFMGCLXXXXXXXXXXX 504
             V+    + A   NW    +I   F T    IT    F++   F G             
Sbjct: 499 QNVRGVGTSYATATNWAGSLVIASTFLTMLQNITPTGTFAF---FAGLSFVSTIFCYFCY 555

Query: 505 CETKGLTLEEVNEMYVEG 522
            E  GL LEEV  +  +G
Sbjct: 556 PELSGLELEEVQTILKDG 573

>Kwal_56.22724
          Length = 578

 Score =  161 bits (407), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 141/486 (29%), Positives = 219/486 (45%), Gaps = 40/486 (8%)

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQ--TDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           +I L  + +  GF+FG+DTG IS  +    TD   R           L+     +I    
Sbjct: 70  IIILTFVASISGFLFGYDTGYISSALISIGTDLDNR----------VLTYGDKEIITAAT 119

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
           ++G     +  G   D++GR+  LM   L +++G V+Q+++S  W Q  +GR+I G GVG
Sbjct: 120 SLGALISAVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFW-QMAVGRLIMGFGVG 178

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             +++SP  I E APK IRG  V    L +T G  + Y    G     N   WR+ +GL+
Sbjct: 179 IGSLISPLFIGEIAPKMIRGRLVVINSLCLTGGQLIAYGCGAGLDHVHNG--WRILVGLS 236

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVET 293
                        +P++PR+ V KG+ + A   LAKS    ++ P+ +        +   
Sbjct: 237 LIPTFTQFVCFCFLPDTPRYYVMKGKLDKAAEVLAKS---YVDAPADLIHQKIQELHALN 293

Query: 294 ERLAGNASWGELFSNKGAI------LPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM 347
             + G++  G++++    I         +I+G  +Q +QQ  G N   Y+  TIF  VG 
Sbjct: 294 RTIPGDSVPGKVWNTIKEIHTVPANFRALILGCALQGIQQFCGWNSLMYFSGTIFETVGF 353

Query: 348 KDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL----GGSASMAICFVIFSTVGVTSL 403
           K+S   SIV+   NF  T VA + +D+ GRR  LL    G   S+ +C V F  +GVT  
Sbjct: 354 KNSAAVSIVVAGTNFIFTLVAFFAIDRIGRRSILLIGLPGMCVSLIVCAVAFHYLGVT-F 412

Query: 404 YPNGK---DQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAV 460
              GK   +     A G V+I+    F  F+A+    + +   +E +P  V+    + + 
Sbjct: 413 EGGGKAIIEHTGFSAWGIVVILSIICFAAFYALGIGTVPWQ-QSELFPQAVRGIGTSYST 471

Query: 461 GANWIWGFLIG--FFTPF--ITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVN 516
             NW    +I   F T    IT    FS   +F G              E  GL LEEV 
Sbjct: 472 ATNWGGSLIIASTFLTMLENITPTGTFS---LFAGLSLLSFFFCYFCYPELSGLELEEVQ 528

Query: 517 EMYVEG 522
            +  +G
Sbjct: 529 MILKDG 534

>Scas_581.6
          Length = 587

 Score =  155 bits (393), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 153/535 (28%), Positives = 240/535 (44%), Gaps = 45/535 (8%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWT-----VICLCLMIA 64
           E  +  TS      +   E D   IQ K    N E     I  +       ++ L  + +
Sbjct: 39  EEPTHHTSKKGNVSLSDDEEDNDRIQIKP--VNDEDDVSVIITFNQGISPFILILTFVAS 96

Query: 65  FGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTL 124
             GF+FG+DTG IS  +      +  G+  + G   +    T L       G     +  
Sbjct: 97  ISGFMFGYDTGYISSAL--ISINKDLGRTLTYGDKEIITAATSL-------GALISSIFA 147

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G   D++GR+  LM   +++++G ++QI ++ +++Q   GR+I G GVG  +++SP  IS
Sbjct: 148 GTAADIFGRKPCLMFSNVLFVIGAILQI-TAHRFWQMNAGRLIMGFGVGIGSLISPLFIS 206

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244
           E APK IRG       L +T G  + Y    G     N   WR+ +GL+    +   +  
Sbjct: 207 EIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNG--WRILVGLSLIPTVLQFSFF 264

Query: 245 LMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED--PSIVAEMDTIMANVETERLAGNASW 302
           L +P++PR+ V KG YE+AK  L +S     ED     V E+  +  ++  +  A    W
Sbjct: 265 LFLPDTPRYYVMKGDYENAKAVLRRSYINAPEDIIDRKVEELTELNHSIPGKNKAVQV-W 323

Query: 303 G---ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGI 359
               EL +N  A    +I+   +Q++QQ TG N   Y+  TIF  VG  +S   SI++  
Sbjct: 324 NTVKELHTNP-ANFRALIIACGLQAIQQFTGWNSLMYFSGTIFETVGFSNSSAVSIIVSG 382

Query: 360 VNFASTFVALYTVDKFGRRKCLL----GGSASMAICFVIFSTVGVTSLYPNGKDQPSSKA 415
            NF  T VA + +DK GRR  LL    G + ++ IC + F  +G+  +   G D   S +
Sbjct: 383 TNFVFTLVAFFAIDKIGRRAILLIGLPGMTMALTICAIAFHFIGIQFV---GNDAVVSNS 439

Query: 416 A----GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIG 471
                G V+IVF  +F  F+A+    + +   +E +P  V+    + A   NW    +I 
Sbjct: 440 GFTAWGIVIIVFIIVFAAFYALGIGTVPWQ-QSELFPTNVRGVGTSYATATNWAGSLVIA 498

Query: 472 --FFTPF--ITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEG 522
             F T    IT    F++   F G              E  GL LEEV  +  +G
Sbjct: 499 STFLTMLQNITPTGTFAF---FAGLSFVSFIFCYFCYPELSGLELEEVQSILKDG 550

>YOL103W (ITR2) [4718] chr15 (124000..125829) Myo-inositol permease
           (minor), closely related to Itr1p, member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [1830 bp, 609 aa]
          Length = 609

 Score =  152 bits (385), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 139/485 (28%), Positives = 226/485 (46%), Gaps = 39/485 (8%)

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNI 115
           +I L  + +  GF+FG+DTG IS  +   +        +      L+     LI    ++
Sbjct: 109 IITLTFVASISGFMFGYDTGYISSALISIN--------RDLDNKVLTYGEKELITAATSL 160

Query: 116 GCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGI 175
           G     +  G   D++GRR  LM   L++++G ++QI ++ K++Q   GR+I G GVG  
Sbjct: 161 GALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQI-TAHKFWQMAAGRLIMGFGVGIG 219

Query: 176 AVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFA 235
           +++SP  ISE APK IRG       L +T G  + Y    G     N   WR+ +GL+  
Sbjct: 220 SLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNG--WRILVGLSLI 277

Query: 236 FAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETER 295
             +   +    +P++PR+ V KG  + AK  L +S  V  ED  I  +++ + +    + 
Sbjct: 278 PTVLQFSFFCFLPDTPRYYVMKGDLKRAKMVLKRS-YVNTEDEIIDQKVEELSS--LNQS 334

Query: 296 LAGNASWGELFS--NKGAILPR----VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD 349
           + G     + ++   +   +P     +I+G  +Q++QQ TG N   Y+  TIF  VG K+
Sbjct: 335 IPGKNPITKFWNMVKELHTVPSNFRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKN 394

Query: 350 SFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL----GGSASMAICFVIFSTVGVTSLYP 405
           S   SI++   NF  T +A + +DK GRR  LL    G + ++ IC + F  +G+     
Sbjct: 395 SSAVSIIVSGTNFVFTLIAFFCIDKIGRRYILLIGLPGMTVALVICAIAFHFLGIKF--- 451

Query: 406 NGKDQPSSKAA----GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVG 461
           NG D   +       G V+IVF  ++  F+A+    + +   +E +P  V+    + A  
Sbjct: 452 NGADAVVASDGFSSWGIVIIVFIIVYAAFYALGIGTVPWQ-QSELFPQNVRGVGTSYATA 510

Query: 462 ANWIWGFLIG--FFTPF--ITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNE 517
            NW    +I   F T    IT    FS+   F G              E  GL LEEV  
Sbjct: 511 TNWAGSLVIASTFLTMLQNITPTGTFSF---FAGVACLSTIFCYFCYPELSGLELEEVQT 567

Query: 518 MYVEG 522
           +  +G
Sbjct: 568 ILKDG 572

>Kwal_27.11638
          Length = 723

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 129/469 (27%), Positives = 212/469 (45%), Gaps = 38/469 (8%)

Query: 63  IAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGL 122
           ++ G F+FG+D G +SG +    FK  F        +  S    G +V I  IG     L
Sbjct: 120 VSLGVFLFGYDQGVMSGIITGPLFKDYF--------HDPSRFAIGNMVSILEIGALISSL 171

Query: 123 TLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTL 182
            +GRLG+ +GRR  +     V+I+G + Q  S+ K     IGR+ISG+GVG ++ + P  
Sbjct: 172 MVGRLGEKWGRRRTIRYGSFVFIIGGLFQ-TSATKLSHLIIGRVISGLGVGLLSTIVPIY 230

Query: 183 ISETAPKHIRG--TCVSFYQLMITLGIFLGYCT----NYGTKDYSNSVQWRVPLGLNFAF 236
            SE +P H RG   C+ F       G  +GYC+    +YG     N+  WR+PL +    
Sbjct: 231 QSEISPPHNRGKLACIEF------TGNIVGYCSSVWVDYGCSYIPNNAAWRLPLFIQCVM 284

Query: 237 AIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK-SNKVTIEDPSIVAEMDTIMANVETER 295
            + ++ G  ++ E+PR+L+      +    +A   +   ++D    AE   I   V   R
Sbjct: 285 GLGLMLGTFVIVETPRWLLNHDHDVEGLIVIADLHSNGDVQDQRAHAEFQAIKETVLISR 344

Query: 296 LAG-NASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQ 352
           L G   S+  +F        R+++ +  Q   QL G N   YY   +F   G   +D+  
Sbjct: 345 LEGEKKSYSYVFKRYRT---RMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGRDAIL 401

Query: 353 TSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPS 412
            + +  ++   ST +  + VDK+GR+  LL G   M +  V  S     +LY N    P+
Sbjct: 402 MTGINSVIYVLSTILPWHLVDKWGRKPILLIGGMVMGLSLVSISA----ALYINIASTPT 457

Query: 413 SKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGF 472
                 +++VF  +F  FF  SW PI ++   E  PL  ++   + +   NW+  +L+G 
Sbjct: 458 ------LVVVFVVVFNAFFGFSWGPIPWLYPVEIAPLSARSAMASASTATNWLCNWLVGI 511

Query: 473 FTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVE 521
            TP +   I +    +                 ET GL LE++  ++ +
Sbjct: 512 MTPVLQEKIQWRMYLIHAASCFISFWCVLRVYPETAGLRLEDMGSVFDD 560

>CAGL0I07447g 716104..717816 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, hypothetical start
          Length = 570

 Score =  150 bits (379), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 154/555 (27%), Positives = 246/555 (44%), Gaps = 57/555 (10%)

Query: 5   ATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPA------KPI-------- 50
           A  +VE  S  ++I    + Q  +   S  +++S   N E         KP+        
Sbjct: 2   AGEKVELSSMDSAIEIRHVNQHAKEISSENKSESYDDNKEFEGSNRVVIKPVNDEDDVSV 61

Query: 51  ------AAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQ--TDFKRRFGQMKSDGTYYLS 102
                      +I L  + +  GF+FG+DTG IS  +    TD   +      + TY   
Sbjct: 62  MINFNQGVSHFIIMLTFVASLSGFLFGYDTGYISSALISIGTDLDNK------ELTYGEK 115

Query: 103 DVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYF 162
           ++ T       ++G     L  G   D++GR+  LM   +++++G ++Q+ ++ K++Q  
Sbjct: 116 EITTAAT----SLGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGAILQV-TAHKFWQMT 170

Query: 163 IGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSN 222
            GR I G GVG  ++++P  ISE APK IRG       L +T G  + Y    G     N
Sbjct: 171 AGRFIMGFGVGIGSLIAPLYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHN 230

Query: 223 SVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKS-NKVTIE--DPS 279
              WR+ +GL+    +      + +P++PR+ V KG YE AK  L +S N V+ E  D  
Sbjct: 231 G--WRILVGLSLIPTVLQFVFFIFLPDTPRYYVMKGDYEKAKSVLKRSYNGVSDELIDRK 288

Query: 280 I---VAEMDTIMANVETERLAGNASWGEL--FSNKGAILPRVIMGIMIQSLQQLTGNNYF 334
           I   +A   +I      ER     +W  +     K A    +I+   +Q +QQ TG N  
Sbjct: 289 IEELLALNQSIPGKNHVER-----TWNAVKELHTKPANFRALIIACGLQGIQQFTGWNSL 343

Query: 335 FYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVI 394
            Y+  TIF +VG K+S   SI++   NF  T VA + +DK GRR  L+ G   M +  V+
Sbjct: 344 VYFSGTIFESVGFKNSSAVSIIVSGTNFIFTLVAFFCIDKIGRRNILIIGIPGMTVAHVM 403

Query: 395 ----FSTVGVTSLYPNGKDQPSSKAA-GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPL 449
               F  +G+  +      + S  ++ G V+IVF  +F  F+A+    + +   +E +P 
Sbjct: 404 SAIAFHFIGIKFVGNTAIVEHSGFSSWGIVIIVFIIMFAAFYALGIGTVPWQ-QSELFPQ 462

Query: 450 RVKNRAMAIAVGANWIWGFLIG--FFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCET 507
            V+    A A   NW    +I   F T         ++G+ F G              E 
Sbjct: 463 NVRGVGTAFATATNWAGSLVIASTFLTMLQNITPTGTFGF-FAGLCVVSFFFCYFCYPEL 521

Query: 508 KGLTLEEVNEMYVEG 522
            GL LEEV  +  +G
Sbjct: 522 SGLELEEVQTILQDG 536

>KLLA0C12309g 1046848..1048557 highly similar to sp|P30606
           Saccharomyces cerevisiae YOL103w ITR2 myo-inositol
           permease, minor, start by similarity
          Length = 569

 Score =  150 bits (379), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 131/486 (26%), Positives = 213/486 (43%), Gaps = 40/486 (8%)

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQ--TDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           ++ L    +  GF+FG+DTG IS  +    TD   +           L+     +I    
Sbjct: 61  ILILTFTASISGFMFGYDTGYISSALVSIGTDLDNK----------ALTYGDKEIITAAT 110

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
           ++G     +  G   D++GR+  LM   +++++G  +Q+++   W Q  +GR+I G GVG
Sbjct: 111 SLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFW-QMAVGRLIMGFGVG 169

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             ++L+P  ISE APKHIRG       L +T G  + Y    G     N   WR+ +GL+
Sbjct: 170 IGSLLAPLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVHNG--WRILVGLS 227

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVET 293
               +        +P++PRF V KG Y+ A   L KS    I  P  + +      +   
Sbjct: 228 LIPTVVQFTCFSFLPDTPRFYVIKGNYKKAAEVLQKS---YINAPQELIDQKIRELSDLN 284

Query: 294 ERLAGNASWGELFSNKGAI------LPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM 347
           E + G     + F+    +         +++G  +Q +QQ  G N   Y+  TIF  VG 
Sbjct: 285 EAIPGKTPVHKFFNTVKELHTVPCNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGF 344

Query: 348 KDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL----GGSASMAICFVIFSTVGVTSL 403
           ++S   SI++   NF  T VA + +DK GRR  LL    G   S+ +C + F  + +   
Sbjct: 345 ENSTAVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLDI-KF 403

Query: 404 YPNGKDQPSS---KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAV 460
              G+ + S+    + G V+IVF  ++  F+A+    + +   +E +   V+    +   
Sbjct: 404 TGAGESEVSNGGFSSWGIVVIVFIMVYAAFYALGIGTVPWQ-QSELFATSVRGVGTSYCT 462

Query: 461 GANWIWGFLIG--FFTPF--ITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVN 516
             NW    +I   F T    IT    FS   +F                E  GL LEEV 
Sbjct: 463 ATNWAGSLIIASTFLTMLQNITPTGTFS---LFAALAAVSTVFCYLCYPELSGLELEEVQ 519

Query: 517 EMYVEG 522
            +  +G
Sbjct: 520 TILSDG 525

>Sklu_2427.8 , Contig c2427 19304-21040
          Length = 578

 Score =  150 bits (379), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/496 (24%), Positives = 227/496 (45%), Gaps = 34/496 (6%)

Query: 44  ELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSD 103
           + P  P    W +    ++ +    + G+DTG + G  +   F R FG  K   T   +D
Sbjct: 37  DRPTPPEVYNWRIYATAMIASTASILIGYDTGFVGGCFSNEYFLRNFGYEKDTPT--AND 94

Query: 104 VRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIAS-SDKWYQYF 162
             + +I   F+    FG L    +   +GRR+ L+    V  +G  + +A+ +      +
Sbjct: 95  ALSNMI-SCFHAAAFFGALISYPMSHYWGRRVSLIIAAGVAAIGAALMMAAVTSHLAPLY 153

Query: 163 IGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDY-- 220
           IGR+++G+ VG    L+   +SE +P  IRG  ++FY++   +G  +G+  N+G  ++  
Sbjct: 154 IGRVLTGLTVGASTNLTVVYLSEVSPAPIRGQIIAFYEVGWRIGDLIGFWINFGVSEHIS 213

Query: 221 SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSI 280
             + QW +PLG+    A     G  ++ ESPR+L +  R  +A  +L    ++  +   +
Sbjct: 214 PGNKQWIIPLGVQLIPAGMFFVGSFIMKESPRWLFQMDRDHEAIENLHYLRQLPEDHEYM 273

Query: 281 VAEMDTIMANVETERLAGNASWG--------ELFSNKGAILPRVIMGIMIQSLQQLTGNN 332
           V E+++I  ++E +    N++ G        E+F        R+++  ++   Q   G  
Sbjct: 274 VWEINSIKNSIEEQ----NSTVGLGMFDPVKEVFVRNRKYSRRLVITALLFLFQNFMGIQ 329

Query: 333 YFFYYGTTIFNAVGMKDSFQT---SIVLGIVNFASTFV-ALYTVDKFGRRKCLLGGSASM 388
              YY   IF ++G++ +  T   S + G+V F  TF+  L+ VD FGRR+  +    S 
Sbjct: 330 SINYYSPRIFKSIGVQGTNATLFSSGMFGVVKFICTFIYILFIVDNFGRRRAFMW---SA 386

Query: 389 AICFVIFSTVGV-----TSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIV 443
           ++C V F  VG          P     P  KAA   M ++T  FI    ++W+   +V  
Sbjct: 387 SVCSVCFWYVGAYLKINDPSKPGVSAGPGGKAAIGFMFIWTASFI----LAWSGGPFVWG 442

Query: 444 AESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXX 503
           AE Y   +++   +I    +W+  F++   T  +   + +   + F              
Sbjct: 443 AEVYEQNIRSFVQSINAAISWVPIFIMTRMTNDMVDKMQYGIFFFFASLAALAVPFVFFF 502

Query: 504 XCETKGLTLEEVNEMY 519
             ETKG+ LE++++++
Sbjct: 503 VPETKGIALEDIDKLF 518

>YDR497C (ITR1) [1312] chr4 complement(1443701..1445455)
           Myo-inositol permease (major), closely related to Itr2p,
           member of the hexose transporter family of the major
           facilitator superfamily (MFS) [1755 bp, 584 aa]
          Length = 584

 Score =  143 bits (361), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 174/355 (49%), Gaps = 24/355 (6%)

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQ--TDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           +I L  + +  GF+FG+DTG IS  +    TD   +           L+     ++    
Sbjct: 86  IITLTFVASISGFMFGYDTGYISSALISIGTDLDHKV----------LTYGEKEIVTAAT 135

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
           ++G     +  G   D++GR+  LM   L++++G ++Q+++   W Q  +GR+I G GVG
Sbjct: 136 SLGALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFW-QMAVGRLIMGFGVG 194

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             ++++P  ISE APK IRG       L +T G  + Y    G    +N   WR+ +GL+
Sbjct: 195 IGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNYVNNG--WRILVGLS 252

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED--PSIVAEMDTIMANV 291
                     +  +P++PR+ V KG    A   L +S   T E+     V E+ T+  ++
Sbjct: 253 LIPTAVQFTCLCFLPDTPRYYVMKGDLARATEVLKRSYTDTSEEIIERKVEELVTLNQSI 312

Query: 292 ETERLAGNASWGEL--FSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD 349
             + +     W  +       + L  +I+G  +Q++QQ TG N   Y+  TIF  VG K+
Sbjct: 313 PGKNVPEKV-WNTIKELHTVPSNLRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKN 371

Query: 350 SFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL----GGSASMAICFVIFSTVGV 400
           S   SI++   NF  T VA +++DK GRR  LL    G + ++ +C + F  +G+
Sbjct: 372 SSAVSIIVSGTNFIFTLVAFFSIDKIGRRTILLIGLPGMTMALVVCSIAFHFLGI 426

>CAGL0M01672g 186088..187731 similar to tr|Q04162 Saccharomyces
           cerevisiae YDR387c, hypothetical start
          Length = 547

 Score =  142 bits (358), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 139/522 (26%), Positives = 222/522 (42%), Gaps = 82/522 (15%)

Query: 54  WTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           W  + L      GG +FG+DTG ISG +          + +  G   +SD    LI  I 
Sbjct: 48  WKTVALFGSSTVGGLLFGYDTGVISGVLLSL-------KPQDLGRATISDWDKELITSIT 100

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
            +GC  G L    L D YGRRI L    +++IV  +    +S+     F GR + G+ VG
Sbjct: 101 CLGCFVGSLLGSPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVF-GRFVVGIAVG 159

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             A  +P  + E +P  IRG  ++   + +T G FL Y   Y   D + S  WR+  GL+
Sbjct: 160 TAAQCTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGS--WRILFGLS 217

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLA-------------KSNKVTI----- 275
              AI  ++ +  +PESPR+LV   +Y+ AK +L              K N++ I     
Sbjct: 218 AVPAIIFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKL 277

Query: 276 -----EDPSIVAEMD------TI-------MANVETERLAGNASWGELFSNKGA---ILP 314
                E  S++  +       TI       +AN+ +     N   G   SNK     + P
Sbjct: 278 KHYQDEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEP 337

Query: 315 R----VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALY 370
           R    +++G ++   QQ+TG N F YY   IF+ +   +    ++ +   NF  TF+A+Y
Sbjct: 338 RTKRALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVY 397

Query: 371 TVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFF 430
            VD  GRR  LL     M +  ++ ST+G                  NV+++   + IF 
Sbjct: 398 LVDLVGRRSMLLNTIWIMTVG-LLLSTIGFQH--------------ENVVVLLFAVSIFV 442

Query: 431 FA-------ISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGF 483
            A       I W+ + ++      PL  ++   +     NW+  F+I      + + IG 
Sbjct: 443 AAYASAMGTIPWSSVEFL------PLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGT 496

Query: 484 SYGYVFMGCLXXXX-XXXXXXXCETKGLTLEEVNEMYVEGVK 524
               +F                 E KGL+LEE+ +++  G+ 
Sbjct: 497 EDTMLFFALFSVMAWFFVYFWYPEVKGLSLEEIGKVFENGID 538

>Sklu_2313.3 YDR497C, Contig c2313 3640-5376 reverse complement
          Length = 578

 Score =  141 bits (356), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 103/348 (29%), Positives = 167/348 (47%), Gaps = 26/348 (7%)

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQ--TDFKRRFGQMKSDGTYYLSDVRTGLIVGIF 113
           +I L  + +  GF+FG+DTG IS  +    TD   +           L+     +I    
Sbjct: 68  IIILTFVASISGFMFGYDTGYISSALVSIGTDLDNK----------TLTYGEKEIITAAT 117

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
           ++G     +  G   D++GR+  +M   L++++G ++Q+++   W Q  IGR++ G GVG
Sbjct: 118 SLGALITAVFAGVSADLFGRKPCIMFSNLLFVIGAILQVSAHTFW-QMAIGRLVMGFGVG 176

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
             +++SP  ISE APK IRG       L +T G  + Y    G     N   WR+ +GL+
Sbjct: 177 IGSLISPLFISEIAPKMIRGRLTVVNSLCLTGGQLIAYACGAGLDKVHNG--WRILVGLS 234

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVET 293
               +      + +P++PR+ V KG  E A + L KS    ++ P  + E   +   VE 
Sbjct: 235 LIPTVIQFTMFMFLPDTPRYYVMKGNLEKAAQVLGKS---YVDAPGDLIERK-VNELVEL 290

Query: 294 ERLAGNASWGELFSN---KGAILPR----VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVG 346
                 A+  E   N   +  ++P     +I+G  +Q +QQ  G N   Y+  TIF  VG
Sbjct: 291 NTTIPGANIFEKVRNTVKEIHVVPANFRALIIGCALQGIQQFCGWNSLMYFSGTIFQTVG 350

Query: 347 MKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVI 394
            ++S   SI++   NF  T VA + +DK GRR  LL G   M +  ++
Sbjct: 351 FENSTAVSIIVAGTNFIFTLVAFFAIDKIGRRAILLIGLPGMMVSLIV 398

>KLLA0A03223g 290002..292035 some similarities with sp|P39932
           Saccharomyces cerevisiae YDR536w STL1 member of the
           sugar permease family P33.1.f24.1, hypothetical start
          Length = 677

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 128/513 (24%), Positives = 215/513 (41%), Gaps = 51/513 (9%)

Query: 22  PIVQKLETDESP------IQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTG 75
           P VQ L+    P      +Q K  Y            Y+T I     ++ G F+FG+D G
Sbjct: 85  PNVQPLDQQRIPPSYTDHLQVKDTYLTGR-----TLLYFTSI----FVSLGVFLFGYDQG 135

Query: 76  TISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRI 135
            +SG +    FK  F    +           G +V I  IG     L +  +G+ +GRR 
Sbjct: 136 VMSGIITGPYFKTYFNNPTA--------ATIGTMVSILEIGALVSSLLVSNIGEKFGRRF 187

Query: 136 GLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRG-- 193
            +    L++I+G ++Q  S +  +  F GRIISG+GVG ++ + P   SE +P H RG  
Sbjct: 188 TIKYGSLIFILGGLVQTFSWEMGHMIF-GRIISGIGVGLLSTIVPIYQSEISPPHNRGKL 246

Query: 194 TCVSFYQLMITLGIFLGYCT----NYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPE 249
            C+ F       G  +GY +    +Y      +   WR+PL +     + +  G  ++ E
Sbjct: 247 ACIEF------TGNIVGYASSVWVDYACSYIESDTSWRLPLFIQCVMGLLLFLGSFVIVE 300

