Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR009W1791779471e-133
Sklu_2248.31771785632e-74
CAGL0K08800g1751775613e-74
ADR021W1761745466e-72
Scas_717.251781775459e-72
KLLA0D14487g1761765266e-69
Kwal_55.208131751775232e-68
CAGL0B00660g74679710.26
Sklu_2055.374340670.80
CAGL0C05247g357114641.6
YOL064C (MET22)35776623.0
Sklu_2250.58544583.7
KLLA0C06633g63168605.7
Scas_717.60325949597.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR009W
         (177 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the ac...   369   e-133
Sklu_2248.3 YMR009W, Contig c2248 7331-7864                           221   2e-74
CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces c...   220   3e-74
ADR021W [1762] [Homologous to ScYMR009W - SH] complement(743305....   214   6e-72
Scas_717.25                                                           214   9e-72
KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces...   207   6e-69
Kwal_55.20813                                                         206   2e-68
CAGL0B00660g complement(55441..57681) similar to sp|P25574 Sacch...    32   0.26 
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            30   0.80 
CAGL0C05247g 501476..502549 highly similar to sp|P32179 Saccharo...    29   1.6  
YOL064C (MET22) [4755] chr15 complement(206102..207175) 3'- (2'-...    28   3.0  
Sklu_2250.5 YBR085C-A, Contig c2250 8992-9249 reverse complement       27   3.7  
KLLA0C06633g 580349..582244 similar to sgd|S0002806 Saccharomyce...    28   5.7  
Scas_717.60                                                            27   7.8  

>YMR009W (YMR009W) [3973] chr13 (284101..284640) Member of the
           acireductone dioxygenase family, has high similarity to
           uncharacterized C. albicans Orf6.5544p [540 bp, 179 aa]
          Length = 179

 Score =  369 bits (947), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV
Sbjct: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60

Query: 61  VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES 120
           VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES
Sbjct: 61  VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES 120

Query: 121 GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALIN 177
           GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALIN
Sbjct: 121 GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALIN 177

>Sklu_2248.3 YMR009W, Contig c2248 7331-7864
          Length = 177

 Score =  221 bits (563), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 136/178 (76%), Gaps = 3/178 (1%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MV+VY HDN    D+R PHN+G E+SL  L K+GV Y++   ++EV+E+AR+R YKNRD+
Sbjct: 1   MVQVYYHDNNDAVDFRQPHNTGREISLQRLEKIGVFYRHFKTQQEVDELARERNYKNRDI 60

Query: 61  VNICEGSFKS-EAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVE 119
           V+I + SF + E    EKL  FY EHLHEDEEIRYCL+G GYFDVRDA + E WIRC VE
Sbjct: 61  VSISKESFGNDENAMIEKLKVFYSEHLHEDEEIRYCLDGTGYFDVRDAESDE-WIRCKVE 119

Query: 120 SGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALIN 177
            GDLLILP GIYHRFTLT  N+IKALRLFK+EPKW A NR + ADS P R++Y++ ++
Sbjct: 120 PGDLLILPAGIYHRFTLTDDNYIKALRLFKEEPKWLAYNRPD-ADSNPTREEYLSSLS 176

>CAGL0K08800g 883045..883572 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w, start by similarity
          Length = 175

 Score =  220 bits (561), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 106/177 (59%), Positives = 136/177 (76%), Gaps = 3/177 (1%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MV++Y+HD     D+R PHNSG  ++L++L K+GVIYK+ A++ +V+ +A++R YKNRD+
Sbjct: 1   MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQADVDILAKERNYKNRDI 60

Query: 61  VNICEGSFKSEAEFNEK-LATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVE 119
           V I   +FK +    EK L  FY+EHLHEDEEIRYC+EG+GYFDVR+    + W+RC V 
Sbjct: 61  VTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFDVRNGKD-DVWVRCKVG 119

Query: 120 SGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALI 176
            GDLLILP GIYHRFTLT +NHIKALRLFKDEPKWQA NR + ADSLPVR +Y+  I
Sbjct: 120 PGDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPD-ADSLPVRHEYLQSI 175

>ADR021W [1762] [Homologous to ScYMR009W - SH]
           complement(743305..743835) [531 bp, 176 aa]
          Length = 176

 Score =  214 bits (546), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (73%), Gaps = 2/174 (1%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MV+ Y+HDN    D RAPH+SG  +SL+ LA LGV Y++C +++EV+ +A  R Y NRD 
Sbjct: 1   MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE 60

