Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR008C (PLB1)66465230420.0
Scas_611.164656724020.0
CAGL0J11770g65959722450.0
YMR006C (PLB2)70656221300.0
Kwal_56.2251064157921110.0
Sklu_1900.165857820950.0
YOL011W (PLB3)68657820970.0
KLLA0C05940g64056920310.0
Scas_685.367756820220.0
Scas_644.870458219690.0
CAGL0E02321g70459118560.0
CAGL0J11748g69556017480.0
Scas_92.0d2362068391e-108
Sklu_2442.195844135935e-68
AAL027W5924075743e-65
Kwal_0.1735074115534e-63
YNL012W (SPO1)6313924983e-54
CAGL0H03575g5143904615e-50
KLLA0F12232g6804064451e-46
Scas_695.105533734354e-46
Scas_690.1*63690790.22
Kwal_55.1982337990750.53
Kwal_56.2413946378721.2
YPL217C (BMS1)1183104712.0
CAGL0I00682g18965673.4
Sklu_1884.254655693.4
KLLA0E11638g40574666.9
ADL239C89170668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR008C
         (652 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...  1176   0.0  
Scas_611.1                                                            929   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   869   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   825   0.0  
Kwal_56.22510                                                         817   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        811   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   812   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   786   0.0  
Scas_685.3                                                            783   0.0  
Scas_644.8                                                            763   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   719   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   677   0.0  
Scas_92.0d                                                            327   e-108
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     233   5e-68
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   225   3e-65
Kwal_0.173                                                            217   4e-63
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   196   3e-54
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   182   5e-50
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   176   1e-46
Scas_695.10                                                           172   4e-46
Scas_690.1*                                                            35   0.22 
Kwal_55.19823                                                          33   0.53 
Kwal_56.24139                                                          32   1.2  
YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein i...    32   2.0  
CAGL0I00682g 50356..50925 similar to sp|P28627 Saccharomyces cer...    30   3.4  
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         31   3.4  
KLLA0E11638g 1028781..1029998 some similarities with sp|P01120 S...    30   6.9  
ADL239C [1502] [Homologous to ScYIL109C (SEC24) - SH; ScYNL049C ...    30   8.5  

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score = 1176 bits (3042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/652 (89%), Positives = 584/652 (89%)

Query: 1   MKLQXXXXXXXXXXXXXENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKR 60
           MKLQ             ENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKR
Sbjct: 1   MKLQSLLVSAAVLTSLTENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKR 60

Query: 61  DAYTKEALHSFLNRATSNFSDTSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXX 120
           DAYTKEALHSFLNRATSNFSDTSLLSTLFGSNSSNMPKIAVACSGGGYR           
Sbjct: 61  DAYTKEALHSFLNRATSNFSDTSLLSTLFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAA 120

Query: 121 XDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDI 180
            DNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDI
Sbjct: 121 MDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDI 180

Query: 181 SHSILTPDGINIFKTGSRWXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVG 240
           SHSILTPDGINIFKTGSRW            AGFNISLADVWGRALAYNFWPSLHRGGVG
Sbjct: 181 SHSILTPDGINIFKTGSRWDDISDDVQDKKDAGFNISLADVWGRALAYNFWPSLHRGGVG 240

Query: 241 YTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTD 300
           YTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTD
Sbjct: 241 YTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTD 300

Query: 301 VKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDF 360
           VKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDF
Sbjct: 301 VKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDF 360

Query: 361 LEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKE 420
           LEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKE
Sbjct: 361 LEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKE 420

Query: 421 RELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKP 480
           RELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKP
Sbjct: 421 RELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKP 480

Query: 481 TFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMG 540
           TFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMG
Sbjct: 481 TFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMG 540

Query: 541 NFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGNDDYXX 600
           NFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGNDDY  
Sbjct: 541 NFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGNDDYSS 600