Query: 250 SPRFLVEKGRYEDAKRSLAK-SNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSN 308
           +PR+L+      +    +A   +   +       E   I   V   RL G       F+ 
Sbjct: 301 TPRWLLNHDHDIEGLVVIADLHSDGDVLHSKAHEEYKLIKETVLISRLEGEKK-SLRFAF 359

Query: 309 KGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVNFASTF 366
           K     R+++ +  Q   QL G N   YY   +F   G   +++   + +  I+   ST 
Sbjct: 360 K-RYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSIIYILSTI 418

Query: 367 VALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCL 426
           +    VDK+GR+  LL G+  M    +  +     SL+ N    P       +++VF  +
Sbjct: 419 LPWKLVDKWGRKPILLSGALVMGTSLLAIA----MSLWANVAATP------RLVVVFVII 468

Query: 427 FIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYG 486
           F  FF  SW PI ++   E  P   ++   + +   NW++ +L+G  TP +   I +   
Sbjct: 469 FNAFFGYSWGPIPWLYPVEIAPAMARSAMASASTATNWLFNWLVGIMTPILQEKIHWRMY 528

Query: 487 YVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
            +                 ET GL LE+++ ++
Sbjct: 529 LIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVF 561

>Kwal_34.16266
          Length = 158

 Score =  128 bits (322), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 69/155 (44%), Positives = 95/155 (61%), Gaps = 2/155 (1%)

Query: 365 TFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFT 424
           T+V+++  D  GR+K LL GS S  IC  IFSTVGV  +  +    P  K +G VMI+FT
Sbjct: 2   TYVSIFVADNLGRKKGLLWGSISCFICLFIFSTVGVVMV--DHAADPDYKLSGYVMIIFT 59

Query: 425 CLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFS 484
           C F+  F  SW+ IA V+V+E + L +K++AMA++   NW   F I   TP IT+ IG++
Sbjct: 60  CFFVVSFCCSWSAIASVLVSEIFTLEIKSQAMALSQAFNWGANFFIALCTPIITARIGYA 119

Query: 485 YGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           +GYVF G +            ETKGLTLEE++E Y
Sbjct: 120 FGYVFTGFMFVAIFFVYVFIPETKGLTLEEIDEFY 154

>ABR223C [817] [Homologous to ScYFL040W - SH] (820632..822506) [1875
           bp, 624 aa]
          Length = 624

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 109/436 (25%), Positives = 207/436 (47%), Gaps = 35/436 (8%)

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           G V G D   ++ F++   F R F        +Y +    G++ G   +    G L  G 
Sbjct: 18  GLVLGIDISAMAVFISSDYFNRYF--------HYPNAFEQGMVSGAHPMEGLTGCLLFGY 69

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           +G+   R         ++I+G ++ +   D  Y   IGR I G+ VG ++V++   + E 
Sbjct: 70  VGERVSRLGCFRYFTFIWIIGCIVSVLVMD-IYMVAIGRFIKGVAVGSLSVVASVYLVEI 128

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLM 246
            P + +G   +  QL +T GIFL Y   +    ++N + +R+  GL    A+ +I+G L 
Sbjct: 129 FPSNRKGIATALVQLTLTFGIFLMYMLCWTFSRFNNHMAFRISWGLEIIPAVALISGTLF 188

Query: 247 VPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELF 306
           VPESPR+ V +G+Y+ A+  L   N  +  + +        + N+  +     AS+ +L 
Sbjct: 189 VPESPRWFVMQGQYKKAQEILTLLNCRSKNEFN-----KQTLLNMYGD--TAKASFKDLI 241

Query: 307 SNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVNFAS 364
             K   + ++IMG+ IQ+L Q TG N   YY   I    G+  ++    + +  ++N   
Sbjct: 242 --KLPYIKQLIMGMTIQALVQFTGINVVMYYVVYICEMAGLEGREKMNVASIPYLLNILF 299

Query: 365 TFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKD------QPS-----S 413
           TF+ L+ +D+  R+  ++ GS ++A    I + +G+T ++ +G D       P+     S
Sbjct: 300 TFIPLHLLDRVQRKVLIVYGSFALA---AIMNLIGLT-MWIHGHDVSPINGNPALVWKLS 355

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFF 473
              G + I     FI  FA + +   ++   E    ++++R ++I +  +WI   ++ F 
Sbjct: 356 PLGGQITISLCFAFIAIFASTLSCAGWLYTNEVLADKIRSRGLSICMSVSWICNAVLTFL 415

Query: 474 TPFITSAIGFSYGYVF 489
           +P + S + +   ++F
Sbjct: 416 SPLMMSTMKWGTFFLF 431

>KLLA0D00374g 30962..32632 weakly similar to sp|Q9P8X7 Aspergillus
           parasiticus Hexose transporter protein, start by
           similarity
          Length = 556

 Score =  134 bits (338), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 126/484 (26%), Positives = 211/484 (43%), Gaps = 54/484 (11%)

Query: 70  FGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLG- 128
            G+D   ++G     D+    G               G  +G+ + G  FG L L +L  
Sbjct: 67  LGYDGSLLNGLYAMPDYLNAMGN------------PNGAELGVISNGMVFGMLILFQLAP 114

Query: 129 ---DMYGRRIGLMCVVLVYIVGIVIQIAS-------------SDKWYQYFIGRIISGMGV 172
              D YGR++G+    ++  +G++IQ  S              D +  +   RII G GV
Sbjct: 115 YIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDKKDVFGMFVASRIILGSGV 174

Query: 173 GGIAVLSPTLISETA-PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLG 231
             I++ +P LISE + P H R  C S Y     LG  +     YG ++ ++   WR+P  
Sbjct: 175 LLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNWRIPSI 233

Query: 232 LNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPS--IVAEMDTIMA 289
           +   F +  +  +   PESPR+LV   R  +A+  L K +    E+ +  I  E+  I  
Sbjct: 234 IQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFELAEIKL 293

Query: 290 NVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM-- 347
            +E E+ + +  + +     G    R+ + I      QL+GN    YY + +FN++G+  
Sbjct: 294 AIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGITD 352

Query: 348 -KDSFQTSIVLGIVNFASTFVAL-YTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYP 405
             D  + +  L + N+  + + + Y    F RR+  L    SM  C+V+++ +   +   
Sbjct: 353 PDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSAENQKR 412

Query: 406 NGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVK-----NRAMAIAV 460
           N +D+  S A G + ++F     + F  +  P  Y      Y LR K       A++I+V
Sbjct: 413 NFEDK--SLANGVLAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQLAISISV 470

Query: 461 GANWIWGFLIGFFTPFITSAIGFSYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVNEMY 519
             N       GF  P    AI + Y Y+F  C L            ET G +LEEV+E++
Sbjct: 471 IFN-------GFVNPVAMDAIEWKY-YIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVF 522

Query: 520 VEGV 523
            +G+
Sbjct: 523 GDGI 526

>KLLA0E25025g complement(2219051..2220721) weakly similar to
           sp|P32466 Saccharomyces cerevisiae YDR345c HXT3
           low-affinity hexose transporter P33.1.f24.1,
           hypothetical start
          Length = 556

 Score =  131 bits (329), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 124/480 (25%), Positives = 208/480 (43%), Gaps = 54/480 (11%)

Query: 70  FGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLG- 128
            G+D   ++G     D+    G               G  +G+ + G  FG L L +L  
Sbjct: 67  LGYDGSLLNGLYAMPDYLNAMGN------------PNGAELGVISNGMVFGMLILFQLAP 114

Query: 129 ---DMYGRRIGLMCVVLVYIVGIVIQIAS-------------SDKWYQYFIGRIISGMGV 172
              D YGR++G+    ++  +G++IQ  S              D +  +   RII G GV
Sbjct: 115 FIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDRKDVFGMFVASRIILGSGV 174

Query: 173 GGIAVLSPTLISETA-PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLG 231
             I++ +P LISE + P H R  C S Y     LG  +     YG ++ ++   WR+P  
Sbjct: 175 LLISIATPALISEISYPPH-RELCTSIYNTCWYLGAIVSAWVTYGCRNLAHHWNWRIPSI 233

Query: 232 LNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPS--IVAEMDTIMA 289
           +   F +  +  +   PESPR+LV   R  +A+  L K +    E+ +  I  E+  I  
Sbjct: 234 IQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAGNNEEYAGLIDFELAEIKL 293

Query: 290 NVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM-- 347
            +E E+ + +  + +     G    R+ + I      QL+GN    YY + +FN++G+  
Sbjct: 294 AIEQEKASQSTKFSDFIKTSGN-RHRLWILIWTAIFTQLSGNGLVSYYLSKVFNSIGITD 352

Query: 348 -KDSFQTSIVLGIVNFASTFVAL-YTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYP 405
             D  + +  L + N+  + + + Y    F RR+  L    SM  C+V+++ +   +   
Sbjct: 353 PDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQLFLISLVSMTSCYVVWTALSAENQKR 412

Query: 406 NGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVK-----NRAMAIAV 460
           N +D+  + A G + ++F     + F  +  P  Y      Y LR K       A++I+V
Sbjct: 413 NFEDK--TLANGVLAMIFLYYLSYNFGFNGFPNLYTTEILPYTLRGKGLTIFQLAISISV 470

Query: 461 GANWIWGFLIGFFTPFITSAIGFSYGYVFMGC-LXXXXXXXXXXXCETKGLTLEEVNEMY 519
             N       GF  P    AI + Y Y+F  C L            ET G +LEEV+E++
Sbjct: 471 IFN-------GFVNPIAMDAIEWKY-YIFYCCFLSVEIVVCYFTFVETSGRSLEEVDEVF 522

>KLLA0E14696g 1309427..1310860 weakly similar to sp|Q9P8X7
           Aspergillus parasiticus Hexose transporter protein,
           hypothetical start
          Length = 477

 Score =  130 bits (326), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 119/448 (26%), Positives = 201/448 (44%), Gaps = 42/448 (9%)

Query: 106 TGLIVGIFNIGCAFGGLTLGRLG----DMYGRRIGLMCVVLVYIVGIVIQIAS------- 154
            G  +G+ + G  FG L   +      D YGR++G+    ++  +G++IQ  S       
Sbjct: 12  NGAELGVISNGMMFGMLLCFQFAPYVIDKYGRKVGMYVGNVLICIGVLIQAVSGAWINGL 71

Query: 155 ------SDKWYQYFIGRIISGMGVGGIAVLSPTLISETA-PKHIRGTCVSFYQLMITLGI 207
                  D +  +   RI+ G GV  I++ +P LISE + P H R  C S Y     LG 
Sbjct: 72  PEDYDKKDVFGMFVASRIVLGTGVLLISISTPALISEISYPPH-RELCTSIYNTCWYLGA 130

Query: 208 FLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL 267
            +     YG ++ ++   WR+P  +   F I  +  +   PESPR+LV   R  +A+  L
Sbjct: 131 VVSAWVTYGCRNLAHHWNWRIPSIIQAFFPIVQLIVLYNCPESPRYLVFHNRDSEARAIL 190

Query: 268 AKSNKVTIEDPS--IVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSL 325
            K +    E+ +  I  E+  I   +E E+ +   ++ + F   G    R+ + I     
Sbjct: 191 NKYHAGDNEEYAGLIDFELAEIKLAIEQEKASQATNFSDFFKTSGN-RHRLWILIWTAIF 249

Query: 326 QQLTGNNYFFYYGTTIFNAVGMKD---SFQTSIVLGIVNFASTFVAL-YTVDKFGRRKCL 381
            QL+GN    YY + +FN++G+ D     + +  L + N+  + + + Y    F RR+  
Sbjct: 250 TQLSGNGLVSYYLSKVFNSIGITDPDEQLEWNGWLMLYNWLCSLILMSYIAPFFKRRQLF 309

Query: 382 LGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYV 441
           L    SMA C+++++ +   +   N +D+  S A G + ++F     + F  +  P  Y 
Sbjct: 310 LISLTSMACCYIVWTALSAENQKRNFEDK--SLANGVLAMIFLYYLSYNFGFNGYPFLYT 367

Query: 442 IVAESYPLRVK-----NRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGC-LXX 495
                Y LR K       A+++AV  N       GF       AI + Y Y+F  C L  
Sbjct: 368 TEILPYTLRGKGLTIFQLAISLAVIFN-------GFVNSIAMDAIEWKY-YIFYCCFLAV 419

Query: 496 XXXXXXXXXCETKGLTLEEVNEMYVEGV 523
                     ET G +LEEV+E++ +G+
Sbjct: 420 EIVVCYFTFVETSGRSLEEVDEVFGDGI 447

>AFL034W [3159] [Homologous to ScYBR241C - SH; ScYGL104C - SH]
           complement(371827..373251) [1425 bp, 474 aa]
          Length = 474

 Score =  129 bits (324), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 111/401 (27%), Positives = 187/401 (46%), Gaps = 24/401 (5%)

Query: 90  FGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIV 149
           +G+   +   +L D + GL+  IF++G   G L  G   D YGRR   +   ++   G  
Sbjct: 65  WGRHGWEQCLHLDDSQYGLVTSIFSVGGLLGSLCTGSQADRYGRRAAAIGSSVLAAAGSA 124

Query: 150 IQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL 209
             +  ++ + Q  +GR+++G+G GG  V++  +++E AP  ++G   +  Q  I LGI +
Sbjct: 125 AMV-FANSYAQLLLGRLVAGVGCGGGIVVTSLMLNEMAPAELKGALGALNQTCINLGILV 183

Query: 210 GYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK 269
              T      ++NSVQWR+   ++ A A+     +L V ESPR+L   G  + A+R+L  
Sbjct: 184 ---TQLLAFAWANSVQWRLLFAVSAAVAVAHCGLLLGVEESPRWLAANGHEQRAERAL-- 238

Query: 270 SNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLT 329
              +  +D +   E+       E E  A  +S     ++      R ++ +++   QQ  
Sbjct: 239 -RWLRADDAAAAHELREWRRAREHEAAAQCSSLRRYIADARYAHVRCVVAVLLMG-QQFC 296

Query: 330 GNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMA 389
           G N   +YG  + N      S   +  +  VN   T  A   VD+ GRR  L   +A+MA
Sbjct: 297 GINSIVFYGVKLINGALPGLSIAVNFGISAVNLVVTLTAAALVDRVGRRPLLQCSAAAMA 356

Query: 390 ICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPL 449
           +          ++L   G    S+     V++V T  +I FFA+ + PI ++I+AE    
Sbjct: 357 V---------ASTLMAAGILLESAA----VLVVCTFAYITFFALGFGPIPFLIIAELSSP 403

Query: 450 RVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFM 490
                A +  +  NW+  F +GF  P +   IG   GYVFM
Sbjct: 404 GTAAVAQSYGLALNWVATFFVGFGFPVLNQLIG---GYVFM 441

>Kwal_14.1105
          Length = 522

 Score =  125 bits (315), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 123/475 (25%), Positives = 213/475 (44%), Gaps = 35/475 (7%)

Query: 62  MIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGG 121
           ++A  G + G D  +IS F+    FK  F                G++ G   +G   G 
Sbjct: 14  ILAVAGTILGMDISSISIFLTSDFFKSYFNNP--------GPAAQGIMTGANPVGGLVGC 65

Query: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           +  G L +  GR      + L++I+G +      + W    +GR++ GM VG  +VL P 
Sbjct: 66  VLFGVLTERTGRVSTFRILSLIWILGSIFSALVLNVW-MITVGRLVRGMAVGSFSVLLPV 124

Query: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241
            I E  P H +GT  +  QL IT  I + +   +      +   +R+  GL    A+ ++
Sbjct: 125 YIGEVIPAHKKGTATAVVQLSITSAILVTFFVCFLLSFLGDQASFRIAWGLEMIPALLVL 184

Query: 242 AGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEM---DTIMANVETERLAG 298
                + ESP++LV  G Y+ A+  L        + P +  E    +  ++ ++   L G
Sbjct: 185 LLSFSLIESPKWLVSHGEYDKAREILQH-----FKPPGMPGEKVTNNVRVSKIDILELYG 239

Query: 299 NAS---WGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQT 353
            A    + +LFS   ++    I GI IQ L Q  G N   +Y   I   +G+  K+    
Sbjct: 240 TAQKTRYSDLFSR--SLWKHTIAGITIQVLVQTCGINTLMFYIVYICEMIGLRGKNKLVA 297

Query: 354 SIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASM-AICFVIFSTVGV---TSLYPNGKD 409
           +++  ++N   TFV + T+D   R+  ++ G  ++ AI  +I  T+GV        NG  
Sbjct: 298 ALIPCLINVVFTFVPILTLDHLRRKVVIVSGGFTLAAIMILIGGTMGVFGHAVATVNGNS 357

Query: 410 QPSSK---AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIW 466
             + K   A+G +++    LF+  FA + +  A++  +E +PLR K + MA  +  +W  
Sbjct: 358 TVTWKVEGASGFLVMALCFLFVAIFASTLSCCAWLYTSEIFPLRAKPKGMAFCMAISWFL 417

Query: 467 GFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXC--ETKGLTLEEVNEMY 519
              + F TP + S I +   +V +GC+           C  ET GLT ++V  ++
Sbjct: 418 NATLTFTTPLLLSKIRWVL-FVLLGCI-TCALTVLIGVCFPETLGLTEQQVCNLF 470

>YDR387C (YDR387C) [1215] chr4 complement(1248142..1249809) Member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1668 bp, 555 aa]
          Length = 555

 Score =  126 bits (316), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 134/523 (25%), Positives = 215/523 (41%), Gaps = 89/523 (17%)

Query: 66  GGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLG 125
           GG +FG+DTG ISG +          + +      L+DV+  LI    ++G  FG +   
Sbjct: 49  GGLLFGYDTGVISGVLLSL-------KPEDLSLVVLTDVQKELITSSTSVGSFFGSILAF 101

Query: 126 RLGDMYGRRIGL-MCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
            L D YGRRI L +C  +  +  I + IA +  +     GR++ G+ VG  A   P  +S
Sbjct: 102 PLADRYGRRITLAICCSIFILAAIGMAIARTLTFL--ICGRLLVGIAVGVSAQCVPLFLS 159

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244
           E +P  IRG  ++   + IT G  + Y      K+  NS  WR    L+   AI  ++ +
Sbjct: 160 EISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEIDNS--WRYLFALSAIPAILFLSIL 217

Query: 245 LMVPESPRFLVEKGRY---EDAKRSL---------------------------AKSNKVT 274
             +PESPR+ + KG      D+ R L                             S  + 
Sbjct: 218 DFIPESPRWSISKGDILYTRDSLRMLYPTASTYHVNSKIKQLIIELDKLRLYEDASEPLL 277

Query: 275 IEDPSIVAEMDT----IMANVETERLAGN---------------------ASWGELFSNK 309
           ++  S++  MD+     ++    +RL+ N                     A  G L SNK
Sbjct: 278 VQSQSVIRYMDSSTSGTLSPPNIKRLSSNTERTSNTMSSSSAYLSALRGPAPNGALASNK 337

Query: 310 GA---ILPR----VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNF 362
                + PR    +I+G M+   QQ+TG N F YY   IF+   +K+     I++   NF
Sbjct: 338 KKRHRMEPRTIRALIVGCMLMFFQQITGFNAFMYYAAIIFSKFNIKNPLLPPILIASTNF 397

Query: 363 ASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIV 422
             TF A+YT+D  GRR  LL     M +  ++ S VG       G DQ       N++++
Sbjct: 398 IFTFFAMYTMDSLGRRAILLRTILIMTVGLLLCS-VGF------GHDQV------NLLLI 444

Query: 423 FTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIG 482
              +++  +A +   + +  V E  PL  ++   +     NW+    +        + IG
Sbjct: 445 SVVIYVAAYASAMGSVPWTCV-EFLPLNRRSFGASCIACTNWLTNAFVSMTYLSTINTIG 503

Query: 483 FSYGYVFMGCLXXXX-XXXXXXXCETKGLTLEEVNEMYVEGVK 524
                +                  E KGL+LEEV  ++  G+ 
Sbjct: 504 DENTMLIFAFFTVCAWFFVYFWYPEVKGLSLEEVGRVFDNGID 546

>KLLA0E08987g 804915..806615 gi|22293246|emb|CAC79614.1
           Kluyveromyces lactis hexose transporter, start by
           similarity
          Length = 566

 Score =  124 bits (312), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 138/522 (26%), Positives = 227/522 (43%), Gaps = 57/522 (10%)

Query: 15  QTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDT 74
           +  I +TP+ + L         + E+       K     + VI L    +F G + G D 
Sbjct: 59  EDEIANTPVTKTLRQR----MRRMEFCEVNFSNKT----YMVIMLGFFASFAGILSGVDQ 110

Query: 75  GTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRR 134
            TISG          +G MK+  +  L+     LI  +  +G   G + L  L + +GR+
Sbjct: 111 STISG--------ASYG-MKA--SLKLTSDEDSLISSLMPLGAVGGSILLTPLSEYFGRK 159

Query: 135 IGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGT 194
           + L+   + Y +G ++  A+ D  +  + GR + G+GVG         I+E+ P  +RG+
Sbjct: 160 VALVISCIFYTIGGILCAAAQDV-HTMYAGRFLIGVGVGIEGGGVGVYIAESVPSTVRGS 218

Query: 195 CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFL 254
            VS YQ  I LG  +GY    G   +     WR  LG +  F+  +  G+  +PESPR+L
Sbjct: 219 LVSLYQFNIALGELVGYVI--GVIFFDVKGGWRYMLGSSLVFSTILFVGLFFLPESPRWL 276

Query: 255 VEKGRYEDAK---RSLAKS----NKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFS 307
           + KG   +A    R L  +    NK    +    AE D  +   E+ R         +  
Sbjct: 277 IHKGYDVEAYKVWRRLRDTSDLGNKREFLEMKHAAEQDRQLKEQES-RFKSMFDLILIPR 335

Query: 308 NKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVNFAST 365
           N+ A+L      IM+ SL QLTG N   YY +T+   +G   K +   S+V G      T
Sbjct: 336 NRRALL----YSIMMVSLGQLTGINAIMYYMSTLMGQIGFSPKQAVAMSMVGGAALLIGT 391

Query: 366 FVALYTVDKFGRRK---CLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIV 422
             A+  +DKFGRR     ++G S  + +  V +     T+L           AA  V + 
Sbjct: 392 IPAILYMDKFGRRPWSMTIIGFSVGLVLVGVGYQIDLNTNL----------AAAEGVYLT 441

Query: 423 FTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIG 482
              L+  FF  ++A + +V+ +ES+ L  ++  M I     ++W F + +   F      
Sbjct: 442 GQILYNIFFG-TYATLTWVVPSESFSLATRSIGMTICSAFLYLWAFTVTY--NFNKMKDA 498

Query: 483 FSYGYVFMG-----CLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           F+Y  + +G      +            ETK  TLEE+++++
Sbjct: 499 FTYTGLTLGFYGGIAIVIGIPYQLLFMPETKDKTLEEIDDIF 540

>Scas_632.14
          Length = 553

 Score =  124 bits (311), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 129/526 (24%), Positives = 215/526 (40%), Gaps = 97/526 (18%)

Query: 66  GGFVFGWDTGTISGFV---NQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGL 122
           GG +FG+DTG ISG +      D  R            L++     I  I + G   G +
Sbjct: 49  GGLLFGYDTGVISGVLLTLKPQDLSRSV----------LTNFDKETITSITSFGSFIGSI 98

Query: 123 TLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTL 182
               L D  GRR  L     ++I+   + +A S       +GR I G  VG  A   P  
Sbjct: 99  IAFPLADRCGRRKTLAICCFIFIIA-ALWMAGSTTLLLLVLGRFIVGCAVGVAAQCVPIY 157

Query: 183 ISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIA 242
           +SE +P  IRG  ++   L IT G  L Y   Y   + ++S  WR   G++   AI ++ 
Sbjct: 158 LSEISPSSIRGFILTLNSLAITGGQLLSYIAAYFLANVNHS--WRYLFGISSIPAIILML 215

Query: 243 GMLMVPESPRFLVEKGRYEDAKRSL------AKSNKVTIEDPSIVAEMDTIMANVETER- 295
            +  +PESPR+L+ KG + +A +SL      A   +V ++   ++ ++  +    + E  
Sbjct: 216 LLDFIPESPRWLISKGEFSEAHKSLTMIYPTASHYQVNLKLRKLIIDLGKLRHYQDIEEP 275

Query: 296 --------------------------------------LAGNASWGELFSNKGAILPR-- 315
                                                 +AG AS  +L +    I PR  
Sbjct: 276 LLIRSRSFLRSLNSSLLSQNREQSTAAGGPIQPQPFTSIAGLASIADL-TAPIPIPPRTS 334

Query: 316 --------------VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVN 361
                         +I+G ++   QQ+TG N F YY   IF+ + +++    +I++ + N
Sbjct: 335 KKHVHKMEARTKRALIIGCVLMFFQQITGFNAFMYYAAVIFSKLNLENPLLPAILVALTN 394

Query: 362 FASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMI 421
           F  TFVAL  VDK G+R  LL     M+I  ++ S          G D+       N+++
Sbjct: 395 FLFTFVALRYVDKIGKRLMLLYTLVVMSIGLLLVSI---------GFDK------NNMIL 439

Query: 422 VFTCLFIFF--FAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITS 479
           +   + IF   +A +   + +  V E  PL  +    +     NW+   ++      +  
Sbjct: 440 ILISIVIFVGGYASALGTVPWTCV-EFLPLNRRAFGSSCISCTNWLTNAIVALSYLSLMD 498

Query: 480 AIGF-SYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVK 524
           +IG  +   +F G              E KGL+LEE+ +++  G+ 
Sbjct: 499 SIGNGNTMLIFAGFTSLAWLFVYFFYPEVKGLSLEEIGKVFEHGID 544

>KLLA0F06853g 656373..657959 gi|24943210|gb|AAN65374.1 Kluyveromyces
           lactis YGL104C, start by similarity
          Length = 528

 Score =  124 bits (310), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 111/423 (26%), Positives = 190/423 (44%), Gaps = 57/423 (13%)

Query: 101 LSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQ 160
           L+D + GLI  +F++G   G L  G L D YGR+        V I+G V  + SS+ +  
Sbjct: 89  LTDSQFGLITSVFSVGGLIGSLVAGPLADSYGRKPISYWNCSVGILGAVC-LFSSNNYLG 147

Query: 161 YFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDY 220
              GR+++G+  G + V++P  I+E +P H++G+  S  Q+ I  GI +   T      +
Sbjct: 148 MLFGRLLAGISCGSLIVVTPLFINEMSPVHLKGSLGSMNQVSINCGILV---TQSLAMLW 204

Query: 221 SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED--- 277
           +N +QWR  L      ++     +  + ESPR+LV KG   DA+  L++    + ++   
Sbjct: 205 ANMLQWRWILLFGGLISLLNFGLLFRINESPRWLVSKGNMTDAEDVLSQLRGNSRQESRQ 264