Query: 61  VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES 120
           V I   SF SE  F +KLA FY EHLHEDEEIRY L G GYFD+RDA+T  +WIR  + +
Sbjct: 61  VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTG-DWIRVKLTT 119

Query: 121 GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIA 174
           GDLLI+P GIYHRFT+T SN I+A RLFKDEPKWQA NR  + D+ PV K+Y+A
Sbjct: 120 GDLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRP-EGDARPVHKEYLA 172

>Scas_717.25
          Length = 178

 Score =  214 bits (545), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (71%), Gaps = 2/177 (1%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MV+ Y+HDN    D+R PHNSG  +SL+ LAKLG++ KY    ++V  +A++R YKNRD 
Sbjct: 1   MVEAYVHDNDNKIDFREPHNSGVAVSLERLAKLGIVAKYLEKIDDVELLAKERNYKNRDT 60

Query: 61  VNICEGSFKS-EAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVE 119
           V + + +F + E     +L  FYQEHLHEDEEIRYC+EG+GYFD++D  T E WIRC V 
Sbjct: 61  VKLSKKTFNNDETLLLNQLNIFYQEHLHEDEEIRYCIEGSGYFDIKDTFTNE-WIRCKVS 119

Query: 120 SGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALI 176
            GDLLI+P GIYHRFTLTT N IKALRLFKDEPKWQA N+S   D   VRK Y+  I
Sbjct: 120 PGDLLIVPAGIYHRFTLTTDNFIKALRLFKDEPKWQAHNKSGDTDQTSVRKQYLQSI 176

>KLLA0D14487g 1229115..1229645 similar to sp|Q03677 Saccharomyces
           cerevisiae YMR009w singleton, start by similarity
          Length = 176

 Score =  207 bits (526), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 100/176 (56%), Positives = 128/176 (72%), Gaps = 2/176 (1%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MVK YIHDN    D+R  H++G  +SL++L ++G+IY+    +EEV++ A+ R+YKNRD+
Sbjct: 1   MVKAYIHDNDSSVDFREDHDTGKPVSLEKLEQIGLIYRKFDTQEEVDQFAQDRDYKNRDI 60

Query: 61  VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES 120
           VNI   SF  E     KL  FY EHLHEDEEIRYCL+G G+FDVRD  T E WIRC V+ 
Sbjct: 61  VNITVNSFPDEETMISKLNVFYAEHLHEDEEIRYCLDGEGFFDVRDPFT-EEWIRCRVQK 119

Query: 121 GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALI 176
           GDLL+LP GIYHRFTLT+ N+IKALRLFK+EPKW A NR + AD    R++Y+  +
Sbjct: 120 GDLLVLPAGIYHRFTLTSDNYIKALRLFKEEPKWLAYNRPD-ADDNRYRQEYLTQV 174

>Kwal_55.20813
          Length = 175

 Score =  206 bits (523), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 99/177 (55%), Positives = 128/177 (72%), Gaps = 4/177 (2%)

Query: 1   MVKVYIHDNKVDSDYRAPHNSGTELSLDELAKLGVIYKYCANEEEVNEIARQREYKNRDV 60
           MV+ Y HDN    D+R PH+SG  LSLD+LAK+GV YKYC ++ +V+E+A +R+YKNRD 
Sbjct: 1   MVEAYYHDNDDTVDFREPHHSGETLSLDQLAKIGVFYKYCPSQAQVDEVATERDYKNRDT 60

Query: 61  VNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYCLEGAGYFDVRDASTPENWIRCLVES 120
           V I + +         KL TFY EHLHEDEEIRY ++G G+FDVR+    + W+RC +  
Sbjct: 61  VQISQETLGD--ALLPKLQTFYAEHLHEDEEIRYIIDGEGFFDVRNEPN-DRWVRCKLVP 117

Query: 121 GDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADSLPVRKDYIALIN 177
           GDLLILP GIYHRFTLT+ N++KALRLFKDEPKW A  R   AD LP+R++Y+A + 
Sbjct: 118 GDLLILPAGIYHRFTLTSKNYVKALRLFKDEPKWVAHGRP-IADDLPIRREYLASVQ 173

>CAGL0B00660g complement(55441..57681) similar to sp|P25574
           Saccharomyces cerevisiae YCL045c, hypothetical start
          Length = 746

 Score = 32.0 bits (71), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 29  ELAKLGVIYKYCANEEEVNEIARQREYKNRDVVNICEGSFKSEAEFNEKLATFYQEHLHE 88
           +L  LG  YK    +EE N +A   E++++ +++  + +  S   F E L    Q+ +H 
Sbjct: 32  QLQNLGSAYKCVMADEESNHLAIVSEWRDQSLLSFLDKNSGS-IIFRELLPYHIQDVMHI 90