Query: 601 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHKKNAGNALVNYSNLNTNTFIG 652
                                        THKKNAGNALVNYSNLNTNTFIG
Sbjct: 601 SASLSASAAAASASASASASASASASGSSTHKKNAGNALVNYSNLNTNTFIG 652

>Scas_611.1
          Length = 646

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/567 (77%), Positives = 492/567 (86%)

Query: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79
           V AWSP+NSYVPANVTCDD+INL+REA+ LSD+E  WL KRDA T EAL SFL R+TSNF
Sbjct: 18  VGAWSPSNSYVPANVTCDDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNF 77

Query: 80  SDTSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQG 139
           SDTSL+S LF  NSS+ P+I VACSGGGYR            DNRTDGANEHGLGGLLQG
Sbjct: 78  SDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQG 137

Query: 140 ATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRW 199
           ATYLAGLSGGNWLTSTL WNNWTSVQAI++N T  +SIWDISHSI+ P G NI +TG RW
Sbjct: 138 ATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILETGERW 197

Query: 200 XXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPF 259
                       AGFNISLADVWGRAL+YNF+PSL+RGG GYTWSTLR+ADVFKN EMPF
Sbjct: 198 DHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPF 257

Query: 260 PITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQC 319
           PI+VADGRYPGTTVINLNAT+FEFNPFEMGSWDPTLN FTDVKYLGTNV+NGKP+ +G+C
Sbjct: 258 PISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKC 317

Query: 320 IAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPF 379
           IAGFDNTGFIT TSSTLFNQFLL +NST LPSFI  LA+ FL DLS + +DIAIY+PNPF
Sbjct: 318 IAGFDNTGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPF 377

Query: 380 KEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYW 439
           ++A+F+  N + SI++S+ LFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADT+  W
Sbjct: 378 RDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSW 437

Query: 440 PDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPL 499
           PDGASLVNTY+RQFG QG  ++FPYVPD NTFVNLGLNK+PTFFGCDARNLTDLEYIPPL
Sbjct: 438 PDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPL 497

Query: 500 IVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRR 559
           +VYIPN+RHSFNGNQSTFKMSYS SER  MI+NGFE+AT GNFTDDSDFLGC+GCAI+RR
Sbjct: 498 VVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRR 557

Query: 560 KQQNLNATLPSECSQCFTNYCWNGTID 586
           KQQ++NATLP+EC+QCFTNYCWNGTID
Sbjct: 558 KQQSMNATLPTECNQCFTNYCWNGTID 584

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/597 (67%), Positives = 482/597 (80%), Gaps = 4/597 (0%)

Query: 1   MKLQXXXXXXXXXXXXXENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKR 60
           M+LQ               V AWSP NSYVPANVTC +DINL+R A+GLS +E +WLKKR
Sbjct: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPNDINLLRNATGLSQSEIDWLKKR 60

Query: 61  DAYTKEALHSFLNRATSNFSDTS----LLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXX 116
           D  T+EAL SFL R TSNF+  S    L+  LF +NSSN+PKI +A SGGGYR       
Sbjct: 61  DVNTREALESFLKRVTSNFTSNSSASNLIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAG 120

Query: 117 XXXXXDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNS 176
                DNRTDGANEHGLGGLLQ ATYLAGLSGGNWLT+TL+WNNWTSVQ IVD+    ++
Sbjct: 121 MVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSA 180

Query: 177 IWDISHSILTPDGINIFKTGSRWXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHR 236
           IWDISHSI++P GINIFKTGSRW            AGFN+SLADVWGRAL+Y F+P+L+R
Sbjct: 181 IWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRALSYQFFPTLYR 240

Query: 237 GGVGYTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLN 296
           GGV Y WS LRE+DVFKN EMP PI+VADGRYPGT VI+LN+T+FE++PFE+GSWDP+L+
Sbjct: 241 GGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLS 300

Query: 297 AFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANL 356
           AFTDV+YLGT V++GKP  +G+CIAGFDN GF+  TSSTLFNQFLLR+N T +P FI NL
Sbjct: 301 AFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNL 360