Query: 278 ---------------PSIVAEMDTIM---ANVETERLAGNASW---------GELFSNKG 310
                            + A  ++ M   +N+  ER +   S           E + +  
Sbjct: 265 EIDGWLQGSQPVRTFSDLEAHTNSQMNLGSNLNLERPSSTRSSLRDSESITVVEYWKDPK 324

Query: 311 AILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALY 370
              PR ++  ++ + QQ  G N   +YG  +        +   +  + IVN   TF +  
Sbjct: 325 YKYPRRVITTILMA-QQFCGINSIVFYGVKVIKKAFPDTAIIINFAISIVNVLMTFFSSP 383

Query: 371 TVDKFGRRKCLLGGSASMAIC--FVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFI 428
            VD +GR+  L+  S  M+IC   + F  VG                A  ++++F  L+I
Sbjct: 384 LVDHWGRKPLLISSSTLMSICSFMICFGIVG---------------NAPMILVIFVILYI 428

Query: 429 FFFAISWAPIAYVIVAE-SYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGY 487
             FA    PI ++I++E S+P  V   A +     NWI  F++G+  P + S +    GY
Sbjct: 429 TAFAGGLGPIPFLIISELSHPETV-GVAQSYGTTMNWIATFMVGYGFPALNSVMD---GY 484

Query: 488 VFM 490
           VF+
Sbjct: 485 VFL 487

>YBR241C (YBR241C) [420] chr2 complement(702546..704012) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1467 bp, 488 aa]
          Length = 488

 Score =  123 bits (308), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 178/398 (44%), Gaps = 36/398 (9%)

Query: 101 LSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQ 160
           L+D + G I  IF+IG  FG    G   + YGR+   M    + +V  ++ +  S+ + Q
Sbjct: 82  LTDSQYGAITSIFSIGGLFGSYYAGNWANRYGRKYVSMGASAMCMVSSLL-LFFSNSYLQ 140

Query: 161 YFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDY 220
              GR + GM  G   V++P  I+E AP   RG   S  Q+ I LGI L   T      Y
Sbjct: 141 LLFGRFLVGMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILL---TQTLALKY 197

Query: 221 SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK-------SNKV 273
           ++S  WR  L      A+  I   L V ESPR+LV  G   +A+ +L K         K 
Sbjct: 198 ADSYNWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTYQQAKQ 257

Query: 274 TIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNY 333
            I+D       +    + E E  +G   W +  ++     PR ++ + I S QQ  G N 
Sbjct: 258 EIQDWQRSHGHNRDPESSE-ETHSGPTLW-QYVTDPSYKKPRTVI-LAILSCQQFCGINS 314

Query: 334 FFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFV 393
             +YG  +   +    S Q +  + I+N   T  A   +D  GRR  LL  +  M    +
Sbjct: 315 IIFYGVKVIGKILPDYSIQVNFAISILNVVVTLAASAIIDHVGRRPLLLASTTVMTAMSL 374

Query: 394 IFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAE-SYPLRVK 452
           + S VG+T             +   +++  T ++I  FAI   PI ++I+ E SYP   +
Sbjct: 375 LIS-VGLT------------LSVSFLLVTATFVYIAAFAIGLGPIPFLIIGELSYP---Q 418

Query: 453 NRAMAIAVGA--NWIWGFLIGFFTPFITSAIGFSYGYV 488
           + A A + G   NW+  F++G+  P     +G   GYV
Sbjct: 419 DAATAQSFGTVCNWLATFIVGYLFPIGHGLMG---GYV 453

>Sklu_2144.6 YFL040W, Contig c2144 7747-9330 reverse complement
          Length = 527

 Score =  120 bits (300), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 113/459 (24%), Positives = 202/459 (44%), Gaps = 31/459 (6%)

Query: 73  DTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYG 132
           D  +++ F+    F + F         Y + +  GL+ G    G   G +  G L +  G
Sbjct: 27  DISSMAIFIGSETFNKYFN--------YPNPLEQGLVAGANPSGALVGCIVYGMLSEKSG 78

Query: 133 RRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIR 192
           R   +     ++I G  I I   + W    + R+I G+ VG  + L P  I E  PK  +
Sbjct: 79  RVSTIKVSSGIWIFGSFISIFVLNIW-MVILSRLIKGVSVGIFSALLPVYIGEVIPKKRK 137

Query: 193 GTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPR 252
           GT  S  QL +T  I L +   +      N + +R+  GL    A+ +     ++PESPR
Sbjct: 138 GTATSTIQLALTAAILLMFYVCFFMNFIGNHLSFRISWGLEMIPALLLFFLAFLLPESPR 197

Query: 253 FLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAI 312
           +LV  G+Y DA+  L +           V+++D +     + +     ++ +LF  K  +
Sbjct: 198 WLVTHGKYTDAQELLERLKSTKFGKG--VSKIDILDKYGSSSQ---RCTYLDLF--KKTL 250

Query: 313 LPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQ--TSIVLGIVNFASTFVALY 370
               I+G+ IQ+L Q  G     YY   I   +G++   +  ++ +  I+N   T   + 
Sbjct: 251 WRHTIIGMTIQALVQCCGIGVLMYYVVYICEMIGLEGDIRLFSASIQYIINVLFTIFPII 310

Query: 371 TVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQP--SSKA--------AGNVM 420
            +DKF R+  ++ GS  +A   VI  ++G T  +   +  P   +KA         G+V+
Sbjct: 311 WLDKFRRKDVIVYGSYLLA---VIMFSIGFTMNWYGHEVPPINGNKAMVWEVKGRPGSVI 367

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           +    LF+  FA + +  A++   E  P + K + M+I +  +W+  F++ F  P++ + 
Sbjct: 368 LGLCFLFVAIFAATLSCGAWLYTNEILPAKTKAKGMSICMAMSWVMNFILTFLAPWLLNR 427

Query: 481 IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           I +    +  G              ET GLT  E+ ++Y
Sbjct: 428 IKWVTFIILGGMTLVITTIVAFSFPETYGLTDLEIEKLY 466

>Kwal_55.21289
          Length = 537

 Score =  117 bits (294), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 131/529 (24%), Positives = 221/529 (41%), Gaps = 68/529 (12%)

Query: 38  SEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSD- 96
           ++ T  ++  +  +  W  + + L  + GG +FG+DTG I+G +         G    D 
Sbjct: 26  TDTTARDIDHRHYSLTWKTLNIYLGASIGGLLFGYDTGVIAGVL--------LGLKPGDL 77

Query: 97  GTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGL-MCVVLVYIVGIVIQIASS 155
           G   L D +  +I G+  IG   G +   +L +  GRR+ L +C V+  +   ++ +A S
Sbjct: 78  GLDILQDHQKEVITGVTGIGSVMGSMVAFKLANCLGRRLTLGLCSVVFTLAAALMALALS 137

Query: 156 DKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY 215
            +      GR+I G+ +G  A   P  +SE +P   RGT ++F    IT G  L     +
Sbjct: 138 FR--ALVAGRLIVGVAIGIAAQCVPLYLSEISPSSRRGTILAFNTSAITGGQLLASLIAW 195

Query: 216 GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLV-----EKGR------YEDAK 264
              D  NS  WR   G +   ++ ++  +  +PESPR+L+     ++ R      Y +A 
Sbjct: 196 AIIDKPNS--WRYLFGASAIPSLLLLFTLKFIPESPRWLLLTEQPQRAREAIETMYPEAS 253

Query: 265 ------------RSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSN---- 308
                       R L K  K   E+  +++          +   + N +    F++    
Sbjct: 254 ELEINDKLTKMGRDLTKLRKYQDENQPLLSRRPEASRRYNSGSSSDNIALARDFTHSIRS 313

Query: 309 --------KGAILPR----VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIV 356
                   K  + PR    +++G ++   QQ TG N F YY   I   +G+ D    +I 
Sbjct: 314 NNRRGLKIKHKLEPRTRRALLVGCLLMFFQQATGFNAFIYYSPVILLRIGVSDPLLPAIG 373

Query: 357 LGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAA 416
           +  VNFA T VA+  VD +GRR  LL     M +  +    VG   L  N     SS   
Sbjct: 374 IAFVNFAFTGVAMKVVDHYGRRTALLYTVWIMTVGLI----VGSAGLQYNN----SSLFL 425

Query: 417 GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGF-FTP 475
           G++++     FI  +A     + ++ V E  PL  ++   +     NW   F +   F  
Sbjct: 426 GSLLV-----FIAGYAAGIGSVPWMSV-EFLPLNQRSFGASCIACTNWFTNFAVSISFLS 479

Query: 476 FITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVK 524
            I    G +   +F                E KGL+LEE+ +++  G+ 
Sbjct: 480 MIRIIGGEASMLIFAAMSALGWLFVYFWYPEVKGLSLEEIGQVFETGID 528

>YGL104C (VPS73) [1880] chr7 complement(308714..310174) Putative
           hexose transporter, class B vacuolar sorting protein
           involved in Prc1p vacuolar trafficking pathway, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1461 bp, 486 aa]
          Length = 486

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 111/479 (23%), Positives = 208/479 (43%), Gaps = 43/479 (8%)

Query: 34  IQTKSEYTNAELPAKPIAAYWTVICLCLMIA-FGGFVFGWDTGTISG---FVNQTDFKRR 89
           + + S  +N  +P +        +C  +++A  G   FG+    ++     ++ ++F   
Sbjct: 5   LSSASLLSNVSMPRQNKHKITKALCYAIIVASIGSIQFGYHLSELNAPQQVLSCSEFDIP 64

Query: 90  FGQMKSDGTYY----------LSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMC 139
                 D T+           L+D + G++  +F IG   G      L ++YGR+   + 
Sbjct: 65  MEGYPYDRTWLGKRGYKQCIPLNDEQIGIVTSVFCIGGILGSYFATSLANIYGRKFSSLI 124

Query: 140 VVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFY 199
              + IVG +I I +S+ +    IGRI+ G+  G + V+ P  I E AP    G   S  
Sbjct: 125 NCTLNIVGSLI-IFNSNSYRGLIIGRILVGISCGSLIVIIPLFIKEVAPSGWEGLLGSMT 183

Query: 200 QLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGR 259
           Q+ I LG+ L   T       ++S +WR  L  +F  A+       +V ESP++L+  GR
Sbjct: 184 QICIRLGVLL---TQGIALPLTDSYRWRWILFGSFLIAVLNFFMWFIVDESPKWLLAHGR 240

Query: 260 YEDAKRSLAKSNKVT-------IEDPSIVAEM-DTIMANVETERLAGNASWGELFSNKGA 311
             DAK SL K   VT       I+D  +  E  D ++    T  ++G+ S  +   ++  
Sbjct: 241 VTDAKLSLCKLRGVTFDEAAQEIQDWQLQIESGDPLIEPTTTNSISGSNSLWKYLRDRTN 300

Query: 312 ILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYT 371
           +  R ++ +++   QQ  G N    YGT I + +  + + + +  + +VN   T +    
Sbjct: 301 VKSRHVITVLLFG-QQFCGINSIVLYGTKIISQLYPQHAIRINFFISMVNVLVTILVSLL 359

Query: 372 VDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFF 431
           +    R+  L+  +  +++      T  +  +  N           N++IVF+ +++  F
Sbjct: 360 IHSLPRKPLLMTSTVLVSV------TAFIMGIAMNHNKM-------NLLIVFSFIYMGVF 406

Query: 432 AISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFM 490
            +   P+ ++I+ E    +    A       NW+  F+I +  P I   +    GYVF+
Sbjct: 407 TMGLNPLPFIIMREVSKPQDMVLAQRYGTICNWVGTFIIAYTFPIIHDVLS---GYVFI 462

>KLLA0B14861g complement(1305927..1307690)
           gi|125935|sp|P07921|LACP_KLULA Kluyveromyces lactis
           Lactose permease, start by similarity
          Length = 587

 Score =  115 bits (289), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 133/520 (25%), Positives = 222/520 (42%), Gaps = 45/520 (8%)

Query: 27  LETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDF 86
           L+ +  PI+   E     LP      Y+ +  LC +      + G+D G + G +   D 
Sbjct: 45  LKINGVPIEDARE--EVLLPGYLSKQYYKLYGLCFITYLCATMQGYD-GALMGSIYTEDA 101

Query: 87  KRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIV 146
             ++  +  +     S   TGL+  IFN+G   G   +  L D  GR+  ++   L  ++
Sbjct: 102 YLKYYHLDIN-----SSSGTGLVFSIFNVGQICGAFFVP-LMDWKGRKPAILIGCLGVVI 155

Query: 147 GIVIQIASSDK-------WYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFY 199
           G +I   ++ K       W+  F   I +          +PT  +E AP H+RG     Y
Sbjct: 156 GAIISSLTTTKSALIGGRWFVAFFATIANAA--------APTYCAEVAPAHLRGKVAGLY 207

Query: 200 QLMITLGIFLGYCTNYGT-KDYSNSVQ-WRVPLGLNFAFAIFMIAGMLMVPESPRFLVEK 257
             + ++G  +   + YGT K++ NS + +++PL L   F   +     ++PESPR+LV  
Sbjct: 208 NTLWSVGSIVAAFSTYGTNKNFPNSSKAFKIPLYLQMMFPGLVCIFGWLIPESPRWLVGV 267

Query: 258 GRYEDAKRSLAKSN-KVTIEDPSIVAEMDTIMANVETERLAGNASWGE---LFSNKGAIL 313
           GR E+A+  + K +       P +  EM  I+ +     L+      +   LF  +    
Sbjct: 268 GREEEAREFIIKYHLNGDRTHPLLDMEMAEIIESFHGTDLSNPLEMLDVRSLFRTRSDRY 327

Query: 314 PRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLG---IVNFASTFVALY 370
            R ++ I++    Q +GNN   YY  T+   VGMK      ++ G   IV + S+    +
Sbjct: 328 -RAMLVILMAWFGQFSGNNVCSYYLPTMLRNVGMKSVSLNVLMNGVYSIVTWISSICGAF 386

Query: 371 TVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFF 430
            +DK GRR+  LG  +  A+     S    T+ Y   K     K+A N  +VF  LF   
Sbjct: 387 FIDKIGRREGFLGSISGAALALTGLSI--CTARYEKTK----KKSASNGALVFIYLFGGI 440

Query: 431 FAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIG--FSYGYV 488
           F+ ++ P+  +   E      +++A  +    + +  F+  F TP     I   F   YV
Sbjct: 441 FSFAFTPMQSMYSTEVSTNLTRSKAQLLNFVVSGVAQFVNQFATPKAMKNIKYWFYVFYV 500

Query: 489 FMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWKS 528
           F                ETKG +LEE+ E+  E   P K+
Sbjct: 501 FFDIF--EFIVIYFFFVETKGRSLEEL-EVVFEAPNPRKA 537

>Kwal_27.12811
          Length = 181

 Score =  105 bits (262), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 98/172 (56%), Gaps = 6/172 (3%)

Query: 61  LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG 120
           L +AFG  +FG++TGTISG +     K++F    S G ++ +D  T LI  I + G   G
Sbjct: 16  LFVAFGDILFGYNTGTISGMLAMDYVKQQF---TSRG-HFTAD-ETSLITEILSAGTFCG 70

Query: 121 GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP 180
            +      D  G R+GL+   +++  G+++Q+A++ +      GR+I+G GVG ++ + P
Sbjct: 71  AILAPLASDTIGHRLGLILSTIIFTFGVILQVAATGQDL-LIAGRVIAGAGVGVLSAIVP 129

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGL 232
              SE +PK IRG  VS YQ  IT+G+ L  C N GT    +S  +R+PL L
Sbjct: 130 LYQSEASPKWIRGAVVSCYQWAITIGLLLAACVNQGTHARQDSGSYRIPLAL 181

>KLLA0E02970g complement(278965..280587) similar to sgd|S0002795
           Saccharomyces cerevisiae YDR387c, start by similarity
          Length = 540

 Score =  110 bits (276), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 171/413 (41%), Gaps = 55/413 (13%)

Query: 9   VESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGF 68
           V S S Q       +   L +  S + T    T  ++  +P    W    + +    GG 
Sbjct: 6   VRSSSPQRDSSVEDVYSDLYSTFSQMTTT---TANDIEQRPYPFTWRTGIMFVSSTIGGM 62

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDV-RTGLIVGIFNIGCAFGGLTLGRL 127
           +FG+DTG ISG +   + K        D  ++  ++ +  +I  I   G   G +    L
Sbjct: 63  LFGYDTGVISGVLIAMNPK--------DLNFHSLEIWQKEIITSITCAGSFIGSIIAFPL 114

Query: 128 GDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETA 187
            D  GR+  L    +++    ++ +A S  +     GR++ G+ VG  A   P  ++E +
Sbjct: 115 ADRCGRKHTLTVCCIIFAASSML-MAVSYTFEMLVTGRLVVGIAVGIAAQCIPIYLTEIS 173

Query: 188 PKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSN---SVQWRVPLGLNFAFAIFMIAGM 244
           P  IRGT ++   + IT G F  Y   Y   D  +   +  WR    L    AI  +  +
Sbjct: 174 PAKIRGTMLTLNSISITGGQFAAYVIAYFMIDNDHPQSTAAWRYLFALGSIPAIVFLLTL 233

Query: 245 LMVPESPRFLVEKGRYEDAKRSLAKS--------------------NKVTIEDPSIVAEM 284
             +PESPR+L+ K R  +A+ +L K                     NK+   +     E 
Sbjct: 234 DFIPESPRWLLSKSRLVEAELALHKVYPAATVPEIRHKLRKLTSDLNKLRYHND----ET 289

Query: 285 DTIMANVETER-----LAGNASWGELFSNK----------GAILPRVIMGIMIQSLQQLT 329
           D ++  V   R       G +S G  + N+          G     +I+G ++   QQ +
Sbjct: 290 DPLLFPVNKRRSVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKRALIIGCVLMFFQQTS 349

Query: 330 GNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL 382
           G N F YY  TIF  VG  +    +I++   NF+ T +A+  +D  G+R  LL
Sbjct: 350 GFNAFMYYSATIFEQVGFTNPLVPAIIVAFTNFSFTLLAMKLIDTMGKRTLLL 402

>Kwal_27.10664
          Length = 653

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 136/517 (26%), Positives = 214/517 (41%), Gaps = 68/517 (13%)

Query: 28  ETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFK 87
           E D  P +         LP K IA    +IC   M   G  V G D   I+G      + 
Sbjct: 117 EEDNHPFRN--------LPRKLIA----IICASAM---GAAVQGMDETVING--ANLFYP 159

Query: 88  RRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR-LGDMYGRRIGLMCVVLVYIV 146
           R+       GT Y  + R GL+ G   + CA     +   L +  GR+  +     V  +
Sbjct: 160 RQLAL--GHGTAY-DEWREGLVNGAPYLCCAAVSCWMTDWLNNWLGRKRVIFWTCAVSAI 216

Query: 147 GIVIQI---ASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMI 203
             ++Q         W+  F  R + G+G+G  +      ++E + K +RG     +Q   
Sbjct: 217 TCLLQAFAPTGERGWHYLFAMRFLLGLGIGPKSATVSVYLAECSTKKLRGIICMNWQTFT 276

Query: 204 TLGIFLGYCTNY-----GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKG 258
             GI  GY  +      G+   S  + WR+ L      AIF++  +   PESPR+L+ KG
Sbjct: 277 AFGIMWGYVFSLIFYRVGSGAVSGGLNWRLTLASAMIPAIFVLFQIPYCPESPRWLMGKG 336

Query: 259 RYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANV---ETERLAGN--ASWGELFS---NKG 310
           RY +A  S      V I    I+A  D    +V   E E L        GE+F+   N+ 
Sbjct: 337 RYLEAYES-----TVQIRPHRILACRDLFYQHVLLMEEESLEKPYFKRLGEVFTVRRNRN 391

Query: 311 AILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD--SFQTSIVLGIVNFASTFVA 368
           A +   I   M    QQ    N   YY + IF   G  +  S   S+  G+VNF     A
Sbjct: 392 AFIAAFICAFM----QQFCAINVIAYYSSAIFLQSGFSEISSLCASLGFGLVNFFFAIPA 447

Query: 369 LYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFI 428
            + +D+FGRR  LL    +MA+   I    G     P+ + +    + G  + +F+ ++ 
Sbjct: 448 FFMIDRFGRRFLLLSTFPAMAVFLFI---TGFAFWIPDQQTRIGIVSMG--IYIFSAIYS 502

Query: 429 FFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI------G 482
           F   +    + +V+  E +PL V+    ++     W + F++    P + SA+      G
Sbjct: 503 FGCGV----VPFVVAGEVFPLYVRAIGASLFTIILWGFNFILSLTWPRMLSALHPQGAFG 558

Query: 483 FSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           F  G+  +G              ETK LTLEE++E++
Sbjct: 559 FYAGWNVVGWFLVYFLLP-----ETKQLTLEELDEVF 590

>CAGL0C01771g 187030..188487 similar to sp|P38142 Saccharomyces
           cerevisiae YBR241c or sp|P53142 Saccharomyces cerevisiae
           YGL104c, start by similarity
          Length = 485

 Score =  109 bits (272), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 98/381 (25%), Positives = 168/381 (44%), Gaps = 25/381 (6%)

Query: 107 GLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRI 166
           G++  + ++G   G    G+L   YG++        VY +G ++   ++  W   F GR+
Sbjct: 87  GVVTSVLSVGGLIGSYIAGQLAAKYGKKKISQGTAFVYFIGSLMLTMANGYWTMIF-GRL 145

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW 226
           + GM  G   V+ P  I+E  P   +G   +  QL I +GI     T      ++NS  W
Sbjct: 146 LVGMASGISIVVIPVYINEITPAEYKGAMGTMNQLSINIGILF---TQTIALVFTNSYYW 202

Query: 227 RVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDP--SIVAEM 284
           R  L +  A A+        + ESP++L+++G   +A+  + K +  T +D    I    
Sbjct: 203 RWILLIGTAIALVNFVAWSTIDESPKWLLKRGLTSEAEMVVYKLHGGTYQDAKDQIQTWQ 262

Query: 285 DTIMANVETERLAGNAS--WGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIF 342
             + ++ E    AG     W E  + +    PR ++  MI   QQ  G N   +YG  + 
Sbjct: 263 TDMNSHHEHADFAGREPTLW-EFVTREEYKKPRNVI-FMILCAQQFCGINSIIFYGVKVI 320

Query: 343 NAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMA-ICFVIFSTVGVT 401
           +      +   +  + ++N   TFVA   +D  GR+  LL  SA MA   F+I  ++G++
Sbjct: 321 SNSLPNSAVLVNFGISVLNVLMTFVASVIIDSLGRKPLLLSSSALMAGTSFLI--SIGIS 378

Query: 402 SLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVG 461
                 KD P       ++++    +I  FAI   PI  +I++E        +A +    
Sbjct: 379 ------KDVPI------LLVIAVFAYIASFAIGVGPIPLMIISELTTHEAAAKAQSFGTI 426

Query: 462 ANWIWGFLIGFFTPFITSAIG 482
            NW+  FL+GF  P     +G
Sbjct: 427 CNWLATFLVGFLFPSFHEVMG 447

>Kwal_33.12950
          Length = 566

 Score =  109 bits (273), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 130/488 (26%), Positives = 213/488 (43%), Gaps = 37/488 (7%)

Query: 46  PAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVR 105
           P   ++ +  +  LC  +A     FG D   I G V Q  ++ +F          ++DV 
Sbjct: 92  PLLCLSKHMILAALCTSLA--ALNFGMDESAIGGAVLQ--YQNQFN---------ITDVN 138

Query: 106 -TGLIVGIFNIGCAFGGLTLGRLGDMY-GRRIGLMCVVLVYIVGIVIQIASSDKWYQYFI 163
             GL V    +  A  G  L    D Y GRR  +    L+   G +IQ   ++ +     
Sbjct: 139 IQGLTVAAPYLAAACIGSPLTVYLDKYTGRRWIVFWSCLIGFAGSLIQ-GFANGFGCLLF 197

Query: 164 GRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNS 223
            R++ G+G+G  +   P   +E +P + RG  +  +Q  I LG+ LG   N    + + S
Sbjct: 198 ARLLLGVGMGLNSATVPIYTAECSPANSRGALLMLWQTFIALGVCLGSVFNRAFVNINGS 257

Query: 224 VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAE 283
           + WR+ +G +    +   A +   PESPR+LV   R   AK++L    K+   D S   +
Sbjct: 258 LSWRLMIGSSAVAPVITAALIFFPPESPRWLVVHKR---AKQALISLTKLRPNDLSGARD 314

Query: 284 MDTIMANVETERLAGN--ASWGE---LFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYG 338
              ++ +++ E    N  + W +   LFSNK      ++  I I   QQ  G N    Y 
Sbjct: 315 FYILIDSLKFEAELNNNLSPWNQFVSLFSNKRNRFALIVSLIGILG-QQYGGVNILVSYT 373

Query: 339 TTIFNAVGMK--DSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFS 396
           TTI    G+    +   SI +G   F +T ++   +D+FGRRK LL      A+C  +F 
Sbjct: 374 TTILTKAGVDPVTAIAGSIGIGGGCFLATLLSAQLIDRFGRRKMLLYTLPVEALC--LFW 431

Query: 397 TVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAM 456
             GV     N  +  S   AG   +    +++ F+     P+++ +VAE+  + V+    
Sbjct: 432 LGGVL----NVTNAKSRLGAG---LASMYVYVLFYGTGIGPVSFTLVAETSSISVRMAHS 484

Query: 457 AIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXX-XXXXXXXCETKGLTLEEV 515
           +  +  NWI  F +    P + S +  S G  F G               ETK  TLE++
Sbjct: 485 STCMFVNWILDFCLSMTWPKMDSTMSTSGGLYFYGGFNIVVWTLAFLCIPETKQFTLEQL 544

Query: 516 NEMYVEGV 523
           +E++  GV
Sbjct: 545 DEIFKVGV 552

>Sklu_2080.4 YBR241C, Contig c2080 4658-6229
          Length = 523

 Score =  108 bits (270), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 103/461 (22%), Positives = 190/461 (41%), Gaps = 60/461 (13%)

Query: 90  FGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIV 149
            G+   D    L D + GL+  IF++G   G L  G L D YGR+        + I+G +
Sbjct: 69  LGRHGFDKCVSLDDQQIGLVTSIFSLGGLAGSLYAGNLADKYGRKRVSFFNSTLGILGSL 128

Query: 150 IQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL 209
           + +  S+ +     GR  +G+  G   V++P LI+E +P   +G   S  Q+ I +GI +
Sbjct: 129 L-LFRSNSYGSLLFGRFTAGVSCGSSIVITPLLINEISPHEWKGALGSMNQVSINIGILV 187