Query: 89  DEEIRYCLEGAGYFDVRDA 107
            +EI Y L   G  DV D+
Sbjct: 91  GDEI-YLLNEDGIVDVYDS 108

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 30.4 bits (67), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 5   YIHDNKVDSDYRAPHNSGTELSLDEL-AKLGVIYKYCANE 43
           Y+ DN     YR   + GTE+ +DE+   LGVI +  ANE
Sbjct: 704 YVSDNTKIHKYRKMISQGTEMDIDEVDGCLGVILQSLANE 743

>CAGL0C05247g 501476..502549 highly similar to sp|P32179
           Saccharomyces cerevisiae YOL064c MET22, start by
           similarity
          Length = 357

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 46/114 (40%), Gaps = 23/114 (20%)

Query: 34  GVIYKYCANEEEVNEIARQREYKNRDVVNICEGSFKSEAEFNE----KLATFYQEHLHED 89
           G  Y  C+ +    +  + R+ K+   +   EG  KS +  +E    K        LH D
Sbjct: 205 GAFYATCSTKVPDWKPIKVRQLKDTSEMISLEGVEKSHSSHDEQSQIKAKLGINNSLHLD 264

Query: 90  EEIRYCLEGAGYFDVRDASTPENWIRCLVE-----------SGDLLILPPGIYH 132
            +++YCL   G  DV        ++R  ++           +G+ ++L  G YH
Sbjct: 265 SQVKYCLLALGLADV--------YLRLPIKLSYREKIWDHAAGNTIVLEAGGYH 310

>YOL064C (MET22) [4755] chr15 complement(206102..207175) 3'- (2'-),
           5'- Bisphosphate nucleotidase required for sulfate
           assimilation, involved in salt tolerance, methionine
           biogenesis, and RNA processing [1074 bp, 357 aa]
          Length = 357

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 33  LGVIYKYCANEEEVNEIARQREYKNRDVVNICEGSFKSEAEFNEKLATF----YQEHLHE 88
           LG  Y   ++ E   +I  +     +D++ + EG  K  +  +E+ A        + LH 
Sbjct: 204 LGAFYSPSSDAESWTKIHVRHLKDTKDMITL-EGVEKGHSSHDEQTAIKNKLNISKSLHL 262

Query: 89  DEEIRYCLEGAGYFDV 104
           D + +YCL   G  DV
Sbjct: 263 DSQAKYCLLALGLADV 278

>Sklu_2250.5 YBR085C-A, Contig c2250 8992-9249 reverse complement
          Length = 85

 Score = 26.9 bits (58), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 20/44 (45%)

Query: 52 QREYKNRDVVNICEGSFKSEAEFNEKLATFYQEHLHEDEEIRYC 95
          Q  YKN D +N   GSF   A         Y+E + + E +++ 
Sbjct: 2  QTLYKNNDTINQSTGSFLQSAPVELTTVKGYEEFIAKQEALKHS 45

>KLLA0C06633g 580349..582244 similar to sgd|S0002806 Saccharomyces
           cerevisiae YDR398w, start by similarity
          Length = 631

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 108 STPENW--IRCLVESGDLLILPPGIYHRFTLTTSNHIKALRLFKDEPKWQAINRSNQADS 165
           S  E+W  +    E GD+ I    +    ++ + N  ++ ++ K + K   + RSN A  
Sbjct: 231 SISEDWSHVSATTEDGDIAIFEEPL---VSINSGNKRRSGKISKQKNKTITLLRSNSATR 287

Query: 166 LPVRKDYI 173
           LP+ K +I
Sbjct: 288 LPIIKSFI 295

>Scas_717.60
          Length = 3259

 Score = 27.3 bits (59), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 30   LAKLGVIYKYCANEEEVNEIARQ----------REYKNRDVVNICEGSF 68
            LA+  ++  Y  NEE  NEIAR             Y+  D +N  E SF
Sbjct: 1451 LAECRILLIYARNEEYANEIARSGIFNKLLKVIGSYQKSDKINFLESSF 1499

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,309,127
Number of extensions: 268409
Number of successful extensions: 857
Number of sequences better than 10.0: 21
Number of HSP's gapped: 845
Number of HSP's successfully gapped: 21
Length of query: 177
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 82
Effective length of database: 13,307,399
Effective search space: 1091206718
Effective search space used: 1091206718
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)