Query: 357 ATDFLEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPL 416
           AT FL+DLS++ DDIA+YAPNPF++A+++  N + S+ ESEYLFLVDGGED QN+PLVPL
Sbjct: 361 ATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPL 420

Query: 417 LQKERELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGL 476
           +Q+ER+LD++FALDNSADT++ WPDGASL++TY+RQFG QG  ++FP VP  +TFVNLGL
Sbjct: 421 IQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGL 480

Query: 477 NKKPTFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEA 536
           NKKPTFFGCDARN+TDLEYIPPLIVYIPNSRHS+NGN STFK+SYS+ ERLG+I+NGFEA
Sbjct: 481 NKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEA 540

Query: 537 ATMGNFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGV 593
           ATM N T DS+F GC+GCAI+RRKQQ LN TLP EC  CFTNYCWNGTID+    GV
Sbjct: 541 ATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGTIDNTPAKGV 597

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/562 (68%), Positives = 461/562 (82%), Gaps = 1/562 (0%)

Query: 29  YVPANVTC-DDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNFSDTSLLST 87
           Y P+ + C  DD +LVR ASGLS  ET+WLKKRDAYTKEALHSFL+RATSNFSDTSLLST
Sbjct: 30  YAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRATSNFSDTSLLST 89

Query: 88  LFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQGATYLAGLS 147
           LF SNSSN+PKI +ACSGGGYR            DNRTDGANEHGLGGLLQ +TYL+GLS
Sbjct: 90  LFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGANEHGLGGLLQSSTYLSGLS 149

Query: 148 GGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRWXXXXXXXX 207
           GGNWLT TLAWNNWTSVQ IVD+ +ES+SIW+I+ SI+ P G N+  T  RW        
Sbjct: 150 GGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQEVQ 209

Query: 208 XXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGR 267
               AGFNISL+D+W RAL+YNF+PSL   G   TWS+LR+ DVFKNGEMP PITVADGR
Sbjct: 210 AKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADGR 269

Query: 268 YPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTG 327
           YPGTTVINLNATLFEF PFEMGSWDP+LNAFTDVKYLGTNVTNGKPVNK QC++G+DN G
Sbjct: 270 YPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNAG 329

Query: 328 FITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPFKEANFLQK 387
           F+ ATS++LFN+F L  +++     I + A  ++ +LS + DDIAIYA NPFK+  F+ +
Sbjct: 330 FVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFVDR 389

Query: 388 NATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYWPDGASLVN 447
           N TSSI++++ LFLVDGGED QN+PLVPL++KER+LDV+FALD S +TD+ WP G  + N
Sbjct: 390 NYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMTN 449

Query: 448 TYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPLIVYIPNSR 507
           TY+RQ+  QG  ++FPYVPDVNTF+NLGL  KPTFFGCDA+NLTDLEYIPPL+VYIPN++
Sbjct: 450 TYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNTK 509

Query: 508 HSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRRKQQNLNAT 567
           HSFNGNQST KM+Y+ +ERLGMI+NGFEAATMGNFTDDS+FLGC+GCAIIRRKQ++LNAT
Sbjct: 510 HSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLNAT 569

Query: 568 LPSECSQCFTNYCWNGTIDSRS 589
           LP EC++CF +YCWNGT+ + +
Sbjct: 570 LPPECTKCFADYCWNGTLSTSA 591

>Kwal_56.22510
          Length = 641

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/579 (65%), Positives = 463/579 (79%), Gaps = 2/579 (0%)

Query: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79
           V AWSP +SYVP NV+C DDINLVR+AS LS NETEWLKKRDAYTKEAL +FL+RATSNF
Sbjct: 15  VQAWSPTDSYVPGNVSCADDINLVRKASSLSPNETEWLKKRDAYTKEALRTFLDRATSNF 74