Query: 210 GYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAK----- 264
              T      +++S +WR  L      A+     + ++ ESP++L+ +G  + A+     
Sbjct: 188 ---TQLLALRWADSFRWRWLLFFGAILALLNFLLLFVIDESPKWLLSRGEVDQAESILHG 244

Query: 265 ----------------------------------RSLAKSNKVTIEDPSIVAEMDTIMAN 290
                                             R   ++ K +   P     + +  + 
Sbjct: 245 LRGGHRQHSRDEINEWLTLRGDRSRSQQQTPSQTRDSLRTIKPSHVSPPTYDPLPSANST 304

Query: 291 VETERLAGN--ASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMK 348
           + TE+ +    + W  + S K     R I  I++   QQ  G N   +YG  + + +   
Sbjct: 305 ISTEQSSEEEMSLWQYITSPKYTKSRRAITAILMG--QQFCGINSIIFYGVKVISDLLPD 362

Query: 349 DSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGK 408
            +   +  + I+N   TF A   VD +GR+  L+  + SM++   + S   +TS      
Sbjct: 363 QAILANFGISILNVVVTFGASPLVDHWGRKPLLITSATSMSLASSLISYGILTS------ 416

Query: 409 DQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGF 468
                     +++ FT ++I  FA+   PI ++++ E  P+    +A +     NW+  F
Sbjct: 417 -------NAVLLVAFTFVYIGVFAVGLGPIPFLVIPELSPVEAVGKAQSYGTTCNWLATF 469

Query: 469 LIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKG 509
           +IG+  P + S +G +  ++F                ETKG
Sbjct: 470 IIGYGFPILNSWLGGAVFFLFSSFAILFAIYVYYEIPETKG 510

>Scas_552.0d
          Length = 112

 Score = 98.6 bits (244), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 53/77 (68%)

Query: 456 MAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEV 515
           MA+A G NW W FLI FFTPFIT AI F YGYVFMGC+            E KGLTLEEV
Sbjct: 7   MALANGCNWFWNFLISFFTPFITGAINFYYGYVFMGCMVFGYFYVFFFVPEMKGLTLEEV 66

Query: 516 NEMYVEGVKPWKSGSWI 532
           NE++ +GV PWKS +W+
Sbjct: 67  NELWEDGVLPWKSPNWV 83

>Kwal_14.1625
          Length = 506

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 111/496 (22%), Positives = 203/496 (40%), Gaps = 72/496 (14%)

Query: 41  TNAELPAKPIAAYWTVICLCLMIA-FGGFVFGWDTGTISG---FVNQTDFKRRFGQMKSD 96
           T A L  +P   +   +    M+A FG   +G+    ++     ++ T F          
Sbjct: 4   TQALLGPRPKPKFTGSLLFATMVACFGSIQYGYHVAELNAPGQVLSCTKFVSPHPDRPYS 63

Query: 97  GTYY----------LSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIV 146
            T++          LS+ + GL   IF IG   G L  G++ D YGR+       ++ ++
Sbjct: 64  DTWFGRHGFQQCIPLSEEQMGLATSIFCIGGLVGSLYAGKVADRYGRKRYSFSNCVIGVI 123

Query: 147 GIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLG 206
           G +I +  ++ +    IGR+I G+  G   V++P  I+E +PK +RG+  S  Q+ I +G
Sbjct: 124 GSLI-LFRANSYASLLIGRLIVGISCGSCIVVTPLFINEISPKELRGSLGSMNQVCINIG 182

Query: 207 IFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRS 266
           I L   T      Y++S +WR  +      A+     +  + ESP +L  +G  + A+  
Sbjct: 183 ILL---TQLLALRYADSYRWRWLMLAGAGLALIQFLLLFAIEESPLWLASRGDLDGAENV 239

Query: 267 LA---------------------KSNKVTIEDP------SIVAEMDTIMANVETERLAGN 299
           L+                      S++     P      S  ++  ++  +        +
Sbjct: 240 LSILRGGDRRRSRGEVEEWLQTRGSSRPGTSSPDSTGRESPASQQSSLPESAIDAASQSD 299

Query: 300 ASWGELFSNKGAILPR-----VIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTS 354
            S    FS+      R     ++MG      QQ  G     +YG  + +    + +   +
Sbjct: 300 VSVSNYFSDPRYSKSRWAVTAILMG------QQFVGIGSIIFYGVKLISGQLPQYAVLVN 353

Query: 355 IVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSK 414
             + I+N   T  A   VD +GR+  L+  + +++I  V F + G+            S 
Sbjct: 354 FAISILNVVVTLGASVLVDHWGRKPLLVFSAGAISIASV-FVSAGIV----------MSN 402

Query: 415 AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFT 474
           AA  +++  T +F+  FA+   PI ++++AE  P      A +     NWI   ++G+  
Sbjct: 403 AA--MLVTSTFMFVAVFAMGLGPIPFLVIAELSPPEASGIAQSYGTACNWIGNSIVGYGF 460

Query: 475 PFITSAIGFSYGYVFM 490
           P +    G   GY F+
Sbjct: 461 PIMNEFFG---GYAFL 473

>KLLA0D00253g <12780..14534 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, hypothetical start
          Length = 584

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 121/505 (23%), Positives = 217/505 (42%), Gaps = 44/505 (8%)

Query: 45  LPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDV 104
           L   P A  W+     L+++ G  + G+DT  I+       F+  FG+       +    
Sbjct: 70  LRKYPKAVGWS-----LVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPS 124

Query: 105 RTGLIVGI-FNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYF- 162
           +  + +G+    G   G    G   D YG R       LV I G+V+ IA +  +  YF 
Sbjct: 125 KWQIGLGMCVACGEIIGLQITGIFADRYGYR-------LVLIAGLVLLIAFN--FILYFA 175

Query: 163 -------IGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY 215
                  IG+I+SG+  G    L  +  SE  P  +R    ++  L   +G  +      
Sbjct: 176 NSLTMIAIGQILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLK 235

Query: 216 GTKDY--SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKV 273
             +++  ++ + WR+P  L + + + +I G+ + PESP +LV KGR + AKRS+ +   +
Sbjct: 236 ACQEHLANDELGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTL 295

Query: 274 -TIEDPSIVAEMDTIMA-NVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGN 331
            T E   +   M T M   VE E    + S   +   KG    R  +  +   +Q LTG+
Sbjct: 296 PTSEKDKLTDIMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTGS 355

Query: 332 NYFFYYGTTIFNAVGMKDS--FQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMA 389
                Y T  +   G+  S  F  SI+  ++    T  + +   + GR   L  G     
Sbjct: 356 A-LMGYSTYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQT 414

Query: 390 ICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPL 449
           I   I   +G +S       + +S  AG++++++     FF+  +  P+ Y +V+E    
Sbjct: 415 IVMFITGGLGFSS------SEGASWGAGSMLLIYN----FFYNSTLGPVVYCVVSEIPSD 464

Query: 450 RVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGY---VFMGCLXXXXXXXXXXXC- 505
           R++ + + +A  +  +   +    TP++ ++  +++G    +F G L             
Sbjct: 465 RLRTKTVVLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLP 524

Query: 506 ETKGLTLEEVNEMYVEGVKPWKSGS 530
           ETKG T  E++E++ + V   K  S
Sbjct: 525 ETKGRTFAELDELFHQRVPARKFNS 549

>KLLA0B00264g 12844..14574 gi|5441459|emb|CAB46745.1 Kluyveromyces
           lactis maltose permease, start by similarity
          Length = 576

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 117/498 (23%), Positives = 216/498 (43%), Gaps = 30/498 (6%)

Query: 45  LPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDV 104
           L   P A  W+     L+++ G  + G+DT  I+       F+  FG+       +    
Sbjct: 62  LRKYPKAVGWS-----LVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPS 116

Query: 105 RTGLIVGI-FNIGCAFGGLTLGRLGDMYGRRIGLMC-VVLVYIVGIVIQIASSDKWYQYF 162
           +  + +G+    G   G    G   D YG R+ L+  +VL+     ++  A+S       
Sbjct: 117 KWQIGLGMCVACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFANSLT--MIA 174

Query: 163 IGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDY-- 220
           IG+I+SG+  G    L  +  SE  P  +R    ++  L   +G  +        +++  
Sbjct: 175 IGQILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLA 234

Query: 221 SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKV-TIEDPS 279
           ++ + WR+P  L + + + +I G+ + PESP +LV KGR + AKRS+ +   + T E   
Sbjct: 235 NDELGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDK 294

Query: 280 IVAEMDTIMA-NVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYG 338
           +   M T M   VE E    + S   +   KG    R  +  +   +Q LTG+     Y 
Sbjct: 295 LTDIMITKMRMTVEKENRLASESSSYMDCFKGIDARRTRITCLTWVMQNLTGSA-LMGYS 353

Query: 339 TTIFNAVGMKDS--FQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFS 396
           T  +   G+  S  F  SI+  ++    T  + +   + GR   L  G     I   I  
Sbjct: 354 TYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFITG 413

Query: 397 TVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAM 456
            +G +S       + +S  AG++++++     FF+  +  P+ Y +V+E    R++ + +
Sbjct: 414 GLGFSS------SEGASWGAGSMLLIYN----FFYNSTLGPVVYCVVSEIPSDRLRTKTV 463

Query: 457 AIAVGANWIWGFLIGFFTPFITSAIGFSYGY---VFMGCLXXXXXXXXXXXC-ETKGLTL 512
            +A  +  +   +    TP++ ++  +++G    +F G L             ETKG T 
Sbjct: 464 VLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVWAYFDLPETKGRTF 523

Query: 513 EEVNEMYVEGVKPWKSGS 530
            E++E++ + V   K  S
Sbjct: 524 AELDELFHQRVPARKFNS 541

>YIL171W (HXT12) [2507] chr9 (19515..19844) Member of the hexose
           transporter family of the major facilitator superfamily
           (MFS) [330 bp, 109 aa]
          Length = 109

 Score = 93.2 bits (230), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (65%), Gaps = 16/88 (18%)

Query: 8   RVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGG 67
           + E G  + S++       L+  E+PI         +LP KP++AY TV  LCLMIAFGG
Sbjct: 29  KTEHGDSKDSLN-------LDATEAPI---------DLPQKPLSAYTTVAILCLMIAFGG 72

Query: 68  FVFGWDTGTISGFVNQTDFKRRFGQMKS 95
           F+FGWDTGTISGFVN +DF RRFGQ K+
Sbjct: 73  FIFGWDTGTISGFVNLSDFIRRFGQKKT 100

>KLLA0E01782g 171319..173037 weakly similar to ca|CA5798|IPF4181
           Candida albicans putative permease (by homology),
           hypothetical start
          Length = 572

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 108/404 (26%), Positives = 182/404 (45%), Gaps = 28/404 (6%)

Query: 131 YGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKH 190
           +GRR  ++    + + G +IQ   S+        R+  G+G+G  +   P   +E AP  
Sbjct: 172 FGRRFIVLISCFIGVSGSLIQ-GFSNGLGLILFARLYLGIGMGLCSSTVPIYTAECAPAV 230

Query: 191 IRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVP-E 249
            RG  +  +Q  I LG+ LG   N    +   ++ WR+ +G +   A F+ A ++ +P E
Sbjct: 231 SRGAILMLWQTFIALGVCLGSVFNRAFVEIEGNLSWRLMIG-SSCVAPFITALVVYIPPE 289

Query: 250 SPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETE-RLAGNASWGE---- 304
           SPR+L+  G   ++  SL +     +       +   +  +++ E +LA   SW +    
Sbjct: 290 SPRWLIGNGFVRESLESLIRLRNTEVSGSR---DFYILYESLKYEHKLAAKLSWHQEIKS 346

Query: 305 LFSNKGAILPRVIMGIMIQSL--QQLTGNNYFFYYGTTIFNAVGMK--DSFQTSIVLGIV 360
           LFSN   I  R  + +    +  QQ  G N    Y  TI    G+    +   SI +G  
Sbjct: 347 LFSN---IRNRFALWVSFLGILGQQYGGVNILVSYTATILTNAGIDPVTAIAGSIGIGGG 403

Query: 361 NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM 420
            F +TF++   +D+FGRR  LL        C  +F   G+     N K+  +  AAG   
Sbjct: 404 CFLATFLSSQLIDRFGRRTMLLLTLPVEGAC--LFWLGGIL----NIKEDQARLAAG--- 454

Query: 421 IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA 480
           +    +F+ F+ I   PI++ +VAE+  + V+    A A+  NW+  F +    P +  +
Sbjct: 455 LAAMYVFVLFYGIGIGPISFTLVAETPSITVRMAHSAFAMSINWLLDFCLTMTWPKMADS 514

Query: 481 IGFSYGYVFMGCLXXXX-XXXXXXXCETKGLTLEEVNEMYVEGV 523
           +G S G  F G               ETK  TLE+++E++  GV
Sbjct: 515 MGTSGGLYFYGAFNFLIWVLAYFTIPETKRFTLEQLDEVFKHGV 558

>CAGL0K12716g complement(1260169..1261623) similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, hypothetical start
          Length = 484

 Score = 99.4 bits (246), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 97/428 (22%), Positives = 187/428 (43%), Gaps = 35/428 (8%)

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           G++ G D  ++  F+N  +F   FG          + +  GL++G   +G   G +    
Sbjct: 18  GYLMGMDLSSLGVFLNGDEFLSYFGTP--------TPIEQGLLMGANPLGGLIGSIFYVS 69

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           L     R        +++++G  I I   + W    + R + G+ +G +++     I+E 
Sbjct: 70  LAKNCARLYSFRLSTIIWLIGCFIGIFVLEIW-MIAVARFLKGITIGMLSIHITNYINEV 128

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLM 246
            P +IRG  ++F Q+  T  IF  +    G   + +   +R+  GL F  A+ +I     
Sbjct: 129 FPSNIRGRTLAFVQVGYTFSIFSMHYYCVGLNTFKSHYAFRLAWGLEFIPAVAVIIATFW 188

Query: 247 VPESPRFLVEKGRYEDAKR---SLAKSNKVTIEDPSIVAE-MDTIMANVETERLAGNASW 302
           +PESP +L+     + +++      K +  +  DP+ +++ +D I     T R+      
Sbjct: 189 IPESPVYLLRNTIPQISQKVDVMKVKHDSDSENDPADISDNIDDIFEFECTSRILCIREI 248

Query: 303 GELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNF 362
            +L +       R++MG ++Q L Q TG N   YY T I    G+K+  +T +++  V +
Sbjct: 249 LKLKTRN-----RLLMGTILQVLVQFTGINVILYYITYICEMAGLKE--ETKLLVSAVPY 301

Query: 363 -----ASTFVALYTVDKFGRRKCLLGGSASMAICF----VIFSTVGVTSLYPNGKDQP-- 411
                 S F  LY +D   R+   + GSA ++       ++ ST G   + P   ++   
Sbjct: 302 FINAVLSCFPLLY-LDVVPRKLMTVIGSALLSTIMIAIAILMSTTG-HEIEPIKGNKSLI 359

Query: 412 --SSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFL 469
               K  G  ++    LF+  +A+S A + ++   E  P+  + + + I +   W+  F 
Sbjct: 360 WIVPKVPGLFILCLCFLFVGIYALSIACVPWIYTCELLPVSARAKGLPICMAIGWLMNFC 419

Query: 470 IGFFTPFI 477
           I    P +
Sbjct: 420 ITMTGPLL 427

>Scas_597.5
          Length = 489

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 177/410 (43%), Gaps = 30/410 (7%)

Query: 90  FGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIV 149
           F +   D    ++D + G I   F+IG   G    G+L + YGR+   +   L+  +G  
Sbjct: 68  FQKYGLDTCIRMTDQQLGAITASFSIGGLVGSFVAGKLAEKYGRKYVSVVNCLIAFLGSF 127

Query: 150 IQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL 209
           I   S+       +GR I G+  G   V++   I++ AP   RG+  +  QL I LGI L
Sbjct: 128 IMFFSNSV-LPMILGRTIVGIAAGVSVVVTSLFINDVAPVDWRGSLGTMNQLSINLGILL 186

Query: 210 GYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK 269
                       +  +WR  + +    AI  +   + V ESPR+L+ +G    A+++L  
Sbjct: 187 TQFAGLKFVRNEDDGKWRWVMFIGMVLAILNLVLWIRVAESPRWLLAQGDVIGAEKALFL 246

Query: 270 SNKVTIEDPSIVAEMDT--------IMANVETERLAGNASWGELFSNKGAILPRV-IMGI 320
               + +D  +  E+ T           + E  +   + S  E F        R  I  I
Sbjct: 247 LRIGSYQD--VKQEVQTWKNENNNSSNNDTEANQSTRDISLKEYFKESQFKKARTAITAI 304

Query: 321 MIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKC 380
           ++   QQ  G N   +YG  + + +  + +   ++ + ++N   TFV+   +DKFGR+  
Sbjct: 305 LVG--QQFCGINSIIFYGVKVISQLLPQHAVLINLGISLLNVIFTFVSSTIIDKFGRKPL 362

Query: 381 LLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAY 440
           L+  ++ MA    I S   V   +P             +++  T L+I  FA+   PI +
Sbjct: 363 LITSTSIMAFSSFIISISIVGK-FP------------IILVSSTYLYIVAFALGVGPIPF 409

Query: 441 VIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFM 490
           +I+ E      K  A +     NWI  F++G+   F   +  FS GYV+M
Sbjct: 410 LIIGELSNKDDKAVAQSYGTVCNWIATFVVGY--TFAVLSNWFS-GYVYM 456

>KLLA0E06743g complement(612941..614944) similar to
           ca|CA5798|IPF4181 Candida albicans putative permease (by
           homology), start by similarity
          Length = 667

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 112/447 (25%), Positives = 189/447 (42%), Gaps = 56/447 (12%)

Query: 102 SDVRTGLIVGIFNIGCA-FGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQI---ASSDK 157
            D   GL+ G   + CA         L +M+GR+  +     +  +   +Q    A +  
Sbjct: 186 DDWLEGLVNGAPYLCCAGVSCWATDWLNNMFGRKKVIFITCAISAITCFLQAFGPAGTPG 245

Query: 158 WYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY-- 215
           W+  F  R + G G+G  +  +   ++E + K +RG     +Q     GI  GY  +   
Sbjct: 246 WHYLFAMRFLLGFGIGPKSATTSVYLAECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIF 305

Query: 216 ---GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNK 272
              G    +  + WR+ L      AI ++  +   PESPR+L+ KGRY++A  S      
Sbjct: 306 YRVGRAGIAGGLNWRLMLASAMIPAILVLVQIPFCPESPRWLMGKGRYKEAYES-----T 360

Query: 273 VTIEDPSIVAEMDTIMANV--ETERLAGNASW---GELFS---NKGAILPRVIMGIMIQS 324
           + I +  I+A  D    +V    E     + W    E+F+   N+ A++   I   M   
Sbjct: 361 LQIRNHKILACRDLFYQHVLLMEENSLEMSYWTRLREIFTVRRNRNALICAFICAFM--- 417

Query: 325 LQQLTGNNYFFYYGTTIFNAVGMKD--SFQTSIVLGIVNFASTFVALYTVDKFGRRKCLL 382
            QQ    N   YY + IF   G  +  S   S+  G++NF     A + +D+FGRR  LL
Sbjct: 418 -QQFCAINVIAYYSSAIFLQSGFTEISSLCASLGFGLINFFFAIPAFFMIDRFGRRFLLL 476

Query: 383 GGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVI 442
                +A+  +I    G +    + + +    + G  + VF+ ++ F   +    + +VI
Sbjct: 477 NTFPWLAVFLLI---TGFSFWIDDTEKRIGVVSMG--IYVFSAIYSFGCGV----VPFVI 527

Query: 443 VAESYPLRVKNRAMAIAVGANWIWGF----------LIGFFTPFITSAIGFSYGYVFMGC 492
             E +PL V  RA+  ++    +WGF          ++  F P    A GF   +  +G 
Sbjct: 528 AGEVFPLYV--RAIGASLFTIVLWGFNFILSLTWPSMLRAFEP--QGAFGFYAAWNVIGW 583

Query: 493 LXXXXXXXXXXXCETKGLTLEEVNEMY 519
                        ETK LTLEE++E++
Sbjct: 584 FLVYFFMP-----ETKQLTLEELDEVF 605

>YFL040W (YFL040W) [1643] chr6 (51350..52972) Putative hexose
           transporter, member of the hexose transport family of
           the major facilitator superfamily (MFS) [1623 bp, 540
           aa]
          Length = 540

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 114/502 (22%), Positives = 214/502 (42%), Gaps = 50/502 (9%)

Query: 44  ELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSD 103
           ++P   I   + V  +  ++   GF+ G +  +++ F+    F   F         Y + 
Sbjct: 13  KMPKIKITKTYEVTKITAILTLVGFIMGLEVPSLATFLTNKTFNEYFK--------YPTP 64

Query: 104 VRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFI 163
           ++ GL++G   +G   G      + D + R       ++++ +  ++     D      I
Sbjct: 65  LQQGLLMGSTPLGGIMGCFICCIMNDRFSRIYQFQSGIIIWNIVTLLNFCIWDI-LGLLI 123

Query: 164 GRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNS 223
            R+I GM +G  ++L  +  +E  P+  RG+ +S+ QL +T+GI + +        + + 
Sbjct: 124 CRMIKGMILGNFSILVASYANEVIPRGKRGSTMSYIQLCLTIGILVMHYLCIALSLWDSH 183

Query: 224 VQWRVPLGLNFAFAIFMIAGMLM------VPESPRFLVEKGRYEDAK---RSLAKS-NKV 273
             +R+      A+ I +I G+L       +PES  +LV  G+  +A+    +LAK  N+ 
Sbjct: 184 FAFRI------AWCIGIIPGLLFWMASYALPESYHWLVLHGKMSEAQEIQHNLAKKFNES 237

Query: 274 TIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPR-----VIMGIMIQSLQQL 328
              D   V EM  I        LAG+   G    +    LPR     +I+G+ +Q L Q 
Sbjct: 238 QPRDA--VPEMSKI-------ELAGDFWIGVNDLDFSKKLPRGSFKPLILGMTLQLLVQF 288

Query: 329 TGNNYFFYYGTTIFNAVGMKDSFQ--TSIVLGIVNFASTFVALYTVDKFGRRK-CLLGG- 384
           +G N    Y T I   VG++ + +  TS +   +N   + + +  +D   R+   LLGG 
Sbjct: 289 SGINIILGYITYICEIVGLEGNVKLFTSSIPYFINMVLSLLPITFIDYTSRKLITLLGGF 348

Query: 385 --SASMAICFVIFSTVGVTSLYPNGKDQP-----SSKAAGNVMIVFTCLFIFFFAISWAP 437
             S  +     +F   G  +   +G          +   G  ++    L +  FA+S + 
Sbjct: 349 PISGLLITIGALFVKYGQDTKPIDGNRSLVWSIGENPFVGGWILTLCFLIVGIFAMSLSS 408

Query: 438 IAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXXX 497
           I +V   E  P RVK +  AI V   W+  F++ F  P +   +  +   +F        
Sbjct: 409 IPWVYTNEMLPSRVKVKGFAICVTFGWLGNFILTFLCPVMIERLKGTTFIIFGSLTFLIS 468

Query: 498 XXXXXXXCETKGLTLEEVNEMY 519
                   ETKG+++E++++ +
Sbjct: 469 LSVLIWFPETKGMSIEDIDKFF 490

>Kwal_27.12815
          Length = 198

 Score = 91.7 bits (226), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 92/167 (55%), Gaps = 12/167 (7%)

Query: 357 LGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAA 416
           + +VN   T   +  V+  GRR  LL G+  M +  +I + VG T+L       P S +A
Sbjct: 1   MNVVNVIMTIPGIALVEIAGRRNLLLWGAVGMCVSELIVAAVG-TAL-------PDSFSA 52

Query: 417 GNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPF 476
              +I F+C FI  FA +W P+A+V+V E +PLRV+ +++A+   +NW++ F I + TP+
Sbjct: 53  NKTLIAFSCTFIASFAATWGPLAWVVVGEIFPLRVRAKSVAVCAASNWLFNFAIVYATPY 112

Query: 477 ITSA----IGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
           +  +    +     +++ GC             ETKGLTLE++++++
Sbjct: 113 LVDSEHANLQSKLFFIWGGCTFLCFLFVYFFIYETKGLTLEQIDQLF 159

>YJR160C (MPH3) [3050] chr10 complement(737923..739731) Protein with
           maltose permease activity, member of hexose transporter
           family of the major facilitator superfamily (MFS),
           identical to Mph2p [1809 bp, 602 aa]
          Length = 602

 Score = 96.3 bits (238), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 122/532 (22%), Positives = 214/532 (40%), Gaps = 72/532 (13%)

Query: 28  ETDES----PIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQ 83
           E DES    P+ T        L   P AA W+++    +I     + G+DT  +  F   
Sbjct: 77  EADESERGMPLATA-------LNTYPKAAAWSLLVSTTLI-----MEGYDTAILGAFYAL 124

Query: 84  TDFKRRFG-QMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVL 142
             F+R+FG Q    G + +S      +   +  G   G    G   D+ G R  L+ + L
Sbjct: 125 PIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGPSVDLVGNRYTLI-IAL 183

Query: 143 VYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLM 202
            ++      +   +      +G+ + GM  G    L+ +  SE  P  +R    ++  L 
Sbjct: 184 FFLAAFTFILYFCNSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSNLC 243

Query: 203 ITLG-IFLGYCTNYGTKDYSNS-VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRY 260
              G +F         K Y++S + +++P  L +   + +  G+   PESP +LV+KGR+
Sbjct: 244 WLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPVPLALGIFFAPESPWWLVKKGRF 303

Query: 261 EDAKRSLAK--SNKVTIEDPSIVAEMDTIMANVETER--LAGNASWGELFSNKGAILPRV 316
           ++A+RSL +  S K   ++  +  E+D I   ++ E+   +   S+ + F +K  I  R 
Sbjct: 304 DEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEKRLTSKEGSYSDCFEDK--INRRR 361

Query: 317 IMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD--SFQTSIVLGIVNFASTFVALYTVDK 374
                +    Q T  +    Y T  +   G+    SF  SI+   +   +TF++ +    
Sbjct: 362 TRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFTFSIIQYCLGICATFLSWWASKY 421

Query: 375 FGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAIS 434
           FGR      G A   I F I   +G +S +       S   +G++++       FF+ + 
Sbjct: 422 FGRYDLYAFGLAFQTIVFFIIGGLGCSSTH------GSKMGSGSLLMAVA----FFYNLG 471

Query: 435 WAPIAYVIVAESYPLRVKNRAMAIAVGA-------------------NWIWGFLIGFFTP 475
            AP+ + +V+E    R++ + + +A                       W WG   GFF  
Sbjct: 472 IAPVVFCLVSEMPSSRLRTKTIILARNTYNVVSIICSVLILYQLNSKKWNWGAKSGFF-- 529