Query: 80  SDTSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQG 139
           S++SL+  ++   S  +P+IAVACSGGGYR            DNRT+GA EHGLGGLLQ 
Sbjct: 75  SNSSLVDNVW--KSGKIPRIAVACSGGGYRAMLSGAGMLSAMDNRTNGATEHGLGGLLQS 132

Query: 140 ATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRW 199
            TYLAGLSGGNWL  +LAWNNWTSVQ I+D     + +WDIS+SIL P G+NI  + +RW
Sbjct: 133 TTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNSILNPGGVNILTSANRW 192

Query: 200 XXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPF 259
                       AGFN SLADVWGRAL+Y+F+P+L++GG+GYTWSTLR+ADVFKNGEMPF
Sbjct: 193 DQISDAVEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWSTLRDADVFKNGEMPF 252

Query: 260 PITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQC 319
           PI+VADGRYPGT +I+LN+TLFEFNPFEMGSWDP+LNAFTDVKYLGT V NG PV +GQC
Sbjct: 253 PISVADGRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTEVKNGTPVTQGQC 312

Query: 320 IAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPF 379
           +AGFDNTGF+  TSSTLFNQFLL+LN+T + SF+     DFL+DLS++S+DIAIY PNPF
Sbjct: 313 VAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQDLSEDSNDIAIYNPNPF 372

Query: 380 KEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYW 439
           ++  ++ KN T  I+ SE LFLVDGGED +NIPLVPL+Q++R++DVIFALDNSADTD+YW
Sbjct: 373 RDTAYVDKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDRDVDVIFALDNSADTDEYW 432

Query: 440 PDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPL 499
           P G SL++TY+RQFG QG +++FPYVPDV+TFVN GLN KP FFGCDA N +DL Y PPL
Sbjct: 433 PAGLSLMHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFFGCDATNTSDLAYTPPL 492

Query: 500 IVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRR 559
           IVY+PN+R S+N N STFKMSYS S+R+ M +NGFEA T  N TDDS+F+GCV CA++RR
Sbjct: 493 IVYMPNNRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLTDDSNFMGCVACAVLRR 552

Query: 560 KQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGNDDY 598
           KQ++ N T P EC++CF NYCW+G    ++ +    D+Y
Sbjct: 553 KQESQNMTFPEECTKCFQNYCWDGKTSKKTSNVTTLDNY 591

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/578 (67%), Positives = 447/578 (77%), Gaps = 8/578 (1%)

Query: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79
           V AWSP NSY P NVTCDDDINLVREA GLS +E+EWLKKR+ YT  AL  FLNRAT NF
Sbjct: 14  VGAWSPTNSYTPGNVTCDDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENF 73

Query: 80  SDTSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQG 139
           +D S++ TLF  NSS+ P+I VACSGGGYR            DNRT G+ EHGLGGLLQ 
Sbjct: 74  TDNSIVKTLF--NSSSAPRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHGLGGLLQS 131

Query: 140 ATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRW 199
            TYLAGLSGGNWL  TLAWNNWTSVQ I+D   + + IWDIS+SI++P G N+ +T SRW
Sbjct: 132 TTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPGGTNVLETTSRW 191

Query: 200 XXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPF 259
                       AGFN SL DVWGRAL+Y+F+P+L  GG  YTWSTLREADVFKN EMPF
Sbjct: 192 DDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMPF 251

Query: 260 PITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQC 319
           PI+VADGRYPGT VINLNAT+FEFNPFEMGSWD +L AFT+VKYLGT V NG P  KGQC
Sbjct: 252 PISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQC 311

Query: 320 IAGFDNTGFITATSSTLFNQFLLRLNST------DLPSFIANLATDFLEDLSDNSDDIAI 373
           IAGFDNTGFI  TSS+LFNQF L+ NST       LPS++   A  FL  LS + DDIA+
Sbjct: 312 IAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGLSKDYDDIAL 371

Query: 374 YAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSA 433
           YAPNPFK  N++ +N T SI+ESE L+LVDGGED QNIPL+PLLQ+ERELDVIFALDNSA
Sbjct: 372 YAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNSA 431

Query: 434 DTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDL 493
           DT+ YWP+G SL  TY+RQF  QG +++FPYVPDV+TFV LGLNK+PTFFGCDA NLTDL
Sbjct: 432 DTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDL 491

Query: 494 EYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVG 553
           +YIPPL+VY+PN++ SFN NQSTFK+SYS   R  MIKNGFEA T  N TDDSDF+ CV 
Sbjct: 492 DYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVA 551

Query: 554 CAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVS 591
           CA+IRRKQQ++NATLP EC +CFTNYCWN      S S
Sbjct: 552 CAVIRRKQQSMNATLPEECEKCFTNYCWNDNASKGSAS 589

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/578 (66%), Positives = 459/578 (79%), Gaps = 2/578 (0%)

Query: 21  NAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNFS 80
           NAWSP +SYVP  V+C DDINLVREA+ +S NE+ WL+KR+  T  AL  FL RAT+NFS
Sbjct: 25  NAWSPTDSYVPGTVSCPDDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATANFS 84

Query: 81  DTS-LLSTLFG-SNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQ 138
           D+S +LS LF   NS N+PKIAVA SGGGYR            DNRT+GA EHGLGGLLQ
Sbjct: 85  DSSEVLSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQ 144

Query: 139 GATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSR 198
             TYL+G SGGNWL  TLA NNWTSVQ I++N    +SIWD+S SI+TP GINIFKT  R
Sbjct: 145 STTYLSGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKTAKR 204

Query: 199 WXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMP 258
           W            A +N SLAD+WGRALAYNF+PSL+RGG+G TWS++R+  VF+N EMP
Sbjct: 205 WDHISNAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMP 264

Query: 259 FPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQ 318
           FPI+VADGRYPGT VINLNAT+FEFNPFEMGSWDP+LN+F +VKYLGTNV+NG P+ +G+
Sbjct: 265 FPISVADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGK 324

Query: 319 CIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNP 378
           C AGFDN GFI  TSSTLFNQFLLR+NST LPSFI  LA  FL+DLS + +DIA+Y+PNP
Sbjct: 325 CTAGFDNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYSPNP 384

Query: 379 FKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDY 438
           FK+  FL  + T+SI++S+ LFLVDGGED++N+P++PL+QKER++D+IFA+DNSAD    
Sbjct: 385 FKDTKFLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLA 444

Query: 439 WPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPP 498
           WPDG+SLV+TY+RQF  QG  +SFPYVPD NTFVNLGLNKKPTFFGCDA NLTDL+YIPP
Sbjct: 445 WPDGSSLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPP 504

Query: 499 LIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIR 558
           L+VY+PN+ +SFN NQS FK+SYS+S+R  MI+NGFE AT  NFTDD +F+GCVGCAIIR
Sbjct: 505 LVVYLPNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIR 564

Query: 559 RKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGND 596
           RKQQ LN TLP EC  CF NYCWNGT+D+  +  V  D
Sbjct: 565 RKQQALNITLPPECETCFKNYCWNGTLDTTPLPDVEKD 602

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/569 (66%), Positives = 439/569 (77%), Gaps = 2/569 (0%)

Query: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79
           VNAWSP N Y P  V CD++INLVR+A  +SD+E +WLK R   T  AL  FL R    F
Sbjct: 23  VNAWSPTNGYAPGVVDCDENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGF 82

Query: 80  S-DTSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQ 138
           + DTS++  L  +  +  PK+A+ACSGGGYR            DNRTDGAN+HGLGGLLQ
Sbjct: 83  TNDTSIIDKLLATQDT-APKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQ 141

Query: 139 GATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSR 198
            +TYLAGLSGGNWL  TLA+NNWTSVQAI++N T+ NSIWDIS+SI+ P GINIF + SR
Sbjct: 142 SSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISR 201