Query: 476 FITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWK 527
                    +G +    L            ET G T  E+NE++  GV   K
Sbjct: 530 ---------WGVLCFCTLIWAVVDLP----ETAGKTFVEINELFKLGVSARK 568

>YDL247W (MPH2) [630] chr4 (5985..7814) Protein with maltose
           permease activity, member of hexose transporter family
           of the major facilitator superfamily (MFS), identical to
           Mph3p [1830 bp, 609 aa]
          Length = 609

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 122/532 (22%), Positives = 214/532 (40%), Gaps = 72/532 (13%)

Query: 28  ETDES----PIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQ 83
           E DES    P+ T        L   P AA W+++    +I     + G+DT  +  F   
Sbjct: 77  EADESERGMPLATA-------LNTYPKAAAWSLLVSTTLI-----MEGYDTAILGAFYAL 124

Query: 84  TDFKRRFG-QMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVL 142
             F+R+FG Q    G + +S      +   +  G   G    G   D+ G R  L+ + L
Sbjct: 125 PIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGPSVDLVGNRYTLI-IAL 183

Query: 143 VYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLM 202
            ++      +   +      +G+ + GM  G    L+ +  SE  P  +R    ++  L 
Sbjct: 184 FFLAAFTFILYFCNSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSNLC 243

Query: 203 ITLG-IFLGYCTNYGTKDYSNS-VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRY 260
              G +F         K Y++S + +++P  L +   + +  G+   PESP +LV+KGR+
Sbjct: 244 WLFGQLFAAGIMKNSQKKYADSELGYKLPFALQWILPVPLALGIFFAPESPWWLVKKGRF 303

Query: 261 EDAKRSLAK--SNKVTIEDPSIVAEMDTIMANVETER--LAGNASWGELFSNKGAILPRV 316
           ++A+RSL +  S K   ++  +  E+D I   ++ E+   +   S+ + F +K  I  R 
Sbjct: 304 DEARRSLRRTLSGKGPEKEILVTLEVDKIKVTIDKEKRLTSKEGSYSDCFEDK--INRRR 361

Query: 317 IMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKD--SFQTSIVLGIVNFASTFVALYTVDK 374
                +    Q T  +    Y T  +   G+    SF  SI+   +   +TF++ +    
Sbjct: 362 TRITCLCWAGQATCGSILIGYSTYFYEKAGVSTEMSFTFSIIQYCLGICATFLSWWASKY 421

Query: 375 FGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAIS 434
           FGR      G A   I F I   +G +S +       S   +G++++       FF+ + 
Sbjct: 422 FGRYDLYAFGLAFQTIVFFIIGGLGCSSTH------GSKMGSGSLLMAVA----FFYNLG 471

Query: 435 WAPIAYVIVAESYPLRVKNRAMAIAVGA-------------------NWIWGFLIGFFTP 475
            AP+ + +V+E    R++ + + +A                       W WG   GFF  
Sbjct: 472 IAPVVFCLVSEMPSSRLRTKTIILARNTYNVVSIICSVLILYQLNSKKWNWGAKSGFF-- 529

Query: 476 FITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWK 527
                    +G +    L            ET G T  E+NE++  GV   K
Sbjct: 530 ---------WGVLCFCTLIWAVVDLP----ETAGKTFVEINELFKLGVSARK 568

>Scas_716.72
          Length = 544

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 111/504 (22%), Positives = 212/504 (42%), Gaps = 53/504 (10%)

Query: 56  VICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKS--DGTYYLSDVRTGLIVGIF 113
           ++ + +++ F  F+ G +  +++ F+N   F + F        G    S    GL+    
Sbjct: 11  LVVIGVILLFPSFIMGMEITSLAVFLNSDHFIKYFNHPSPFLQGILMSSSTLGGLV---- 66

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG 173
             GC     T+ ++G + G +I     +L +I G+V  +          I RII G+ +G
Sbjct: 67  --GCISYSATVVKVGRITGFQIA---TLLWFIGGVVATLVQHIS--MIIIARIIKGVTMG 119

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL-GYCTNYGTKDYSNSVQWRVPLGL 232
             +VL P  I E  P   RG  ++  QL  T+ I L  Y + +    + N   +R+  GL
Sbjct: 120 WFSVLIPAYIGEIYPSQWRGRMIAMTQLSYTIAILLVHYLSIWFNHVWKNHWSFRMVWGL 179

Query: 233 NFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKR---SLA------------KSNKVTIED 277
               ++    G + +PE+P++L   G Y  A++   +LA             S+K  +  
Sbjct: 180 EIIPSLLFFWGSVWLPETPQWLTLHGEYTKAQKIQNNLAIKFNSRFGSTSNHSSKDIVTS 239

Query: 278 PSIVAEMDT-------IMANVETERLAGNAS----WGELFSNKGAILPRVIMGIMIQSLQ 326
               AE D        IM  ++   L G+ S    + ELF    +   +  +G+ +Q L 
Sbjct: 240 NEDAAEEDDQQRAKMEIMDKLDLANLYGDGSNDLKYKELFGK--SYWKQTAIGVTLQLLV 297

Query: 327 QLTGNNYFFYYGTTIFNAVGMK---DSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLG 383
           Q +G N   +Y T I   +G+    + F +SI    +N   + + +  +D   R+K  L 
Sbjct: 298 QFSGINILMFYITYICEMLGLNGNTNYFASSIPY-FINMILSLIPICFIDSVNRKKMTLA 356

Query: 384 GSASMAICFVIFSTV----GVTSLYPNGKDQP---SSKAAGNVMIVFTCLFIFFFAISWA 436
           GS  ++I  V   T+    G      NG +        ++G  ++    LF+  F+++ +
Sbjct: 357 GSFPVSIIMVAIGTIMALNGRKVAPVNGNESIIWFVDDSSGGWILALCFLFVGVFSLTLS 416

Query: 437 PIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSYGYVFMGCLXXX 496
               +   E +P + K + +A ++  +W   F +    P +   + +    +  G     
Sbjct: 417 CFPLLYTNEIFPTKAKPKGLAFSMFISWTSNFTLTLLAPLMLEYLKWGTFILLGGLTFVL 476

Query: 497 XXXXXXXXCETKGLTLEEVNEMYV 520
                    +T GL+++E+N +++
Sbjct: 477 SVCIAIFFPDTSGLSVQEINHLFI 500

>Sklu_2375.1 YGR289C, Contig c2375 1376-3217 reverse complement
          Length = 613

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 118/552 (21%), Positives = 235/552 (42%), Gaps = 51/552 (9%)

Query: 3   EFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAEL----PAKPIAAYWTVIC 58
           EF++S VE     +++ +  I + L   E   Q+ ++     L       P AA+W+V+ 
Sbjct: 43  EFSSSTVEQ-VDCSNVENEVIAKFLGMSEDAQQSDNQDKEMSLLQGIKQYPKAAFWSVVL 101

Query: 59  LCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKS-DGTYYLSDV-RTGLIVGIFN-- 114
              +I     + G+DT  ++       F ++FG   +  G Y +S   +TGL + IF   
Sbjct: 102 SSALI-----MEGYDTALLASLYALPAFAKKFGSFNAASGIYEISAAWQTGLSMCIFVGE 156

Query: 115 -IGCAFGGLTLGRLG---DMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGM 170
            IG    G+   R+G    +    + L C + V        + +        +G I+ G+
Sbjct: 157 IIGLQLAGVAADRVGYRWTLITSLLALFCFIFVLFFAPSCAVLA--------VGEILCGI 208

Query: 171 GVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL--GYCTNYGTKDYSNSVQWRV 228
             G    L+ +  +E  P  +R    ++  +   +G  +  G   N       +++ +++
Sbjct: 209 PWGCFQTLTVSYATEVCPLVLRYYLTTYVNICWVIGQIMASGVLKNSQENLADSALAYKL 268

Query: 229 PLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK---SNKVTIEDPSIVAEMD 285
           P  L + +   +  G+   PESP +LV+K R ++A+RSL +     + T +D  + A + 
Sbjct: 269 PFALQWIWPFPIALGIYFAPESPWWLVKKNRLKEAERSLKRLITGIEATEKDIVVDAMIK 328

Query: 286 TIMANVETER-LAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNA 344
            +    E E  +  N ++ + F  KG    R  +  ++   Q   G+     Y T  +  
Sbjct: 329 KMKLTTEKEDMMTKNVTYWDCF--KGVDGRRTRIASLVWIAQNACGST-LMGYSTYFYQK 385

Query: 345 VGMKDS--FQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTS 402
            G+ DS  F  SI+   + F  TF + +   ++GR      G     +   +   +G   
Sbjct: 386 AGLSDSFAFNFSIIQYCLGFVGTFSSWFFSKRYGRFTIFTTGLGLQTLLLFVIGGLG--- 442

Query: 403 LYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGA 462
            + + K+  +S A G++M+     F+F + +   P+ Y I  E    +++ + + +A   
Sbjct: 443 -FSDSKN--ASWAIGSLMMA----FVFVYDVGVGPVTYCIFPEEPSTKLRTKTVIVARNF 495

Query: 463 NWIWGFLIGFFTPFITSAIGFSYGY---VFMGCLXXXXXXXXXXXC-ETKGLTLEEVNEM 518
             I G +   +TP++ ++  +++G    +F G +             ET G T  E++E+
Sbjct: 496 YNIMGIINSIWTPYMLNSTEWNWGAKTGLFWGGISLVMLVWAVLDLPETAGRTFGEIDEL 555

Query: 519 YVEGVKPWKSGS 530
           + + +   K  S
Sbjct: 556 FAQKIPARKFSS 567

>AGL277W [4035] [Homologous to NOHBY] complement(185070..187085)
           [2016 bp, 671 aa]
          Length = 671

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 98/380 (25%), Positives = 162/380 (42%), Gaps = 38/380 (10%)

Query: 158 WYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY-- 215
           W   F  R + G G+G  +      ++E APK +RG     +Q     G+  GY  +   
Sbjct: 252 WRYLFAMRFLLGFGLGIKSATVNVYLAECAPKELRGIVCMNWQAFTAFGVMWGYVASLVF 311

Query: 216 ---GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNK 272
              G       + WR+ L      A+F++  +   PESPR+L+ KGRY +A  +L +  K
Sbjct: 312 YRVGDAGIGGGLNWRLMLASAALPAVFVLFQLPHCPESPRWLMGKGRYPEAYAALLQLRK 371

Query: 273 VTIEDPSIVAEMDTIMANVETERLAGNASWGELFS---NKGAILPRVIMGIMIQSLQQLT 329
             +     +     ++    T +L+      E+F+   N+ A +   I   M    QQ  
Sbjct: 372 HRLLACRDLFYQHVLLVQESTLQLSYFTRLKEIFTVRRNRNAFVAAFICAFM----QQFC 427

Query: 330 GNNYFFYYGTTIFNAVGMKD--SFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSAS 387
             N   YY + IF   G  +  S  +S+  GI+N      A + +D+FGRR  LL     
Sbjct: 428 AINVIAYYSSVIFLQAGFSEIASLCSSLGFGIINTVFAIPAYFMIDRFGRRFLLLSTLPW 487

Query: 388 MAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESY 447
           + +  +      VT      KD   +KA+  V+     +F   ++     + +V   E +
Sbjct: 488 LGVFLL------VTGFAFWIKD---TKASIGVISFGIYIFSAIYSFGMGVVPFVYAGEVF 538

Query: 448 PLRVKNRAMAIAVGANWIWG--FLIGFFTPFITSAI------GFSYGYVFMGCLXXXXXX 499
           PL V  RA+  ++ A  +WG  F++    P +  A+      GF   + F+G        
Sbjct: 539 PLYV--RAIGSSLFAVVLWGFNFILALTWPSMLRAMKPQGAFGFYAAWNFIGYFLVYFFL 596

Query: 500 XXXXXCETKGLTLEEVNEMY 519
                 ETK LTLEE++E++
Sbjct: 597 P-----ETKQLTLEELDEVF 611

>KLLA0D05379g complement(464200..465690) weakly similar to sp|P43562
           Saccharomyces cerevisiae YFL040w, start by similarity
          Length = 496

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 101/439 (23%), Positives = 193/439 (43%), Gaps = 52/439 (11%)

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           GF+ G DT ++S F+  + FK  F Q  +        ++TG++ G   IG   G L  G 
Sbjct: 18  GFMLGMDTSSLSLFLGTSYFKEYFKQPTA--------LQTGMMTGANQIGGFVGCLMSGS 69

Query: 127 LGDMYGRRIGLMCVVLVYIVG-----IVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           L ++ G +  L    +++ +G      V+++      Y   + R + G+ VG ++VL+  
Sbjct: 70  LIELIGCKWCLCACSVIWTMGSVGSFFVLEV------YTMALSRFVKGIAVGILSVLASF 123

Query: 182 LISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMI 241
            + E    +IRG   +  Q+ +T+ I   Y  +         + +++  GL    ++ ++
Sbjct: 124 YLMEVFSSNIRGQATALMQMALTISILSIYFLSMLLDKIQGPLAFKITWGLEVIPSLLLL 183

Query: 242 AGMLMVPESPRFLVEKG-RYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA 300
                +PESPR+L + G   +D  RSLA    + ++D   + E   +    +  +L+   
Sbjct: 184 MLFQALPESPRWLYKHGYSNKDIDRSLA---ILRVKDVEKLRE-KFVSETKQKPKLS--- 236

Query: 301 SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLG-- 358
                +  K      + +GI++Q L Q++G N   YY   I   VG  D   + +  G  
Sbjct: 237 -----YIIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMVGFDDDVSSKLTAGPY 291

Query: 359 IVNFASTFVALYTVDKFGRR------KCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPS 412
           IVN   T V ++ +DKF R+         LGG     I  +I   +G        +    
Sbjct: 292 IVNTIFTLVPVFLLDKFNRKVFIGWASVFLGG-----IMLLIGFLIG------ERERHVG 340

Query: 413 SKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGF 472
                N+++    LF+  F+ S +   ++   E  P  +K+ A+++ +  +W  GF +  
Sbjct: 341 DVVLRNIVVALCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSWFTGFALAL 400

Query: 473 FTPFITSAIGFSYGYVFMG 491
             P++   + + + +V +G
Sbjct: 401 MAPYLMQIVEW-WTFVMLG 418

>Kwal_27.11079
          Length = 613

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 115/497 (23%), Positives = 203/497 (40%), Gaps = 42/497 (8%)

Query: 49  PIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVR--T 106
           P AA W+V+    +I     + G+DT  +S       F RRFG        Y    R  T
Sbjct: 97  PKAALWSVVLSSALI-----MEGYDTSLLSSLYALPAFARRFGSYNEVSGIYEVPARWQT 151

Query: 107 GLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRI 166
            L + + N+G   G    G   D  G R  L+  +L  +   +  +  +        G I
Sbjct: 152 ALSMCV-NVGEIIGLQFAGIAADHLGYRRTLIASLLA-VFAFIFILFFATGCPMLAAGEI 209

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFL--GYCTNYGTKDYSNSV 224
           + G+  G    L+    +E  P  +R    +F  +   LG  +  G   N       + +
Sbjct: 210 LCGIPWGCFQTLTVAYATEVCPLALRYYLTTFVNVCWILGQIMAAGVLKNSQENLADSPL 269

Query: 225 QWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK--SNKVTIEDPSIVA 282
            +R+P  L + + + +  G+ + PESP +LV+K R  DA  SL++  S     E  +++ 
Sbjct: 270 AYRIPFALQWVWPLPIALGIYLAPESPWWLVKKERMADAAHSLSRLISGLPPAEKATVIG 329

Query: 283 EM-DTIMANVETER-LAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNN---YFFYY 337
            M   I    + E  L  NAS+ +          R      I SL  +T N        Y
Sbjct: 330 TMLKRIQLTTQKEDILTKNASYRDCLIGSDGRRTR------IASLTWVTQNACGVAMMTY 383

Query: 338 GTTIFNAVGMKDS--FQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIF 395
            T  +   G+ +S  F  SI+        T ++ +    +GR +    G A   +  +I 
Sbjct: 384 STYFYTKAGLSESYAFTFSIIQYCFGLIGTILSWFISKHYGRYEIFARGLALQTLLLIII 443

Query: 396 STVGVTSLYPNGKDQPSSK-AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNR 454
              G +       D  ++K  AG +++V    F+F + +   P+ Y +V E    +++ +
Sbjct: 444 GASGFS-------DSKNAKWVAGTLLLV----FVFVYDVGVGPVTYCLVPEIPSNKLRTK 492

Query: 455 AMAIAVGANWIWGFLIGFFTPFITSAIGFSYGY---VFMGCLXXXXXX-XXXXXCETKGL 510
            + +A     I G +   +TP++ ++  +++G    +F G +             ETKG 
Sbjct: 493 TVILARNCYNIMGIVNAIWTPYMLNSDQWNWGAKTGLFWGAISLVMLIWAYYELPETKGR 552

Query: 511 TLEEVNEMYVEGVKPWK 527
           T  E++E++ +GV   K
Sbjct: 553 TFGEIDELFSQGVPARK 569

>Scas_652.12
          Length = 478

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 95/401 (23%), Positives = 172/401 (42%), Gaps = 31/401 (7%)

Query: 101 LSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQ 160
           L D + G+   IF +G   G   +G + +MYGRRI  +   L+ ++G +I I S + +  
Sbjct: 66  LDDEQIGITNAIFCLGGIVGSFFVGTICNMYGRRIISLFNCLLSLIGALI-IFSGNSFST 124

Query: 161 YFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDY 220
              GR+++G+  G   ++ P  I E  P H +G      Q+MI +GI L         D 
Sbjct: 125 LLWGRLLTGVACGATLIVGPLFIKEVTPPHWKGFLNVTNQVMIKVGILLTQLIGIVLND- 183

Query: 221 SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRS-------LAKSNKV 273
             S +WR         A+  +   L + +SP++L  +G    A+ +       L +  + 
Sbjct: 184 --SYRWRWIFFCGAIAALVNLVLWLEIDDSPKWLFSRGDTLGAEMALFNLRGGLYQEAQE 241

Query: 274 TIEDPSIVAEMDTIMANVET----ERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLT 329
            ++      E    +ANVE       + G +S+ +    +    PR I+ I++   QQ  
Sbjct: 242 EVQTWQREVEQQNSLANVEPMGEYNVMMGPSSFWQYIHKELYWRPRQIITILLMG-QQFC 300

Query: 330 GNNYFFYYGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMA 389
           G +   +YG  + + V  K S + + ++ +     T +    V     RK LL  S+ + 
Sbjct: 301 GISSIVFYGVKVIDQVDPKHSLEINFLIQLTTVFVTIITCIMVPVM-NRKPLLLISSVLV 359

Query: 390 ICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPL 449
           +      T+G+            ++  G ++ V   ++I  FAI   P+ Y+I+ E    
Sbjct: 360 VVSSFLLTIGI------------NRNDGTLLAVAVFIYIIGFAIGLGPLPYLIMKEISTP 407

Query: 450 RVKNRAMAIAVGANWIWGFLIGFFTPFITSAI-GFSYGYVF 489
             +  A       NW    +IG+  P +   + G++Y +VF
Sbjct: 408 PDQKMAQKYGTVCNWTATMIIGYIFPLLFDIMNGYAY-FVF 447

>YBR298C (MAL31) [475] chr2 complement(802587..804431) Maltose
           permease, a high affinity maltose/H[+] symporter, member
           of the hexose transporter family of the major
           facilitator superfamily (MFS) [1845 bp, 614 aa]
          Length = 614

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 115/517 (22%), Positives = 217/517 (41%), Gaps = 43/517 (8%)

Query: 28  ETDES----PIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQ 83
           E DES    P+ T        L   P AA W+++    +I  G     +DT  +  F   
Sbjct: 79  EADESERGMPLMTA-------LKTYPKAAAWSLLVSTTLIQEG-----YDTAILGAFYAL 126

Query: 84  TDFKRRFGQMKSD-GTYYLS-DVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVV 141
             F++++G + S+ G Y +S   + GL +  +  G   G    G   D  G R  L+ + 
Sbjct: 127 PVFQKKYGSLNSNTGDYEISVSWQIGLCL-CYMAGEIVGLQMTGPSVDYMGNRYTLI-MA 184

Query: 142 LVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQL 201
           L ++   +  +          +G+ + GM  G    L+ +  SE  P  +R    ++  L
Sbjct: 185 LFFLAAFIFILYFCKSLGMIAVGQALCGMPWGCFQCLTVSYASEICPLALRYYLTTYSNL 244

Query: 202 MITLG-IFLGYCTNYGTKDYSNS-VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGR 259
               G +F           Y+NS + +++P  L + + + +  G+   PESP +LV+KGR
Sbjct: 245 CWAFGQLFAAGIMKNSQNKYANSELGYKLPFALQWIWPLPLAVGIFFAPESPWWLVKKGR 304

Query: 260 YEDAKRSLAK--SNKVTIEDPSIVAEMDTIMANVETE-RLAGNASWGELFSNKGAILPRV 316
            + A+RSL +  S K   ++  +  E+D I   +E E +++   ++ +    K  I  R 
Sbjct: 305 IDQARRSLERTLSGKGPEKELLVSMELDKIKTTIEKEQKMSDEGTYWDCV--KDGINRRR 362

Query: 317 IMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVNFASTFVALYTVDK 374
                +  + Q +       Y T  +   G+    +F  SI+   +  A+TF++ +    
Sbjct: 363 TRIACLCWIGQCSCGASLIGYSTYFYEKAGVSTDTAFTFSIIQYCLGIAATFISWWASKY 422

Query: 375 FGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAIS 434
            GR      G A  AI F I   +G +       D   +K     +++   +  FF+ + 
Sbjct: 423 CGRFDLYAFGLAFQAIMFFIIGGLGCS-------DTHGAKMGSGALLM---VVAFFYNLG 472

Query: 435 WAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAIGFSY----GYVFM 490
            AP+ + +V+E    R++ + + +A  A  +   ++     +  ++  +++    G+ + 
Sbjct: 473 IAPVVFCLVSEIPSSRLRTKTIILARNAYNVIQVVVTVLIMYQLNSEKWNWGAKSGFFWG 532

Query: 491 GCLXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPWK 527
           G              ET G T  E+NE++  GV   K
Sbjct: 533 GFCLATLAWAVVDLPETAGRTFIEINELFRLGVPARK 569

>YGR289C (MAL11) [2234] chr7 complement(1073968..1075818) Maltose
           permease, a general alpha-glucoside permease, member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [1851 bp, 616 aa]
          Length = 616

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 126/556 (22%), Positives = 228/556 (41%), Gaps = 61/556 (10%)

Query: 3   EFATSRVESGSQQTSIHSTPIVQKL----ETDESPIQTKSEYTNAELPAKPIAAYWTVIC 58
           EF T+  + G       +  ++ ++    + +E+  + KS      L   P AA W+++ 
Sbjct: 56  EFTTNSAQLGDSDE--DNENVINEMNATDDANEANSEEKSMTLKQALLKYPKAALWSILV 113

Query: 59  LCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYL-SDVRTGLIVGIF---N 114
              ++     + G+DT  +S       F+R+FG +  +G+Y + S  + GL + +     
Sbjct: 114 STTLV-----MEGYDTALLSALYALPVFQRKFGTLNGEGSYEITSQWQIGLNMCVLCGEM 168

Query: 115 IGCAFGGLTLGRLGDMYG--RRIGLMC--VVLVYIVGIVIQIASSDKWYQYFIGRIISGM 170
           IG       +  +G+ Y     +GL+   + ++Y    +  IA         +G+I+S +
Sbjct: 169 IGLQITTYMVEFMGNRYTMITALGLLTAYIFILYYCKSLAMIA---------VGQILSAI 219

Query: 171 GVGGIAVLSPTLISETAPKHIR-------GTCVSFYQLMITLGIFLGYCTNYGTKDYSNS 223
             G    L+ T  SE  P  +R         C  F Q+  + GI      N G  D    
Sbjct: 220 PWGCFQSLAVTYASEVCPLALRYYMTSYSNICWLFGQIFAS-GIMKNSQENLGNSD---- 274

Query: 224 VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAK--SNKVTIEDPSIV 281
           + +++P  L + +   ++ G+   PESP +LV K R  +A++SL++  S K   +D  + 
Sbjct: 275 LGYKLPFALQWIWPAPLMIGIFFAPESPWWLVRKDRVAEARKSLSRILSGKGAEKDIQVD 334

Query: 282 AEMDTIMANVETERLAGNASWGELFSN-KGAILPRVIMGIMIQSLQQLTGNNYFFYYGTT 340
             +  I   +E ERL  + S G  F+  KG    R  +  +    Q  +G      Y T 
Sbjct: 335 LTLKQIELTIEKERLLASKS-GSFFNCFKGVNGRRTRLACLTWVAQNSSG-AVLLGYSTY 392

Query: 341 IFNAVGM--KDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTV 398
            F   GM    +F  S++   +  A T  +     + GR   L  G A   +C  I   +
Sbjct: 393 FFERAGMATDKAFTFSLIQYCLGLAGTLCSWVISGRVGRWTILTYGLAFQMVCLFIIGGM 452

Query: 399 GVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAI 458
           G  S         +S  AG +++  +    FF+      + Y IVAE     ++ + + +
Sbjct: 453 GFGSG------SSASNGAGGLLLALS----FFYNAGIGAVVYCIVAEIPSAELRTKTIVL 502

Query: 459 AVGANWIWGFLIGFFTPFITSAIGFSY----GYVFMGCLXXXXXXXXXXXCETKGLTLEE 514
           A     +   +    TP++ +   +++    G  + G              ET G T  E
Sbjct: 503 ARICYNLMAVINAILTPYMLNVSDWNWGAKTGLYWGGFTAVTLAWVIIDLPETTGRTFSE 562

Query: 515 VNEMYVEGVKPWKSGS 530
           +NE++ +GV   K  S
Sbjct: 563 INELFNQGVPARKFAS 578

>KLLA0C19481g 1747623..1748795 similar to ca|CA3241|IPF7493 Candida
           albicans putative permease (by homology), hypothetical
           start
          Length = 390

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 144/334 (43%), Gaps = 19/334 (5%)

Query: 209 LGYCTNYGTKDY---SNSVQWRVPLGLNFAFA-IFMIAGMLMVPESPRFLVEKGRYEDAK 264
           L Y  NYGT  +   ++ +QW  P  +    A + ++   +   ESPR+L++ G+ + A 
Sbjct: 2   LAYFANYGTALHVSNTSRLQWVAPTSIKIVLAGLILVGSFIWCIESPRWLMKMGKDDKAI 61

Query: 265 RSLAKSNKVTIEDPSIVAEMDTIMANV--ETERLAGNASWG---ELFSNKGAILPRVIMG 319
            +LAK   ++   P I  E+  I   +  E E ++G        E+   K       ++ 
Sbjct: 62  INLAKLRNLSETHPFIAGEVADIRYQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIA 121