Query: 199 WXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMP 258
           W            AGFN S+ DVWGRAL+YNF+PSL  GGVGYTW+TLR+ DVFKNGEMP
Sbjct: 202 WDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMP 261

Query: 259 FPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQ 318
           FPI+VA GRYPGT V+NLNAT+FEFNPFEMGSWD TL+ FTDV+Y GTNVTNG P   G+
Sbjct: 262 FPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGK 321

Query: 319 CIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNP 378
           C+AGFDNTGF+  TSS+LFNQFLL+LN+TDLPSF+ NL   FL D SD+ DDI+I+APNP
Sbjct: 322 CVAGFDNTGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTDASDDYDDISIWAPNP 381

Query: 379 FKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDY 438
           F E   +  N + SI E + L+LVDGGED QNIPL PLLQ ERE+DVIFALDNSADTD  
Sbjct: 382 FYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQS 441

Query: 439 WPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPP 498
           WPDG SL  TY RQFG QG  ++FPYVPDVNTF NLGLN +PTFFGCDARNLTDLE IPP
Sbjct: 442 WPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPP 501

Query: 499 LIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIR 558
           L+VY+PN+R SFN N STFKMSYS SER  MI+NGFEA TM N T D +F+GC+ CAI+R
Sbjct: 502 LVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILR 561

Query: 559 RKQQNLNATLPSECSQCFTNYCWNGTIDS 587
           RKQ++LN TLPSEC  CF  YCWNGT+D+
Sbjct: 562 RKQESLNYTLPSECDACFEKYCWNGTVDA 590

>Scas_685.3
          Length = 677

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/568 (65%), Positives = 451/568 (79%), Gaps = 6/568 (1%)

Query: 20  VNAWSPNNSYVPANVTCDDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79
           V AWSP+N Y PANVTC DD+NL+REAS LS +E +WLKKR+  T E+L +FL+R+T NF
Sbjct: 17  VQAWSPSNGYAPANVTCADDVNLLREASDLSKDEQDWLKKRNTITAESLKTFLDRSTKNF 76

Query: 80  SDTS--LLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLL 137
           SD+S  LL+ LF  +  N+PKI +A SGGGYR            DNRT GAN+HGLGGLL
Sbjct: 77  SDSSSSLLNKLF-QDGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGGLL 135

Query: 138 QGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGS 197
           Q +TYLAGLSGGNWLT+TLAWNNWTSVQ I+DN T  NSIWDI +S+ +   I+     S
Sbjct: 136 QSSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVENSIWDIDNSLFS---ISEMANSS 192

Query: 198 RWXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEM 257
            W            AGFN++LAD+WGRALAYNF+P L+ GG GYTWSTLR+++VFKN EM
Sbjct: 193 IWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRDSEVFKNAEM 252

Query: 258 PFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKG 317
           PFPITVADGRYPGTTVI+LNAT+FEFNPFEMGSWDPTLN+FTDVKYLGTNV+NGKP++ G
Sbjct: 253 PFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGKPIDAG 312

Query: 318 QCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPN 377
           QC+AGFDN GF+  TS+TLFN   L   S+ LP  ++ L  +F   L+D  +DIAIY+PN
Sbjct: 313 QCVAGFDNAGFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADTYNDIAIYSPN 372

Query: 378 PFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDD 437
           PF++A+ ++ N + +I++S+ LFLVDGGED + IPLVPLLQ++R LDV+FALD ++DT  
Sbjct: 373 PFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFALDFNSDTTT 432

Query: 438 YWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIP 497
            WPDG+SLV TYQRQF  QG  +SFPYVPD  TF+  GLN KPTFFGCDA+NLTDLEYIP
Sbjct: 433 SWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAKNLTDLEYIP 492

Query: 498 PLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAII 557
           PLIVYIPNSR+SFN N ST ++SY+ S+RLGMI+NGFE+AT GNFTDD +FLGC+GCAI+
Sbjct: 493 PLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEFLGCIGCAIM 552