Query: 320 IMIQSLQQLTGNNYFFYYGTTIFNAVGMK--DSFQTSIVLGIVNFASTFV-ALYTVDKFG 376
            ++Q L Q +G N    Y   + + VG+K  D  + + VLG+V F S ++ A + +D  G
Sbjct: 122 CLVQILGQWSGANAITIYAPELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLG 181

Query: 377 RRKCLLGGSASMAIC---FVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAI 433
           R+K    G +   +    F +F T+   +   +     S   A    I    L    + +
Sbjct: 182 RKKAAYIGISIQLLTLLYFALFLTIVPQATESDAILTKSQFHASQAAIAALFLSGTGWTM 241

Query: 434 SWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTP-FITSAIGFSYGYVFMGC 492
            +  I Y++ AE +P+++++ A +  +  ++   F      P  + S   F   Y F+G 
Sbjct: 242 GFNSIQYLLSAEVFPIKIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGV 301

Query: 493 LXXXXXXXXXXXCETKGLTLEEVNEMYVEGVKPW 526
           L            E  G +LE + E++     PW
Sbjct: 302 LFISLLWVHFFVPEITGRSLESMEELF---SLPW 332

>Kwal_27.11385
          Length = 222

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 93/208 (44%), Gaps = 21/208 (10%)

Query: 321 MIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVNFASTFVALYTVDKFGRR 378
           M+ SL QLTG N   YY +T+   +G   K S   S+V G      T  A+  +D+FGRR
Sbjct: 1   MMVSLGQLTGINAIMYYMSTLMGRIGFSKKRSVAMSMVGGAALLIGTIPAILWMDRFGRR 60

Query: 379 KCLLGGSASMAICFVIFS----TVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAIS 434
                   + A   V+FS     VGV  L P   + P   AA  V +    L+   F  S
Sbjct: 61  --------AWANTIVLFSLGLVLVGVGYLIPLKSNLP---AAEGVYLTGQILYNMAFG-S 108

Query: 435 WAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSAI---GFSYGYVFMG 491
           ++ + +V+ +ES+ L  ++  M       ++W F + +    +  A+   G + G+    
Sbjct: 109 YSALTWVLPSESFSLATRSVGMTCCSTMLYLWSFTVTYNFDRMQKAMTYTGLTLGFYGGL 168

Query: 492 CLXXXXXXXXXXXCETKGLTLEEVNEMY 519
            +            ETK  TLEE+++++
Sbjct: 169 AIVIGLPYQLLFMPETKNRTLEEIDDIF 196

>YDL199C (YDL199C) [675] chr4 complement(101291..103354) Member of
           the hexose transporter family of the major facilitator
           superfamily (MFS) [2064 bp, 687 aa]
          Length = 687

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 91/437 (20%), Positives = 180/437 (41%), Gaps = 60/437 (13%)

Query: 71  GWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGL-TLGRLGD 129
           G D G ISG V    F++ F        +Y      G IV I N+G     L     + +
Sbjct: 135 GLDQGLISGNVMTLSFQKYF--------HYPLTSPLGNIVSIVNLGAFMASLFVYSGILE 186

Query: 130 MYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVG---GIAVLS------P 180
              R+  L    ++Y +G ++Q+ + ++W    +GR + G+G+G    + ++       P
Sbjct: 187 PCSRKKMLQISTMIYSLGAIVQVLALNQWC-LLLGRFLLGVGMGFAFSMVIIYQFEFPLP 245

Query: 181 TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM 240
            +   T    I   CVS   +  + GI++     Y          WR PL  + A  I +
Sbjct: 246 CIRKRTL---ISIQCVSSV-IAYSFGIWINCAFRYL------GFAWRYPLSTHVALGIIL 295

Query: 241 -IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKV---TIEDPSIVAEMDTIMANV--ETE 294
            +    ++ ESP +L+++    D +  +  SN       E+     +   +  ++  ++ 
Sbjct: 296 NLMSFYLILESPSWLLKQK--NDVEALVLISNVFDDGNFEENQTQLKFRVLKRDILLKSH 353

Query: 295 RLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVG---MKDSF 351
               +  +  +  +  +I+ ++++G   Q L +  G + F YY   I   +G    K  +
Sbjct: 354 LQKNSYPYAYILKDFSSII-KLLIG--FQLLTRTNGVDAFLYYSPLILQQMGRGERKSIY 410

Query: 352 QT---SIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGK 408
            T   +++  IV  A  +V L    +  +   LLG   S+ +C ++F T+  T  +P   
Sbjct: 411 LTGLNALIYSIVILA--YVPLVLRKRKEKTNVLLG---SIVMCALLF-TISFTDWFP--- 461

Query: 409 DQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGF 468
                K+    + +   +F+F   ISW  I +V+  E  P   +   + +     WI+ +
Sbjct: 462 -----KSTTRYISILFAVFLFTHFISWDSIGWVMTIELLPHLSQAPVILLVSNFYWIFKW 516

Query: 469 LIGFFTPFITSAIGFSY 485
            +   TP +   + + +
Sbjct: 517 FVSLITPILIDRLSWKF 533

>KLLA0F13684g complement(1267367..1269082) similar to sp|Q04301
           Saccharomyces cerevisiae YMR088c, start by similarity
          Length = 571

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 102/263 (38%), Gaps = 36/263 (13%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIA-AYWTVICLCLMIAFGGF 68
            S  + T + S  I      DE  ++      N  LP  PI  + W           G F
Sbjct: 3   HSTDETTRLLSNRITSS-SADEDDLEEMYHRHNLALPKGPILYSLW----------MGSF 51

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLG 128
           +   D+  ++  +N+      F +         SD +  ++        AF  L  G+L 
Sbjct: 52  LGSLDSTIVANIMNKV--AEEFEE---------SDKKQWIVTSFLLTNTAFQPL-YGKLS 99

Query: 129 DMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAP 188
           D+ GR+  LM     ++VG +   A S    ++ I R + GMG GGI+ LS   +S+   
Sbjct: 100 DLAGRKTALMVAHSFFLVGCLFT-ALSRNLVEFSIARAVCGMGAGGISALSSISVSDICT 158

Query: 189 KHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWR------VPLGLNFAFAIFMIA 242
              RG    +  ++   G  LG        D   S  W+      VPL +   F  +   
Sbjct: 159 PKERGVYQGYANVVFGTGSMLGGPIGGWLMD---SFGWKVIFAGQVPLIMTCMFLGYRNV 215

Query: 243 GMLMVPESPRFLVEKGRYEDAKR 265
            + ++   PR   E+ R+E+ KR
Sbjct: 216 NIKLLHVPPRH--ERYRWENIKR 236

>Scas_105.1
          Length = 56

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 22/27 (81%)

Query: 506 ETKGLTLEEVNEMYVEGVKPWKSGSWI 532
           ETKGL+LEEVN M+ EGV PWKS  W+
Sbjct: 2   ETKGLSLEEVNTMWEEGVLPWKSSEWV 28

>KLLA0F10043g complement(928691..930277) weakly similar to sp|P36035
           Saccharomyces cerevisiae YKL217w JEN1 carboxylic acid
           transporter protein singleton, start by similarity
          Length = 528

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 96/251 (38%), Gaps = 24/251 (9%)

Query: 33  PIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGF---VNQTDFKRR 89
           P +        E P  P  A  ++  L       GF+  W    +  F   +N T+  + 
Sbjct: 50  PTKASIREARKEYPINPFPALRSMNWLQTQYFIVGFL-AWTWDALDFFAVSLNMTNLAKD 108

Query: 90  FGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIV 149
             +   D ++ ++ V    ++G          L  G LGD YGR+      VL   + IV
Sbjct: 109 LDRPVKDISHAITLVLLLRVIG---------ALIFGYLGDRYGRKYSF---VLTMALIIV 156

Query: 150 IQIASS-DKWYQYFIG-RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGI 207
           IQI +     +  F+G R I G+ +G +  ++     E AP   +      +Q     G 
Sbjct: 157 IQIGTGFVNSFSAFLGCRAIFGIIMGSVFGVASATALENAPNKAKSILSGIFQEGYAFGY 216

Query: 208 FLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYE----DA 263
            LG        D S    WR     +    +  IA  LM+PES  + VE+ R E    D 
Sbjct: 217 LLGVVFQRAIVDNSPH-GWRAIFWFSAGPPVLFIAWRLMLPESQHY-VERVRLEKLENDG 274

Query: 264 KRSLAKSNKVT 274
           K    K+ K+ 
Sbjct: 275 KSQFWKNAKLA 285

>Kwal_47.18976
          Length = 534

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 100/247 (40%), Gaps = 23/247 (9%)

Query: 33  PIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGF---VNQTDFKRR 89
           P + K    +A+ P  P  A   +          GF+  W    +  F   +N  +  + 
Sbjct: 42  PTREKLREAHAQYPINPFPALSHMNAKQTQFFIVGFL-AWTWDALDFFAVSLNMAEIAKD 100

Query: 90  FGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIV 149
             +   D ++ ++ V    ++G          +  G LGD YGR++   C+ +V IV  V
Sbjct: 101 LDKSIKDMSHAITLVLLLRVIG---------AIIFGYLGDRYGRKVP-YCISMVLIV--V 148

Query: 150 IQIASS-DKWYQYFIG-RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGI 207
           +QI +   K +  F+G R + G+ +G I  ++     E AP+  +      +Q    LG 
Sbjct: 149 VQIGTGFVKSFPAFLGCRALFGIVMGSIFGVASATALEDAPQESKSILSGIFQEGYALGY 208

Query: 208 FLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSL 267
            LG        D S S  WR     +    +  I   L++PES  +     R    ++ L
Sbjct: 209 LLGVVFKRAIVDNS-SHGWRAFFWFSAGPPVLFIVWRLLLPESEAYT----RRTTEEKRL 263

Query: 268 AKSNKVT 274
           A+S + T
Sbjct: 264 AESEERT 270

>YML123C (PHO84) [3849] chr13 complement(24038..25801) High-affinity
           inorganic phosphate/H+ symporter, member of the
           phosphate:H[+] symporter (PHS) family of the major
           facilitator superfamily (MFS) [1764 bp, 587 aa]
          Length = 587

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 99/486 (20%), Positives = 185/486 (38%), Gaps = 108/486 (22%)

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG-----RIIS 168
           ++G   G    G L D+ GR+      +++ IV  ++Q   +      F+      RI+ 
Sbjct: 112 SVGTVIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVAVLTFYRIVM 171

Query: 169 GMGVGGIAVLSPTLISETAPKHIRGTCV-------SFYQL---MITLGIFLGYCTNYGTK 218
           G+G+GG   LS  + SE A    RG  +       ++ Q+   +I L +   Y    G  
Sbjct: 172 GIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILVAAY---KGEL 228

Query: 219 DYSNS-------------VQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVE-KGRYEDAK 264
           +Y+NS               WR+ +GL     +  +   L +PESPR+ ++   + E A 
Sbjct: 229 EYANSGAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRYQLDVNAKLELAA 288

Query: 265 RSLAKSNKVTIEDPS----IVAEMDTIMANVET-ERLAGNASWGELFSNKGA-ILPRVIM 318
            +  +  +  I D S     +  ++     VE+ +     AS+ +   + G     ++++
Sbjct: 289 AAQEQDGEKKIHDTSDEDMAINGLERASTAVESLDNHPPKASFKDFCRHFGQWKYGKILL 348

Query: 319 GIMIQSLQQLTGNNYF----FYYGTTIFNAV--------GMKDSFQ--------TSIVLG 358
           G         T  ++F     +YG ++ +AV        G K+ ++          I++ 
Sbjct: 349 G---------TAGSWFTLDVAFYGLSLNSAVILQTIGYAGSKNVYKKLYDTAVGNLILIC 399

Query: 359 IVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGN 418
             +    +V+++TVD  GR+   L G     I   +F  +G              K   +
Sbjct: 400 AGSLPGYWVSVFTVDIIGRKPIQLAG---FIILTALFCVIGFA----------YHKLGDH 446

Query: 419 VMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAI--------AVGANWIWGFLI 470
            ++    +  FF         +++  E +P R ++ A  I        A+ A    G LI
Sbjct: 447 GLLALYVICQFFQNFGPNTTTFIVPGECFPTRYRSTAHGISAASGKVGAIIAQTALGTLI 506

Query: 471 GF-----------FTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEEVNEMY 519
                        + P +         ++ +G              ETK  TLEE+NE+Y
Sbjct: 507 DHNCARDGKPTNCWLPHVMEIFAL---FMLLGIFTTLLIP------ETKRKTLEEINELY 557

Query: 520 VEGVKP 525
            + + P
Sbjct: 558 HDEIDP 563

>Scas_626.1
          Length = 570

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 105/504 (20%), Positives = 182/504 (36%), Gaps = 140/504 (27%)

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG-----RIIS 168
           ++G   G +  G + D+ GR+      +++ IV  V+Q  + +     F+      RI+ 
Sbjct: 98  SVGTVIGQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAINFVAVLTFYRIVM 157

Query: 169 GMGVGGIAVLSPTLISETAPKHIRGT----------------------CVSFYQLMITLG 206
           G+G+GG   LS  + SE A    RG                       CV+ Y+  +   
Sbjct: 158 GIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAAGIVALVCVAAYKDQLIGA 217

Query: 207 IFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM---LMVPESPRFLVEKGRYEDA 263
                C     K  +    WR+ +GL    A+  +AG+   L +PESPR+ ++       
Sbjct: 218 ETAEMCGPDCMK--ACDQMWRILVGLG---AVPGLAGLYFRLTIPESPRYTLD------- 265

Query: 264 KRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQ 323
                              E +   A+ + E+   +++  E  S+   I P     +M+Q
Sbjct: 266 ------------------VETNAAQASEDIEKFVTSSTLLEKNSSHSHISPNSQETLMVQ 307

Query: 324 ----SLQQLTGNNYFFYYGTTIFNAVG---MKD------SFQTSIVLGIVNFAST----- 365
               S +    +   + YG  +    G   M D      S  T+++L  + +A +     
Sbjct: 308 PPKASFKDFCRHFGQWRYGKILLGTAGSWFMLDVAFYGLSLNTAVILQAIGYAGSENVYK 367

Query: 366 ---------------------FVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLY 404
                                +V+++TVD  GR+   L G     I  V+F  +G     
Sbjct: 368 KLYNSAVGNLILICAGSLPGYWVSVFTVDTIGRKPIQLFG---FFILTVLFCIIGF---- 420

Query: 405 PNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAI------ 458
               D+ S K    + IV  C F   F  +     +++  E +P R ++ A  I      
Sbjct: 421 --AYDKLSDKGLLGLYIV--CQFFQNFGPNVT--TFIVPGECFPTRYRSTAHGISAASGK 474

Query: 459 --AVGANWIWGFLIGF-----------FTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXC 505
             A+ A    G LI             + P +         ++ +G              
Sbjct: 475 IGAIIAQTALGTLINHNCARDGKKANCWLPHVMEIFAL---FMLLGIFLTLLIP------ 525

Query: 506 ETKGLTLEEVNEMYVEGVKPWKSG 529
           ETK +TLE+++E Y + V P K G
Sbjct: 526 ETKRMTLEDISEKYHDEVDPSKFG 549

>Sklu_2253.3 , Contig c2253 3254-4825 reverse complement
          Length = 523

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 67/152 (44%), Gaps = 9/152 (5%)

Query: 120 GGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASS-DKWYQYFIG-RIISGMGVGGIAV 177
           G L  G LGD YGR+I   C+ ++ I   +IQI +   K +  F+G R + G+ +G +  
Sbjct: 125 GALIFGYLGDRYGRKIP-YCISMLLIC--IIQIGTGFVKSFPAFLGCRAVFGIVMGSVFG 181

Query: 178 LSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFA 237
           ++     E AP+  +      +Q     G  LG        D S S  WR     +    
Sbjct: 182 IASATSLENAPEESKSILSGIFQEGYAFGYLLGVVFQRAIVDNS-SHGWRAMFWFSSGPP 240

Query: 238 IFMIAGMLMVPESP---RFLVEKGRYEDAKRS 266
           I  IA  L++PES    R   E+ R  +  +S
Sbjct: 241 ILFIAWRLLLPESEAYTRRKAEEKRVTNGTKS 272

>Kwal_56.23754
          Length = 589

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 7/152 (4%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G+L D  GR+  L+   +V+ +G +I   S+  W+   +GR +SG+G  G+  L+  +IS
Sbjct: 138 GKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWW-VVVGRFVSGIGGCGLTCLASMVIS 196

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGM 244
           +  P   R         +  LG   G       +D+  +   + P+ L    +  +I   
Sbjct: 197 DLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQDWRMAFTIQCPISLA---SCALIVSY 253

Query: 245 LMVPESPRFLVEKGRYEDAK-RSLAKSNKVTI 275
           L +P  PR   +K R+  +K R L  +  VT+
Sbjct: 254 LELP--PRHEDDKDRHWTSKLRDLDWAGVVTL 283

>Sklu_2304.5 , Contig c2304 8691-10388
          Length = 565

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 104/251 (41%), Gaps = 39/251 (15%)

Query: 13  SQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGW 72
           S +T+    P++    T+ + + T  E T +     P     TV+ L +    G F+   
Sbjct: 2   SDETAALLVPVISP-TTETALVDTGEESTTSHSELPPTKVRITVLALLM----GSFLSAL 56

Query: 73  DTGTISGFVNQ--TDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDM 130
           DT  ++  +    +D      QM    T YL             + C+      G+L D+
Sbjct: 57  DTTIVATLLPTIASDLDAS-SQMSWIATAYL-------------LSCSAFQPLYGKLSDI 102

Query: 131 YGRRIGLMCVVLVYIVGIVIQIAS-SDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPK 189
           +GR+I L+   L + +G  I  +  ++  +    GR ++G+G GG A LS    S+  P 
Sbjct: 103 FGRKILLILSNLTFALGCAICGSPWTNNVWVLSTGRFVAGIGGGGQATLSTITTSDIIPL 162

Query: 190 HIRGTCVSFYQLMITLGIFLGYCTNYGT--KDYSNSVQWR------VPLGLNFAFAIFMI 241
             RG     YQ ++ +   LG C +           + WR      VP+ L  A    MI
Sbjct: 163 RKRGV----YQGLVNICFSLG-CASGSVLGAVLQQGIGWRWAFLVQVPMALVCA---LMI 214

Query: 242 AGMLMVP-ESP 251
           A +L +P +SP
Sbjct: 215 AVVLDLPADSP 225

>Sklu_1567.2 YPR198W, Contig c1567 1150-2859
          Length = 569

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 4/123 (3%)

Query: 105 RTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG 164
           + G ++  +++  A   L  GR   ++G +  LM  ++++ +G ++ IA S+       G
Sbjct: 56  KIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLV-IAVSNSMDMIIGG 114

Query: 165 RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSV 224
           R+I+G G  GI  L   + +    +H RGT V+   L   +   LG        +Y   V
Sbjct: 115 RVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEY---V 171

Query: 225 QWR 227
            WR
Sbjct: 172 TWR 174

>Scas_660.3
          Length = 568

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 84/214 (39%), Gaps = 27/214 (12%)

Query: 22  PIVQKLETDESPIQTKSEYT--NAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISG 79
           PI   +E  E     + +Y   N  LP  PI          L +  G F+   D+  ++ 
Sbjct: 12  PIRSSIEDGEEDNGLEEQYHEYNLSLPKFPI---------LLSLWLGSFLSSLDSTIVAN 62

Query: 80  FVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMC 139
            +N+      F +         SD +  +         AF  L  G+L D+ GR+  ++ 
Sbjct: 63  IMNKV--AEEFEE---------SDKKQWIATSFLLTNTAFQPL-YGKLSDITGRKFAVLT 110

Query: 140 VVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFY 199
               + +G  +   + +   Q+ I R I G+G GG+  +S   +S+      RG    + 
Sbjct: 111 SHFFFGLGCFLTCFAQNI-TQFSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQGYA 169

Query: 200 QLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
            ++  LG  LG         + +SV WRV  G+ 
Sbjct: 170 NIVFGLGQLLGAPLG---GLFIDSVGWRVIFGVQ 200

>CAGL0J01375g 127843..129537 similar to sp|Q04301 Saccharomyces
           cerevisiae YMR088c, start by similarity
          Length = 564

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 83/205 (40%), Gaps = 25/205 (12%)

Query: 29  TDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKR 88
           T++  ++ +    N  LP  PI          L +  G F+   D   ++  +N+     
Sbjct: 18  TEQDALEQEYHEHNLSLPKLPIV---------LSLWLGSFLSSLDGTIVANIMNRV--AE 66

Query: 89  RFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGI 148
            F +         SD +  +         AF  L  G+L D+ GR+  ++     + +G 
Sbjct: 67  EFQE---------SDKKQWIATSYLLTNTAFQPL-YGKLSDLTGRKFAVLTAHFFFGLGC 116

Query: 149 VIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIF 208
           ++    ++   Q+ I R I G+G GGI  +S   +S+   +  RG    +  ++  LG  
Sbjct: 117 LLT-CFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYANIVFGLGQI 175

Query: 209 LGYCTNYGTKDYSNSVQWRVPLGLN 233
           LG         + +++ WR+  GL 
Sbjct: 176 LGAPIG---GLFIDTLGWRILFGLQ 197

>Sklu_1959.3 , Contig c1959 3851-5446 reverse complement
          Length = 531

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 62/158 (39%), Gaps = 2/158 (1%)

Query: 120 GGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLS 179
           G +  G +GD YGR++  +  +   +V  +I       +  + I R   G+ +GGI   S
Sbjct: 126 GAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFIKHNFKYFLIARAFFGVVLGGIFGNS 185

Query: 180 PTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIF 239
                +  P         F+Q   TLG  L         D +   +WR            
Sbjct: 186 AAQCFDDCPPEAHSFISGFFQQGYTLGYLLAVIFTRALADTTKD-RWRSCFWFAAGITFL 244

Query: 240 MIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED 277
           +I    ++PE+  FL E+ R +  K+   + +  T ++
Sbjct: 245 LIIFRALLPETNAFL-ERQRIKAEKKLNNEDDDHTFKE 281

>Scas_694.19
          Length = 581

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 104/258 (40%), Gaps = 36/258 (13%)

Query: 1   MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC 60
           +S   T  ++  S Q+S          E +E   ++ S YT      K     W ++ L 
Sbjct: 50  LSRATTREIDGDSLQSSDE--------EKNEQASESTSPYTLLTYKQK-----WGMVALL 96

Query: 61  LMIAFGGFVFGWDT-GTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAF 119
            M  F      W + G+   +      +++FG         L + +  + V ++ +    
Sbjct: 97  TMCGF------WSSLGSPIYYPALRQLEKQFG---------LDENKVNVTVVVYLLFQGI 141

Query: 120 GGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLS 179
                G L D++GRR  ++  +L+Y+V   I +A +  +      RII  +G+     +S
Sbjct: 142 APTISGGLADVFGRRPVILIGMLIYVVA-SIGLACAPSYGVIVFLRIIQSIGISPTIAIS 200

Query: 180 PTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSN--SVQWRVPLGLNFAFA 237
             ++ +   KH RGT V     ++ LG   G           N  ++ W + +G   +F 
Sbjct: 201 SGVVGDFTLKHERGTFVGATSGLVLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSF- 259

Query: 238 IFMIAGMLMVPESPRFLV 255
              I   L++PE+ R LV
Sbjct: 260 ---IIAFLLLPETKRTLV 274

>Kwal_26.6669
          Length = 590

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 117 CAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIA 176
           CA      G+  D++GR+  L+   L++  G +    S   W+   +GR+++G+G GG+ 
Sbjct: 129 CAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWW-LILGRLVTGIGGGGLT 187

Query: 177 VLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAF 236
            +   +I++  P   R     F  L   LG   G        +Y N   WR+   +   F
Sbjct: 188 SMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNG--WRMAFMIQLPF 245

Query: 237 A 237
            
Sbjct: 246 C 246

>Kwal_33.15241
          Length = 580

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 73/172 (42%), Gaps = 19/172 (11%)

Query: 43  AELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLS 102
           +E P  P+   W+V+   L  A   F        I+ F   T       Q   +  Y +S
Sbjct: 49  SESPNDPLN--WSVMRKTLHFALMAF--------ITAFTAATSNDAGAAQYNLNEEYGIS 98

Query: 103 DVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIG-LMCVVLVYIVGIVIQIASSDK---W 158
                   G+  +G  +G L L  L ++YGR+I  L+C+ L  I  +    ++  +   W
Sbjct: 99  YDSMNTGAGVLFLGIGWGTLFLAPLANLYGRKITYLICISLGLIGAVWFGFSTRTRDTIW 158

Query: 159 YQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLG 210
            Q F+G  IS         LS   +S+   +H  G+ ++ Y L  ++G FLG
Sbjct: 159 SQLFVG--ISESCAEAQVQLS---LSDIFFQHQLGSVLTVYILATSVGTFLG 205

>Kwal_26.7984
          Length = 612

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 82/198 (41%), Gaps = 26/198 (13%)

Query: 6   TSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAF 65
           T+ V+SG+ QT+       + +  +  P ++  +  N  +  + IA         L++ +
Sbjct: 41  TAAVDSGTMQTT------KKGIILNPQPSESMRDPLNWPVWRRDIA--------LLVVGW 86

Query: 66  GGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLG 125
             FV G  T  ++           F +  SD +Y         +VG   +  AFG +   
Sbjct: 87  HCFVGGGQTSILAA--GSRSLAEEFNRSLSDISY---------LVGGMMLALAFGSIIAS 135

Query: 126 RLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISE 185
               ++G+RI  +  ++V+  G  I  + S  +      RI+SG+GV  I  L    ++E
Sbjct: 136 PSAVLFGKRILYLIGIIVFFFG-SIGCSVSHSYESLLASRIVSGLGVATIESLPSATVAE 194

Query: 186 TAPKHIRGTCVSFYQLMI 203
               H R   +  Y L++
Sbjct: 195 IYFAHERAYRLGVYTLLL 212

>KLLA0C19459g 1746987..1747436 some similarities with
           ca|CA3241|IPF7493 Candida albicans putative permease (by
           homology), hypothetical start
          Length = 149

 Score = 37.4 bits (85), Expect = 0.008,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFV 69
           +S S Q    ++ I  K+  ++   + +    + E P  P    WT+    L+    G  
Sbjct: 20  DSQSVQDDDQASQITPKIAAEKKKFRWR--VVDNESP--PEVYNWTLYMSILIFGILGAA 75

Query: 70  FGWDTGTISGFVNQTDFKRRFGQM-KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLG 128
            G+D G +SG V Q  F+ +FG   K+    YL+++++  I  +  +G   G L      
Sbjct: 76  RGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN-ITSMVQLGSIGGTLIAMYTV 134

Query: 129 DMYGRRIGL--MCVV 141
           + +GR   L  +CV+
Sbjct: 135 EKFGRIKALQGVCVL 149

 Score = 32.7 bits (73), Expect = 0.32,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 58/136 (42%), Gaps = 17/136 (12%)

Query: 259 RYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIM 318
           +YE+  +S+   ++ +   P I AE           R+  N S  E++ N    +  +I 
Sbjct: 16  QYENDSQSVQDDDQASQITPKIAAEKKKFRW-----RVVDNESPPEVY-NWTLYMSILIF 69

Query: 319 GIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQT--------SIVLGIVNFAS---TFV 367
           GI+  +     GN        +  N  G+ D  ++        S +  +V   S   T +
Sbjct: 70  GILGAARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSNITSMVQLGSIGGTLI 129

Query: 368 ALYTVDKFGRRKCLLG 383
           A+YTV+KFGR K L G
Sbjct: 130 AMYTVEKFGRIKALQG 145

>AGR076C [4386] [Homologous to ScYDR119W - SH] (871570..873630)
           [2061 bp, 686 aa]
          Length = 686

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G+L D++GRR  L+   LV+ +G +I   S + W    +GR ++G+G GG+  +     +
Sbjct: 196 GKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV-LVLGRFVAGIGGGGLTSMCSITTT 254

Query: 185 ETAPKHIR----GTCVSFYQLMITLGIFLG 210
           +  P   R    G C  F+ L    G  +G
Sbjct: 255 DIVPLRSRALYQGICNVFFGLGTACGGLVG 284

>KLLA0E09614g 853845..855602 highly similar to sp|P53389
           Saccharomyces cerevisiae YNR055c HOL1 member of major
           facilitator superfamily multidrug-resistance protein
           subfamily 1, start by similarity
          Length = 585

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 9/104 (8%)

Query: 111 GIFNIGCAFGGLTLGRLGDMYGRRIG-LMCVVLVYIVGIVIQIASSDK---WYQYFIGRI 166
           G+  +G  +  L L    ++YGR+I  L+C+ L  +  +   +ASS K   W Q F+G  
Sbjct: 107 GVLFLGIGWATLFLAPFANLYGRKITYLICITLGLLGALWFALASSTKDTIWSQLFVG-- 164

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLG 210
           IS         LS   +++   +H  G+ ++ Y L  ++G FLG
Sbjct: 165 ISESCAEAQVQLS---LTDIYFQHQLGSVLTVYILATSIGTFLG 205

>Scas_713.17
          Length = 572

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 99/253 (39%), Gaps = 18/253 (7%)

Query: 7   SRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFG 66
           S + S ++   IH T     L   +S  + +    NA +P     +    I L L  AF 
Sbjct: 33  SSILSYNKPVHIHETSATADLCKTQSNKKDEPNLDNA-VPYSRFGSSEKTI-LVLQCAFT 90

Query: 67  GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR 126
           GF       TI+G +            + +  +++S+    + V ++ I        +G 
Sbjct: 91  GFF-----STIAGAIYYPVLS------EIEEIFHISEESVNITVVVYFIFQGISPSIMGG 139

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           L D  GRR  ++C + VY     I +A    + Q  + R +   G+  +  ++  ++ + 
Sbjct: 140 LADTMGRRPIVLCSIAVYFCA-CIGLACCQTYPQIVVLRCLQAAGISPVIAINSGIMGDI 198

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLG-LNFAFAIFMIAGML 245
             +  RG  V +      +G   G     G    S++  WR     L     I +I   +
Sbjct: 199 TTRAERGGFVGYVSGFQVMGSAFGALIGAGI---SSTWSWRAIFWFLAIGSGICLIISFI 255

Query: 246 MVPESPRFLVEKG 258
           ++PE+ R +V  G
Sbjct: 256 ILPETKRTIVGNG 268

>KLLA0A04631g complement(415070..416809) similar to
           ca|CA1324|IPF6676 Candida albicans polytopic membrane
           protein involved in drug transport (by homology), start
           by similarity
          Length = 579

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G++ D++GRR  ++   L +I+G +I   S + W     GR I+G+G GG+  L     S
Sbjct: 117 GKISDIFGRRPLIIISNLFFILGCLICGLSKNLW-TLVAGRFIAGIGGGGVTSLGSITAS 175

Query: 185 ETAPKHIRG 193
           +  P   R 
Sbjct: 176 DIVPLRSRA 184

>CAGL0B02475g 236029..237771 highly similar to sp|P25297
           Saccharomyces cerevisiae YML123c PHO84, start by
           similarity
          Length = 580

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 93/229 (40%), Gaps = 38/229 (16%)

Query: 114 NIGCAFGGLTLGRLGDMYGRR--IGLMCVVLVYIVGIVIQIASSD--------KWYQYFI 163
           ++G   G L  G + D+ GR+   GL  +V++    +   I  S          +Y    
Sbjct: 113 SVGTVIGQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGINFPAVLTFY---- 168

Query: 164 GRIISGMGVGGIAVLSPTLISETAPKHIRGTCV-------SFYQL------MITLGIFLG 210
            RI+ G+G+GG   LS  + SE A    RG  +       ++ Q+      +I +  + G
Sbjct: 169 -RIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQIAGGLVALIVIRAYKG 227

Query: 211 ---YCTNYGTKDYSN----SVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDA 263
              Y  +    DY+        WR+ +G      I  +   L +PESPR+ ++     D 
Sbjct: 228 DLIYANSGAECDYACQKACDQMWRILIGFGAVPGIIGLYFRLTIPESPRYALDVKEEVDL 287

Query: 264 KRSLAKSNKVTIEDPSI--VAEMDTIMANVETERLAGNASWGELFSNKG 310
             ++ K  + T +D  +  +    T++ +         ASW +  S+ G
Sbjct: 288 PSNIEKV-RATADDEHLEDLERSSTVVEDGIVVPPPKKASWKDFRSHFG 335

>Scas_692.8
          Length = 625

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 92/493 (18%), Positives = 178/493 (36%), Gaps = 123/493 (24%)

Query: 114 NIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG-----RIIS 168
           ++G   G +  G + D+ GR+      +++ I+  ++Q  +       F+      RI+ 
Sbjct: 146 SVGTVIGQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGINFVAVLTFYRILM 205

Query: 169 GMGVGGIAVLSPTLISETAPKHIRGTCV-------SFYQLM---ITLGIFLGYCT----- 213
           G+G+GG   LS  + SE +    RG  +       ++ Q++   I L +   Y +     
Sbjct: 206 GIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQILGGIIALVLVAAYKSSLIDA 265

Query: 214 NYGTKDYSNSVQ-----WRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLA 268
           N G +     ++     WR+ +GL     +  +   L +PESPR+ ++     DA     
Sbjct: 266 NTGAECGYECMKACDQMWRILIGLGAVPGVIGLYFRLTIPESPRYSLDV----DADLDSI 321

Query: 269 KSNKVTIEDPSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQL 328
           +  KVT               NV  E+L  +AS          ++ R+ +     S +  
Sbjct: 322 EVTKVT--------------DNVMEEKLGDSAS----LERANTMVERIEIQPPKVSFKDF 363

Query: 329 TGNNYFFYYGTTIFNAVGM---------KDSFQTSIVLGIVNFAST-------------- 365
             +   + YG  +    G            S  T+++L  + +A +              
Sbjct: 364 CHHFGQWKYGKILLGTAGCWFTLDVAFYGLSLNTAVILQTIGYAGSSNVYKKLYDSAVGN 423

Query: 366 ------------FVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSS 413
                       + +++T+D  GR+   + G     I  ++F  +G              
Sbjct: 424 LILICAGSLPGYWASVFTIDTIGRKPIQMFG---FIILTILFCVIGFA----------YH 470

Query: 414 KAAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAI--------AVGANWI 465
           K +G+ ++    +  FF         +++  E +P R ++ A  I        A+ A   
Sbjct: 471 KISGHGLLGLYVICQFFQNFGPNVTTFIVPGECFPTRYRSTAHGISAASGKIGAIIAQTA 530

Query: 466 WGFLIGF-----------FTPFITSAIGFSYGYVFMGCLXXXXXXXXXXXCETKGLTLEE 514
            G LI             + P +         ++ +G              ETK +TLEE
Sbjct: 531 LGTLINHNCARDGKKANCWLPHVMQIFAL---FMLLGIFLTLLIP------ETKRMTLEE 581

Query: 515 VNEMYVEGVKPWK 527
           ++E Y + + P K
Sbjct: 582 ISEKYHDEIDPSK 594

>KLLA0E03729g 349784..351613 similar to sgd|S0006360 Saccharomyces
           cerevisiae YPR156c, start by similarity
          Length = 609

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 78/195 (40%), Gaps = 11/195 (5%)

Query: 91  GQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVI 150
           G    +  +++S     L   +  IG + G L    + D+YGRR+     + +Y++   I
Sbjct: 190 GLFTVEEKFHVSQEVAILSCSLMVIGFSLGPLIWSPVSDLYGRRVAYFISLGLYVI-FNI 248

Query: 151 QIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLG 210
             A +       + R + G+       L    I++  P   RG  ++F+      G   G
Sbjct: 249 PCALAKNIGTLLVCRFLCGVWSSSGLCLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFG 308

Query: 211 YCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKS 270
              N      +N +   +   +N AFA  M   +  +PE+   ++ K R        AK 
Sbjct: 309 PLVNGFIAISTNRMD--LIFWVNMAFAGVMWIIVSCIPETYAPVILKKR--------AKR 358

Query: 271 NKVTIEDPSIVAEMD 285
            ++ + +P I+ E +
Sbjct: 359 LRIELNNPKIMTEQE 373

>KLLA0E14652g 1302073..1303992 similar to sp|P38724 Saccharomyces
           cerevisiae YHL047c TAF1 siderophore transporter for
           triacetylfusarinine C, hypothetical start
          Length = 639

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 76/180 (42%), Gaps = 26/180 (14%)

Query: 10  ESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFV 69
           E   +Q  +    +  KL  + S +  K E    +        Y +V  +C+ + F  F+
Sbjct: 40  EENHKQELLDEYGVPDKLRANRSLVIRKMEIMRKQ--------YTSVFAICVFL-FTAFL 90

Query: 70  FGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLI---VGIFNIGCAFGGLTL-G 125
            G  T   S   N               TY  +  R+  +   +G+ +   + G LT+  
Sbjct: 91  AGVGTDLNSQLRNNYT------------TYATNSYRSHSLLSTIGVVSSIISAGALTVYA 138

Query: 126 RLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISE 185
           RL D++GR    +  +L ++VG +IQ + ++   +Y  G +   +G  GI V+   ++S+
Sbjct: 139 RLSDVFGRIRLYLSAMLFFVVGTIIQ-SQANNVQKYAAGTVFYSLGTAGIQVMMFIIMSD 197

>CAGL0G08624g complement(811931..813682) similar to sp|P40474
           Saccharomyces cerevisiae YIL121w, hypothetical start
          Length = 583

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 70/165 (42%), Gaps = 7/165 (4%)

Query: 96  DGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASS 155
           +  +++++    + V ++ I        +G L D  GRR  ++  V VY  G  I +A +
Sbjct: 109 EKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPVVLFAVTVYF-GACIGLACA 167

Query: 156 DKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY 215
             + Q  + R +   G+  +  ++  +I +   +  RG  V +      LG   G     
Sbjct: 168 QTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAERGGYVGYISGFQVLGSAFGALIGA 227

Query: 216 GTKDY--SNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKG 258
           G        S+ W + +G      + ++  ++M+PE+ R +V  G
Sbjct: 228 GLSSRWGWRSIFWFLAIG----SGVCLVFSIIMLPETKRTIVGNG 268

>Kwal_33.15638
          Length = 535

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 119/290 (41%), Gaps = 52/290 (17%)

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSI-VAEMDTIMANVE 292
           F F +F+I     V ESPRF + +G  E A  +L K  K+  ++ +I + +++ I A   
Sbjct: 246 FTFLLFVIRFAFNVFESPRFHISRGDNEAAVATLYKIAKINGKETTITLDDLNKIDARYG 305

Query: 293 TE-----RLAGNASWGELFSNKGAILP----RVIMGIMIQSLQQ--------LTG----- 330
           T      +  G  S  ++F N  A       RV+ G   Q+           + G     
Sbjct: 306 TPIDLGVKENGLLSRKQVFKNSLAEFRLERVRVVFGSRKQAYSSSLVIFVWAIIGLAFPL 365

Query: 331 -NNYFFYYGTTIFNA---VGMKDSFQTSIVLGIVNFASTFVA-LYTVDKFGRRKCLLGGS 385
            N +   Y +   NA   + +  +++ S+++ ++      +A ++   + GR+  L   S
Sbjct: 366 YNAFLPTYLSERGNANQPLSVALTYRNSLIIALMGIPGAIIAGIFIETRLGRKGTL---S 422

Query: 386 ASMAICFVIF--STVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIAYVIV 443
            SM I  VI   ST   TS               N  + + C F     I +  + Y   
Sbjct: 423 LSMIITGVILYGSTTAKTS---------------NSYLGWNCGFNITSNIVYG-VLYAYT 466

Query: 444 AESYPLRVKNRAMAIAVGANWIWGF---LIGFFTPFITSAIGFSYGYVFM 490
            E +P +V+   + +A  AN + G    +IG +    TSA  F  G +F+
Sbjct: 467 PEIFPTKVRGTGVGLAASANRVLGIFSPVIGMYANLATSAPIFVSGALFI 516

>CAGL0B02079g complement(191736..193610) similar to sp|P50080
           Saccharomyces cerevisiae YGR224w AZR1 or sp|P36172
           Saccharomyces cerevisiae YKR105c, hypothetical start
          Length = 624

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 92/216 (42%), Gaps = 42/216 (19%)

Query: 57  ICLCLMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIG 116
           + LCL +A        D  T+S  + +    ++FG     G  +     TG     +++ 
Sbjct: 49  LVLCLFLA------ALDVMTVSTIIEEV--SQKFGDYSKVGWLF-----TG-----YSLP 90

Query: 117 CAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIA 176
            A   L  GR+  + G +   +  ++++ VG ++  A ++       GR+I+G+G  G+ 
Sbjct: 91  NALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVS-ALANSMDMLIGGRVIAGIGGSGVQ 149

Query: 177 ----VLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWR----- 227
               V+S TL+ E     I     S + +   +G FLG         ++  V WR     
Sbjct: 150 SLVFVISSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGA-------FTTHVTWRWCFYI 202

Query: 228 -VPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYED 262
            +P+G   AF +F+       PE  +++V K   ED
Sbjct: 203 NLPVG-GLAFFLFL---TFYNPE--KWVVNKDTAED 232

>KLLA0F17776g complement(1627198..1628859) similar to
           ca|CA1324|IPF6676 Candida albicans polytopic membrane
           protein involved in drug transport (by homology), start
           by similarity
          Length = 553

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDK-WYQYFIGRIISGMGVGGIAVLSPTLI 183
           G+L D++GR+  L+   L +  G ++  A   K  +   IGR I+G+G GG+  LS    
Sbjct: 88  GKLSDVFGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITT 147

Query: 184 SETAPKHIRG 193
           S+  P   RG
Sbjct: 148 SDIIPLRQRG 157

>Sklu_2348.2 YIL121W, Contig c2348 2640-4442 reverse complement
          Length = 600

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 70/165 (42%), Gaps = 7/165 (4%)

Query: 96  DGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASS 155
           +  + +S     + V ++ I      + +G L D  GRR  ++C + +Y V   I +AS+
Sbjct: 107 EEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCSIALYAVA-CIGLASA 165

Query: 156 DKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNY 215
             + +    R +   G+  +  ++  +I +   K  RG  +        +G   G     
Sbjct: 166 QNYGEVLFLRCLQSAGISPVVAVNNGIIGDITTKAERGGYLGLMAGTQVIGSAFGALIGA 225

Query: 216 G-TKDYS-NSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKG 258
           G T  +   ++ W + +G  F+ A+       ++PE+ R +V  G
Sbjct: 226 GITARWGWRAIFWFLAIGSGFSLAV----ASFLLPETKRTVVGNG 266

>ADL258W [1483] [Homologous to ScYNL065W (AQR1) - SH; ScYIL121W -
           SH] complement(247674..249278) [1605 bp, 534 aa]
          Length = 534

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 7/131 (5%)

Query: 127 LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET 186
           L D YGRR  ++  +L++IV   I IA S+ +      R I   G+  I  ++  ++ + 
Sbjct: 128 LADTYGRRPVILMGMLIFIVS-SIGIACSNSFALVIALRCIQSSGISPIIAINSGVVGDF 186

Query: 187 APKHIRGTCVSFYQLMITLGIFLGYCTNYG-TKDYS-NSVQWRVPLGLNFAFAIFMIAGM 244
             K  RGT +     +  LG   G       T  Y+  +V W + +G    F    +A  
Sbjct: 187 TLKSERGTFIGAVSGLTLLGQAFGSLIGASLTAAYNWRAVFWFMTIGCGVCF----LANF 242

Query: 245 LMVPESPRFLV 255
           L +PE+ R +V
Sbjct: 243 LFLPETHRCIV 253

>Sklu_1110.1 YDR119W, Contig c1110 22-1995
          Length = 657

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G++ D++GR+  L+   +++ +G +I   S   W     GR I+G+G GG+  +S    S
Sbjct: 185 GKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWC-LVAGRFIAGIGGGGLTSMSSITTS 243

Query: 185 ETAPKHIR----GTCVSFYQLMITLGIFLG 210
           +  P   R    G C  F+ L    G  +G
Sbjct: 244 DIVPLRNRALYQGICNFFFGLGTACGGLVG 273

>AFR322C [3514] [Homologous to ScYGR138C (TPO2) - SH; ScYPR156C
           (TPO3) - SH] (1017695..1019473) [1779 bp, 592 aa]
          Length = 592

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 5/164 (3%)

Query: 115 IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISG-MGVG 173
           +G   G L    L D+YGRRI     + +Y+V   I  A +       + R I G +   
Sbjct: 198 LGYGVGQLVWAPLSDLYGRRITYFTSLFLYVV-FNIPCAVAPNIQTLLVCRFICGVLSSS 256

Query: 174 GIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLN 233
           G+ ++  +L ++  P  +RG  ++F+      G       N      +  +     + + 
Sbjct: 257 GLCLVGGSL-ADMFPADLRGLTIAFFAFAPYGGPVFAPLINGFIAVRTERLDLIFWVNMA 315

Query: 234 FAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED 277
            A A++++    +VPE+   ++ K R E  ++     N +T ++
Sbjct: 316 LAGAVWLLVA--LVPETYAPIILKRRAEKLRKLTGNQNIMTEQE 357

>Kwal_14.1585
          Length = 570

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVI-QIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
           G+  D+ GR+  L+   +V+I+G+V+  +A + K  +  I R I G+G  G+  +   ++
Sbjct: 107 GKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVK--ELAIARAICGIGGSGLGAMCNIIL 164

Query: 184 SETAPKHIR 192
           S+ AP   R
Sbjct: 165 SDLAPLSQR 173

>Scas_713.30
          Length = 630

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 68/147 (46%), Gaps = 19/147 (12%)

Query: 105 RTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG 164
           +TG I   +++  A   L  GR+  + G +  ++  ++++ +G +I    ++       G
Sbjct: 114 KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLIS-GVANSMNMLIGG 172

Query: 165 RIISGMGVGGIAVLSPTLISETAPKHIRGTCV----SFYQLMITLGIFLGYCTNYGTKDY 220
           R+I+G+G  GI  L+  + S    +  RG  +    S + +   +G FLG         +
Sbjct: 173 RVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAVASVIGPFLG-------GAF 225

Query: 221 SNSVQWR------VPLGLNFAFAIFMI 241
           +    WR      +P+G   AFA+F++
Sbjct: 226 TTHATWRWCFYINLPVG-GVAFALFVV 251

>Sklu_2183.3 YCR098C, Contig c2183 6694-8208
          Length = 504

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 107/288 (37%), Gaps = 60/288 (20%)

Query: 115 IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDK-----WYQYFIGRIISG 169
           +G   G + +G   D  GR+  ++   L  ++G ++  AS        ++   + R ++G
Sbjct: 80  VGTILGQVFIGAACDYMGRKWSILVATLFLVIGTILCAASHGSTVPGMFWMLTVMRGVTG 139

Query: 170 MGVGGIAVLSPTLISETAPKHIR----GTCVSFYQLMITLG------IFLGYCTNYGTKD 219
            G+G     S    +E A +H      G  V    L ++LG      +FL   +  GTK 
Sbjct: 140 FGIGAEYPCSSVSANEAANEHSEKRRGGIMVLVTNLPLSLGGPFASIVFLVVYSICGTKH 199

Query: 220 YSNSVQWRV--PLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED 277
                 WR+   LG  +  ++F                   R++ A   L K   +    
Sbjct: 200 L--EALWRIMFALGCFWPLSVFYF-----------------RWKMATNELYKKGAIKNRV 240

Query: 278 PSIVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIM-GIMIQSLQQLTGNNYFFY 336
           P        ++     +RL G    G  F     + P  I  G +I S+           
Sbjct: 241 PY------WLVVKYCWKRLLGTC--GVWFIYDFVVFPNSIFSGTIISSV----------- 281

Query: 337 YGTTIFNAVGMKDSFQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGG 384
               I N   +K+  + +++LGI+     FV  +  D+ GR+  L+ G
Sbjct: 282 ----INNTTDLKEICEWNLLLGIIAIPGCFVGAWLCDRIGRKYTLMFG 325

>YMR088C (YMR088C) [4046] chr13 complement(443413..445101) Member of
           the multidrug-resistance 14-spanner (DHA14) family of
           the major facilitator superfamily (MFS-MDR) [1689 bp,
           562 aa]
          Length = 562

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G+L D+ GR+  L+     + +G ++   + +   ++ I R I G+G GG+  +S   +S
Sbjct: 92  GKLSDITGRKSALLTAQFFFGLGCLLTCFARNV-TEFSIARAICGIGAGGLNAISSIAVS 150

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLG 210
           +      RG    +  ++   G  LG
Sbjct: 151 DICTARERGVYQGYANIVFGFGQLLG 176

>YPR198W (SGE1) [5610] chr16 (934028..935659) Crystal violet
           resistance protein, member of the multidrug-resistance
           14-spanner (DHA14) family of the major facilitator
           superfamily (MFS-MDR) [1632 bp, 543 aa]
          Length = 543

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 19/146 (13%)

Query: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPT 181
           L  GRL ++ G +  LM  V+V+ +G +I  A S+       GR+++G G  GI  L+  
Sbjct: 61  LLWGRLAEILGTKECLMISVIVFEIGSLIS-ALSNSMATLISGRVVAGFGGSGIESLAFV 119

Query: 182 LISETAPKHIRGTCVSF----YQLMITLGIFLGYCTNYGTKDYSNSVQWR------VPLG 231
           + +    ++ RG  ++     Y +   +G F+G         ++  + WR      +P+G
Sbjct: 120 VGTSIVRENHRGIMITALAISYVIAEGVGPFIG-------GAFNEHLSWRWCFYINLPIG 172

Query: 232 LNFAFAIFMIAGMLMVPESPRFLVEK 257
             FAF I         P    +L  K
Sbjct: 173 -AFAFIILAFCNTSGEPHQKMWLPSK 197

>YIL120W (QDR1) [2556] chr9 (134414..136105) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1692 bp, 563
           aa]
          Length = 563

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 55/136 (40%), Gaps = 5/136 (3%)

Query: 124 LGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
           +G L D +GRR  ++  +L Y     I +A +  + Q    R +   G+  +  ++  ++
Sbjct: 125 MGGLADTFGRRPIVLWAILAYFCA-CIGLACAHNYAQILALRCLQAAGISPVIAINSGIM 183

Query: 184 SETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLG-LNFAFAIFMIA 242
            +   K  RG  V        +G   G     G    S+   WR     L     I ++ 
Sbjct: 184 GDVTTKVERGGYVGLVAGFQVVGTAFGALIGAG---LSSKWGWRAIFWFLAIGSGICLVF 240

Query: 243 GMLMVPESPRFLVEKG 258
             L++PE+ R LV  G
Sbjct: 241 STLLMPETKRTLVGNG 256

>Kwal_23.2794
          Length = 619

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 65/165 (39%), Gaps = 31/165 (18%)

Query: 9   VESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGF 68
           VE    +  +H   +  KL+  +S I  KSE     L AK   ++++     L      F
Sbjct: 27  VEKQCSKDVVHEHELPDKLQVTKSIIIRKSE-----LMAKQYDSWFSKSVFLLAAFICSF 81

Query: 69  VFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGC----AFGGLTL 124
            +G D+     ++                TY + D     ++   N+      A G +  
Sbjct: 82  AYGLDSIIRDIYM----------------TYAMDDYAEHSLLSTVNVVSLMISAVGQIFF 125

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISG 169
             L D++GR    +  ++ Y+VG +IQ  + D      +GR ++G
Sbjct: 126 AGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYD------VGRYVAG 164

>YCR023C (YCR023C) [557] chr3 complement(158533..160368) Member of
           the multidrug-resistance 12-spanner (DHA12) family of
           the major facilitator superfamily (MFS-MDR) [1836 bp,
           611 aa]
          Length = 611

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 49/107 (45%), Gaps = 5/107 (4%)

Query: 106 TGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGR 165
           +G +   F +         GR  + +GR+I L C ++   V ++I +  S  +YQ  + R
Sbjct: 61  SGYLSSSFALCQVISAYHWGRFSEKHGRKITLTCGLIGTSVSLLI-LGFSRNFYQALVAR 119

Query: 166 IISGMGVGGIAVLSPTLISE--TAPKHIRGTCVSFYQLMITLGIFLG 210
            + G+  G + V+  T+I E  T  KH +    S   L+   G  +G
Sbjct: 120 SLMGLLNGNVGVIR-TIIGEIATERKH-QALAFSTMPLLFQFGAVVG 164

>Scas_705.26
          Length = 614

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 118 AFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAV 177
           A   L   R  DM+GR   L   ++ Y++G +I+  + D   +Y  G  I  +G  GI +
Sbjct: 124 AAAQLWFARSADMFGRPTILTISIIFYVIGTIIECRAFDV-SRYAAGACIFSLGHAGIVL 182

Query: 178 LSPTLISETAPKHIRGTCVS 197
           +S   +++ +  + R T  +
Sbjct: 183 VSELYVADFSNLNWRVTAAA 202

>YDR119W (YDR119W) [966] chr4 (688221..690527) Member of the
           14-spanner drug:[H+] antiporter (DHA14) family of
           multidrug-resistance (MFS-MDR) proteins in the major
           facilitator superfamily (MFS) [2307 bp, 768 aa]
          Length = 768

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 64/148 (43%), Gaps = 8/148 (5%)

Query: 105 RTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG 164
           R  L++  + +  A G L   +L  +   ++ L      +I+G  +  +S+  W  +   
Sbjct: 285 RLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFW-TFIFA 343

Query: 165 RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLG-YCTNYGTKDYSNS 223
           R ++G G G +  L  T+++  + K+     +S   +   +G+ +G +  N    D S+ 
Sbjct: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLF--DSSHG 401

Query: 224 VQWR----VPLGLNFAFAIFMIAGMLMV 247
             WR    +P+      A  M+A M  V
Sbjct: 402 SGWRNAFLIPVPFCLVNASIMLADMYSV 429

>Sklu_2394.9 YHR048W, Contig c2394 13885-15486
          Length = 533

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 73/163 (44%), Gaps = 6/163 (3%)

Query: 99  YYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKW 158
           +++S   + L + ++  G  FG L L  L +MYGR+I  +  + + IV  V+ + S    
Sbjct: 121 FHISHEVSVLGISLYIFGLGFGPLFLSPLSEMYGRKITFVMSLSMSIVWQVLTVWSPTIV 180

Query: 159 YQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTK 218
             +F GR ++G        ++  +IS+   +   G  ++ Y     LG  LG   +    
Sbjct: 181 GMFF-GRFLAGFFGSSFLSVAGGVISDIFTRQEIGIPMTVYTTSPFLGPALGPVVSGAL- 238

Query: 219 DYSNSVQWRVPLGLNFAFAIFMIAGMLMVPES--PRFLVEKGR 259
            Y  S +W   + L  A  + ++     VPE+  P  L+ K +
Sbjct: 239 -YGVSYKWTF-IALLIASGVCLVLIAFTVPETYQPVLLIGKAK 279

>CAGL0M06281g 651932..653560 similar to sp|P38125 Saccharomyces
           cerevisiae YBR180w DTR1, hypothetical start
          Length = 542

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 100/239 (41%), Gaps = 22/239 (9%)

Query: 25  QKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIAFGGFVFGWDTGTISGFVNQT 84
           Q++   ESP+     Y   ++P     ++  V  + L++ + GF+     G ++G V   
Sbjct: 53  QQVSIKESPL-----YYLRDIPYSAYTSF-QVSLIFLIVIYNGFL-----GPLAGNV--- 98

Query: 85  DFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVY 144
            F      ++ +  + +S+      V +F    +   L  G L D  GR+I L  + +  
Sbjct: 99  -FIPALPLLQKE--FNVSETTINATVSVFMATFSISPLFWGALADKGGRKI-LYIISISL 154

Query: 145 IVGIVIQIASSDKWYQYFI-GRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMI 203
           +V I I +AS  K     I  RII       +  L    +++  P   RG  ++++ L  
Sbjct: 155 MVIINILLASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLGP 214

Query: 204 TLGIFLGYCTNYGTKDYSNSVQWRVPLG-LNFAFAIFMIAGMLMVPESPRFLVEKGRYE 261
            LG  L      G     N+  WR   G L     + +I  +L++PE+ R +V  G  +
Sbjct: 215 NLGPILAPIIA-GLILLDNN-NWRWLFGFLCIVSGLGLIMVILLLPETLRCIVGNGDRQ 271

>KLLA0E14520g complement(1279788..1280543) similar to sp|P38724
           Saccharomyces cerevisiae YHL047c TAF1 siderophore
           transporter for triacetylfusarinine C, start by
           similarity
          Length = 251

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 5/99 (5%)

Query: 98  TYYLSDVRTGLI---VGIFNIG-CAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIA 153
           TY  +D  T  +   +GI N+   A   L    L D++GR   ++  ++ Y+VG VIQ  
Sbjct: 97  TYAANDYDTHSLLTTIGIVNMMISAVAQLFFAGLSDVFGRLSLMIVAIVFYVVGTVIQSQ 156

Query: 154 SSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIR 192
           + D   +Y  G +   +G+ G+ +     +S+ +    R
Sbjct: 157 AYDI-QKYCAGSVFYNVGLVGVMLQVTLFLSDNSSLRWR 194

>KLLA0C16852g 1471656..1473029 similar to sp|P25297 Saccharomyces
           cerevisiae YML123c PHO84 high-affinity inorganic
           phosphate/H+ symporter, start by similarity
          Length = 457

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 52/266 (19%), Positives = 101/266 (37%), Gaps = 49/266 (18%)

Query: 226 WRVPLGLNFAFAIFMIAGMLMVPESPRFLVE------KGRYEDAKRSLAKSNKVTIEDPS 279
           WR+ +GL        +   L +PESPR+ ++      KG  + AK +  +      E+  
Sbjct: 124 WRILIGLGCLPGCIALYFRLTIPESPRYTLDVDMDFNKGAADAAKFTSGEHGNAEQEE-- 181

Query: 280 IVAEMDTIMANVETERLAGNASWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFF---- 335
            +A+++     VET  +   A+  + F+          M I+I      T  ++F     
Sbjct: 182 -IAKLEKAPTAVETMEIKPPAASFKDFTRHFNQWKH--MKILIG-----TAGSWFLLDVA 233

Query: 336 YYGTTIFNAVGMK----------------DSFQTSIVLGIVNFASTFVALYTVDKFGRRK 379
           +YG ++ +AV ++                 +    I++   +    +V++ T+D  GR+ 
Sbjct: 234 FYGVSLNSAVILQTIGYASSSNVYRKLYNSAVGNLILICAGSLPGYWVSVATIDVIGRKP 293

Query: 380 CLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVMIVFTCLFIFFFAISWAPIA 439
             L G   + I F I                   K   + ++    L  FFF        
Sbjct: 294 IQLMGFVILTILFCIIGFA-------------YDKIGDHGLLALYVLCQFFFNFGPNVTT 340

Query: 440 YVIVAESYPLRVKNRAMAIAVGANWI 465
           +++  E +P R ++ A  I+  +  I
Sbjct: 341 FIVPGECFPTRYRSSAHGISAASGKI 366

>Kwal_23.4824
          Length = 553

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 54/257 (21%), Positives = 100/257 (38%), Gaps = 34/257 (13%)

Query: 5   ATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLCLMIA 64
           A SRV +   + S   +     +  D +P+   + YT      K     W   C+  ++ 
Sbjct: 42  APSRVTTHEMKGSSSESIEGHDIAHDNAPLPQHAPYTLLSNAQK-----W---CMVALLT 93

Query: 65  FGGFVFGWDT-GTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLT 123
             GF   W + G+   +      +++F          +S+    + V ++ I        
Sbjct: 94  SAGF---WSSLGSPIYYPALKQLEKQFS---------VSEELVNITVVVYLIFQGVAPTI 141

Query: 124 LGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
            G L D+YGRR  ++  +L+Y+    I +A S+ +      R +   G+  I  ++  ++
Sbjct: 142 SGGLADVYGRRPVILIGMLIYVCA-SIGLACSNSYGVIVFLRCLQSAGISPIIAINSGVV 200

Query: 184 SETAPKHIRGT---CVSFYQLM-ITLGIFLGYCTNYGTKDYSNSVQWRVPLG-LNFAFAI 238
            +   K  RGT    VS + LM    G  +G          + +  WR     L      
Sbjct: 201 GDFTVKQERGTFVGAVSGFTLMGQAFGSLIG-------AALTAAFDWRAIFWFLTIGCGT 253

Query: 239 FMIAGMLMVPESPRFLV 255
            M+   L++PE+ R +V
Sbjct: 254 CMLVNFLLLPETKRSIV 270

>Kwal_14.728
          Length = 568

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 16/138 (11%)

Query: 94  KSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIA 153
           KS G Y     ++G IV  +++  A   L  GR+    G RI ++  ++++  G +I  A
Sbjct: 72  KSFGDY----TKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSLIS-A 126

Query: 154 SSDKWYQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSF----YQLMITLGIFL 209
            +        GR++SG+G  G+  LS  +  +   +  R   +S     + +   +G F+
Sbjct: 127 LARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFI 186

Query: 210 GYCTNYGTKDYSNSVQWR 227
           G         ++  V WR
Sbjct: 187 G-------GAFTTHVTWR 197

>YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1869 bp, 622 aa]
          Length = 622

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 44/107 (41%), Gaps = 1/107 (0%)

Query: 108 LIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRII 167
           L V +  IG + G L    + D+YGRR+     + +Y++   I  A +         R +
Sbjct: 219 LSVSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVI-FNIPCALAPNLGSLLACRFL 277

Query: 168 SGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTN 214
            G+       L    I++  P   RG  ++F+     +G  +G   N
Sbjct: 278 CGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVN 324

>YNL065W (AQR1) [4525] chr14 (503723..505483) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1761 bp, 586
           aa]
          Length = 586

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G L D +GRR  ++  +L+Y++   I +A +  +      R I  +G+     +S  ++ 
Sbjct: 157 GGLADCFGRRPIILAGMLIYVIA-SIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVG 215

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLG 210
           +   KH RGT V      + LG   G
Sbjct: 216 DFTLKHERGTFVGATSGFVLLGQCFG 241

>YHR048W (YHR048W) [2336] chr8 (204599..206143) Member of the
           multidrug-resistance 12-spanner (DHA12) family of the
           major facilitator superfamily (MFS-MDR) [1545 bp, 514
           aa]
          Length = 514

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 81/192 (42%), Gaps = 11/192 (5%)

Query: 99  YYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKW 158
           +++S   + L + ++  G   G L L  L ++YGRRI  +  + + I+   + I S    
Sbjct: 104 FHISHEVSTLGITLYVFGLGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSKTIT 163

Query: 159 YQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTK 218
              F GR +SG        ++   I++   K   G  ++ Y     LG  LG     G  
Sbjct: 164 GVMF-GRFLSGFFGSAFLSVAGGAIADIFDKDQIGIPMAIYTTSAFLGPSLGPII--GGA 220

Query: 219 DYSNSVQWR-VPLGLNFAFAIFMIAGMLMVPES--PRFLVEKG---RYEDAKRSLAKSNK 272
            Y  S +W  + L +     + MI  +  +PE+  P  L+ K    R E   +      +
Sbjct: 221 LYHQSYKWTFITLLITSGCCLVMI--IFTIPETYKPMLLIRKAKRLRKEKNDQRYYAVLE 278

Query: 273 VTIEDPSIVAEM 284
           VT E  S+++ +
Sbjct: 279 VTREQTSLLSAI 290

>YML116W (ATR1) [3855] chr13 (38196..39824) Membrane transporter
           conferring aminotriazole and 4-nitroquinoline-1-oxide
           (4NQO) resistance, member of the multidrug-resistance
           14-spanner (DHA14) family of the major facilitator
           superfamily (MFS-MDR) [1629 bp, 542 aa]
          Length = 542

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 22/136 (16%)

Query: 122 LTLGRLGDMYGRR----IGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAV 177
           L  GRLGD+YG +    +G + V++  ++  + + + SD +  + I R   G+   GIA 
Sbjct: 123 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTF--FIISRAFQGL---GIAF 177

Query: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW------ 226
           + P ++      ++ GT      +SF   M  +G  LG C   G     +  QW      
Sbjct: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTEDPKQWPWAFYA 236

Query: 227 -RVPLGLNFAFAIFMI 241
             +   +NF  +I+ I
Sbjct: 237 YSIAAFINFVLSIYAI 252

>KLLA0A10439g complement(913342..915246) similar to sp|P38731
           Saccharomyces cerevisiae YHL040c ARN1 ferrichrome-type
           siderophore transporter, start by similarity
          Length = 634

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 110 VGIFN-IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIIS 168
           +G+ N +  A   +   RL D+YGR    +  ++ Y+VG +I+  + D   +Y  G +  
Sbjct: 121 IGVVNAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDV-QRYAAGAVFY 179

Query: 169 GMGVGGIAVLSPTLISE 185
            +G  G+ ++   ++S+
Sbjct: 180 NIGYVGVILIVLLILSD 196

>KLLA0E16313g complement(1450546..1452348) similar to sp|P36035
           Saccharomyces cerevisiae YKL217w JEN1 carboxylic acid
           transporter protein singleton, start by similarity
          Length = 600

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 69/176 (39%), Gaps = 18/176 (10%)

Query: 103 DVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIG-LMCVVLVYIVGIVIQIASSDKWYQY 161
           D+  GL + +F      G +  G   D Y R+   + C+ L  I  +    A +   Y  
Sbjct: 169 DISWGLSLVLFVRSA--GAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPWAKT---YTQ 223

Query: 162 FIG-RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLG-----IFLGYCTNY 215
           F+G R ISG+ +GGI   +     E AP   R      +     +G     IF     N 
Sbjct: 224 FLGVRWISGIAMGGIYACASATAIEDAPVKARSFLSGLFFTAYAMGFIFAIIFYRAFLNV 283

Query: 216 GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFL-VEKGRYEDAKRSLAKS 270
             ++Y     W+V    +      +I   L+ PE+  F  V K R      ++AK+
Sbjct: 284 NGENY-----WKVQFWFSIWLPAVLILWRLVWPETKYFTKVLKARQLMRDDAIAKN 334

>Kwal_23.4853
          Length = 603

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 118 AFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAV 177
           A G +   R  D++GR   L   VL+Y+VG +++   S+   ++  G  I  +G  GI +
Sbjct: 96  AAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVE-CQSNTVSKFATGASIFQLGKAGIVL 154

Query: 178 L 178
           L
Sbjct: 155 L 155

>YHL047C (ARN2) [2242] chr8 complement(8298..10211)
           Triacetylfusarinine C transporter, member of the
           yeast-specific putative multidrug-resistance family of
           the major facilitator superfamily (MFS) [1914 bp, 637
           aa]
          Length = 637

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 86/197 (43%), Gaps = 24/197 (12%)

Query: 6   TSRVESGSQQTSIHSTPIVQKLETDESP---IQTKSEYTNA------ELPAKPIAAYWTV 56
           +S+ +  + + + +   + +K++ D SP   ++ K + T +      EL AK     W +
Sbjct: 10  SSQTKRKNTEKNCNELMVDEKMDDDSSPRDEMKDKLKGTKSLIIRKSELMAKKYDT-WQL 68

Query: 57  ICLCLMIAF-GGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNI 115
             + L  AF   F +G D+     ++           M S   + L    + +++ I   
Sbjct: 69  KAIFLFSAFICTFAYGLDSSIRGTYMTYA--------MNSYSAHSLISTVSVIVLMI--- 117

Query: 116 GCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGI 175
             A   +  G L D++GR    +  +++YIVG +IQ  + D   +Y  G +   +G+ G+
Sbjct: 118 -SAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDV-QRYAAGAVFYYVGLVGV 175

Query: 176 AVLSPTLISETAPKHIR 192
            +    ++S+ +    R
Sbjct: 176 MLQVVLMLSDNSSLKWR 192

>Kwal_33.14268
          Length = 569

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 226 WRVPLGLNFAFAIFMIAGMLMVPESPRFLVE-KGRYEDAKRSLAK 269
           WR+ +GL     +F +   L +PESPR+ ++ + R   A   ++K
Sbjct: 241 WRILVGLGCVPGVFALYFRLTIPESPRYTLDVENRVNKAAADVSK 285

>Kwal_56.22298
          Length = 610

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
            RL D++GR    +  +  Y+VG +IQ  + D   +Y +G +   +G  GI ++   ++S
Sbjct: 114 ARLSDVFGRLSLFVTAIAFYVVGTIIQSQAYDI-QRYAVGSVFWSIGYVGILLMLILIVS 172

Query: 185 E 185
           +
Sbjct: 173 D 173

>CAGL0J09944g 974150..975928 similar to sp|P53943 Saccharomyces
           cerevisiae YNL065w, hypothetical start
          Length = 592

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 9/134 (6%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLIS 184
           G L D +GRR  L+  +L+Y+V   I +A +  +      R +  +G+     +S  ++ 
Sbjct: 156 GGLADKFGRRPVLLIGMLIYVVA-SIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVVG 214

Query: 185 ETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTK---DYSNSVQWRVPLGLNFAFAIFMI 241
           +   K  RGT V      + LG   G           D+  ++ W + +G   +FAI   
Sbjct: 215 DFTVKSERGTFVGATSGFVLLGQAFGSLIGAALAAAWDW-RAIFWFLTIGCGASFAICFA 273

Query: 242 AGMLMVPESPRFLV 255
               ++PE+ R +V
Sbjct: 274 ----LLPETKRSIV 283

>CAGL0B02343g complement(222130..223743) similar to sp|P13090
           Saccharomyces cerevisiae YML116w ATR1 Aminotriazole
           resistance protein or sp|Q03263 Saccharomyces cerevisiae
           YMR279c, hypothetical start
          Length = 537

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 22/136 (16%)

Query: 122 LTLGRLGDMYGRRIGLMCVVLVYIVGIVI----QIASSDKWYQYFIGRIISGMGVGGIAV 177
           L  GR+GD+YG +  L+   L  IV  +I    + A SD +  + + R   G+   GI++
Sbjct: 117 LISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSF--FIVSRAFQGL---GISL 171

Query: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLG--YCTNYGTKDYSNSVQW---- 226
           + P ++      +I G+      +S    M  +G  LG  +    GT+D +N   W    
Sbjct: 172 ILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTED-ANQWPWAFYS 230

Query: 227 -RVPLGLNFAFAIFMI 241
             +   +NF  +I++I
Sbjct: 231 YAITAAINFVLSIWLI 246

>KLLA0E09856g complement(874102..875994) similar to sp|P36172
           Saccharomyces cerevisiae YKR105c, hypothetical start
          Length = 630

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 42/240 (17%), Positives = 99/240 (41%), Gaps = 40/240 (16%)

Query: 19  HSTPIVQKLE-------TDESPIQTKSEYT--NAELPAKPIAAYWTVICLCLMIAFGGFV 69
            S P+ +K E        ++ P+  K+ +T  N +  +  +A     +CL   +     +
Sbjct: 29  ESEPVSKKYEDKKAGEDAEDVPVDLKNVFTSDNEKTQSSIMAGMRLYVCL-FALVLAQLI 87

Query: 70  FGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGRLGD 129
              D   ++  ++           K+ G Y     ++G ++  +++  +   L  GR   
Sbjct: 88  VALDVFIVNTVIDVVS--------KNLGGY----AKSGWLITGYSLPNSLLSLIWGRATS 135

Query: 130 MYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLS----PTLISE 185
           + G +  ++  + ++ VG ++  A++       +GR+++G+G  G+  +S     +L+ E
Sbjct: 136 LLGFQSSMLISIFIFEVGSIVS-ATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEE 194

Query: 186 TAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWR------VPLGLNFAFAIF 239
                +    +S + +   +G F+G         ++    WR      +P+G + AF  F
Sbjct: 195 RNRTIVIAVIMSAFAVSSLIGPFIG-------GAFTTHATWRWCFWISLPVGGSAAFLFF 247

>CAGL0I10384g 1016935..1018827 highly similar to sp|P53283
           Saccharomyces cerevisiae YGR138c, start by similarity
          Length = 630

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 66/165 (40%), Gaps = 7/165 (4%)

Query: 115 IGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGG 174
           IG + G L    + D+YGRR+     + +Y +   I  A S       + R + G+    
Sbjct: 232 IGFSLGPLIWSPVSDLYGRRLAYFISMGLYTI-FNIPCALSPNLGGLLVCRFLCGVFSSS 290

Query: 175 IAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPL--GL 232
              L    I++  P   RG  ++F+      G  +G   N     + +    R+ L   +
Sbjct: 291 GLCLVGGSIADMFPSETRGRAIAFFAFAPYTGPIIGPLVN----GFVSVCTRRMDLIFWI 346

Query: 233 NFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIED 277
           N AFA  M   +  +PE+   ++ K R    ++       +T ++
Sbjct: 347 NMAFAGVMWIIVAFIPETYAPVILKWRAAKLRKETGNPKIMTEQE 391

>KLLA0C00220g 13632..15506 similar to sp|P38724 Saccharomyces
           cerevisiae YHL047c TAF1 siderophore transporter for
           triacetylfusarinine C, start by similarity
          Length = 624

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 118 AFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAV 177
           A   L    L D++GR   ++  +L Y+VG VIQ  + D   +Y  G +   +GV G+ +
Sbjct: 123 AVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDI-QRYAAGSVFYNIGVVGVML 181

Query: 178 LSPTLISETAPKHIR 192
                +++ +    R
Sbjct: 182 QVSLFLADNSSLKWR 196

>Kwal_47.18919
          Length = 640

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 72/182 (39%), Gaps = 9/182 (4%)

Query: 99  YYLSDVRTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKW 158
           +++S   + L   +  IG + G L    + D++GRR+     + +Y++   I  A +   
Sbjct: 228 FHVSQEVSILTCSLMVIGFSLGPLIWSPVSDLFGRRVAYFVSLGLYVI-FNIPCALAPNI 286

Query: 159 YQYFIGRIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTN---Y 215
               + R + G+       L    I++  P   RG  ++F+      G   G   N    
Sbjct: 287 GCLLVCRFLCGVWSSSGLCLVGGSIADMFPPETRGRAIAFFAYAPYCGPVFGPLVNGFIS 346

Query: 216 GTKDYSNSVQWRVPLGLNFAFAIFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTI 275
            +    + + W     +N AFA  M   +  +PE+   ++ K R    +R       +T 
Sbjct: 347 VSTHRMDLIFW-----VNMAFAGVMWLVVACIPETFAPVILKRRAAKLRRETGNPKIMTE 401

Query: 276 ED 277
           ++
Sbjct: 402 QE 403

>AGL069C [4242] [Homologous to ScYNR055C (HOL1) - NSH]
           (578235..580019) [1785 bp, 594 aa]
          Length = 594

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 105 RTGLIVGIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG 164
           +   +VG   +  A G +       ++G+R+  +  +L+++ G  I  A S+ +    I 
Sbjct: 116 QVSFLVGPMMLALAIGSVVASPTAVLFGKRMVYLMGILIFLGG-SIGCALSNSFASLLIF 174

Query: 165 RIISGMGVGGIAVLSPTLISETAPKHIRG 193
           R++SG G+  +  L    I+E    H R 
Sbjct: 175 RMVSGFGLSTVESLPSATIAEIYFAHERA 203

>YNR055C (HOL1) [4638] chr14 complement(728424..730184) Membrane
           transporter, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1761 bp, 586 aa]
          Length = 586

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 111 GIFNIGCAFGGLTLGRLGDMYGRRIG-LMCVVLVYIVGIVIQIA--SSDK-WYQYFIGRI 166
           G+  +G  +  L L    ++YGR+I  ++C  L     +   +A  +SD  W Q F+G  
Sbjct: 107 GVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFGALWFALAKRTSDTIWSQLFVG-- 164

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLG 210
           IS         LS   +S+   +H  G+ ++ Y +  ++G FLG
Sbjct: 165 ISESCAEAQVQLS---LSDIFFQHQLGSVLTVYIMCTSIGTFLG 205

>YHL040C (ARN1) [2247] chr8 complement(19085..20968) Protein
           involved in the transport of ferrichromes, member of the
           yeast-specific putative multidrug-resistance family of
           the major facilitator superfamily (MFS) [1884 bp, 627
           aa]
          Length = 627

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 125 GRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGI 175
            RL D++GR    +  V++Y+VG +IQ  + D   +Y  G I    G  G+
Sbjct: 131 ARLSDVFGRLYLFISAVILYVVGTIIQSQAYDV-QRYAAGAIFYNAGYVGV 180

>ADR336C [2077] [Homologous to ScYNR055C (HOL1) - NSH]
           (1299396..1301102) [1707 bp, 568 aa]
          Length = 568

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 111 GIFNIGCAFGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDK----WYQYFIGRI 166
           G+  +   +G L    L  +YGR+I  M  +   ++G +   ++S+     W Q  +G  
Sbjct: 108 GVLFLCIGWGTLVFAPLSSLYGRKITYMICIGFGLLGAIWFASTSNTNDAIWSQALVG-- 165

Query: 167 ISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLG 210
           +S         LS   +S+   +H  G+ ++ Y L  ++G FLG
Sbjct: 166 VSEACAEAQVQLS---LSDIFFQHQLGSVLTVYILCTSIGTFLG 206

>KLLA0D10615g 903967..905322 similar to sp|P47159 Saccharomyces
           cerevisiae YJR124c singleton, hypothetical start
          Length = 451

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 339 TTIFNAVGMKDS----FQTSIVLGIVNFASTFVALYTVDKFGRRKCLLGGSASMAICFVI 394
           T  F+ +G+ D     F +  ++G  +   ++V  +  D +GRR  L  GSA MA+  ++
Sbjct: 36  TLFFSEIGISDDEMGWFMSLTLVG--DVCISYVLTWYADSWGRRLVLTYGSAMMALSGIV 93

Query: 395 FST 397
           F+T
Sbjct: 94  FAT 96

>Sklu_2083.1 YKL217W, Contig c2083 424-2220
          Length = 598

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 108 LIVGIFNIGCAFGGLTLGRLGDMYGRRIGLM--CVV 141
           +I+ + N+G   GG+  G++ ++ GRR+ L+  CV+
Sbjct: 392 VIITVVNLGAICGGMIFGQIMEVTGRRLALLLACVL 427

>KLLA0F03278g 309127..310284 similar to sp|P40475 Saccharomyces
           cerevisiae YIL120w QDR1, start by similarity
          Length = 385

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 85/209 (40%), Gaps = 20/209 (9%)

Query: 124 LGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLI 183
           +G L D  GRR   M  ++VY     I IA    + +    R + G G+  I  ++  L+
Sbjct: 154 MGGLADRLGRRPVAMFCIMVYFCA-CIGIACCRTFGEMIFLRCLQGGGISPIIAINNGLM 212

Query: 184 SETAPKHIRGTCV---SFYQL---MITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFA 237
            +   K  RG  V   S +Q+    +   +   +   +G +    S+ W +  G      
Sbjct: 213 GDITVKSERGGYVGLTSGFQVLGSALGGLLGALFTARWGWR----SIFWFLSAGSGVTL- 267

Query: 238 IFMIAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLA 297
           +F++  +   PE+ R +V  G     K     S  V +  P    ++   + N + E   
Sbjct: 268 LFVVTAL---PETKRSIVGNG---SIKPPHLISRSVLLGAPYYKKKLH--LDNPDYETKT 319

Query: 298 GNASWGELFSNKGAILPRVIMGIMIQSLQ 326
            NAS+  L   K  + P +I  + +Q LQ
Sbjct: 320 ENASYDPLAPFKIMVRPELISLLAVQGLQ 348

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.140    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,691,176
Number of extensions: 631326
Number of successful extensions: 2715
Number of sequences better than 10.0: 268
Number of HSP's gapped: 2357
Number of HSP's successfully gapped: 284
Length of query: 532
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 426
Effective length of database: 12,926,601
Effective search space: 5506732026
Effective search space used: 5506732026
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)