Query: 558 RRKQQNLNATLPSECSQCFTNYCWNGTI 585
           RRKQQ+LN TLPSEC QCFTNYCWNGT+
Sbjct: 553 RRKQQSLNETLPSECEQCFTNYCWNGTL 580

>Scas_644.8
          Length = 704

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/582 (61%), Positives = 448/582 (76%), Gaps = 16/582 (2%)

Query: 22  AWSPNNSYVPANVTC--------DDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLN 73
           AW+P+NSY P+ + C        ++D +L+REA  +S NE+ WL+KR   T+E L  FLN
Sbjct: 22  AWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFLN 81

Query: 74  RATSN------FSDTSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDG 127
           R+ ++      F   +LLS+L GS+S++ PKI +A SGGGYR            DNRT G
Sbjct: 82  RSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRG 141

Query: 128 ANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTP 187
           A  HGLGGLLQ  TYL+G SGGNWL  TLA+NNWTSVQ+I+DN  ES+SIWD+S SI++P
Sbjct: 142 AQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSP 201

Query: 188 DGINIFKTGSRWXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLR 247
            G NIFK+  RW            AGF+ SLADVWGRAL+Y F+PSL+RGGV YTWS+LR
Sbjct: 202 GGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLR 261

Query: 248 EADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTN 307
           ++ VF  G+MPFPI+VADGRYPG+ V+NLNAT+FEFNPFEMGSWDP+LN FTDVK+LGTN
Sbjct: 262 DSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTN 321

Query: 308 VTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTD--LPSFIANLATDFLEDLS 365
           V+ GKP++  +C+ GFDNT FI  TSSTLFNQFLLR+NST+  LP FI  LAT FL+D+S
Sbjct: 322 VSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDIS 381

Query: 366 DNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDV 425
            + +D+A Y PNPFK+ANF+  N T SI+ S+ L+LVDGGED++NIPL+PL+Q+ER+LD+
Sbjct: 382 QDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDI 441

Query: 426 IFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGC 485
           +FA+DNS D    WPDG+SLV+T++RQF  QG  ++FPYVP  +TFVNLGLN+KPTFFGC
Sbjct: 442 VFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGC 501

Query: 486 DARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDD 545
           DA NLTDLEYIPPL++Y+PN ++SF  NQS FK+SY++ +R  MI NGFE AT  NFTDD
Sbjct: 502 DAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDD 561

Query: 546 SDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDS 587
            DFLGC+GCAIIRRKQQ+LN TLP  C+ CFTNYCWNGT+D+
Sbjct: 562 PDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDT 603

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/591 (57%), Positives = 434/591 (73%), Gaps = 17/591 (2%)

Query: 21  NAWSPNNSYVPANVTC-DDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNF 79
           + +S  + Y P    C  DDINLVREASGLS NET+WL++RD  TKEALH+FL RATS+ 
Sbjct: 18  SGYSVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSS 77

Query: 80  SD-TSLLSTLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQ 138
            + T L   +F  ++  +P+I +A SGGGYR            DNRT GA +HGLGG+LQ
Sbjct: 78  QNFTQLFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQ 135

Query: 139 GATYLAGLSGGNWLTSTLAWNNWTSVQAIVD-----------NTTESNSIWDISHSILTP 187
             TY+ G SGGNWL ++L+WNNWTSVQ I+D                + IWD+S SI++P
Sbjct: 136 STTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSP 195

Query: 188 DGINIFKTGSRWXXXXXXXXXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLR 247
            G+NI KT  RW            AGFN SLADVWGRAL+Y F+P+L RGG+ YTWS+LR
Sbjct: 196 GGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLR 255

Query: 248 EADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTN 307
           ++ +F+ G+MP PITVADGRYPG+  I LNAT+FEFNPFEMGSWDP+LNAFTDVKYLGTN
Sbjct: 256 DSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTN 315

Query: 308 VTNGKPV--NKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLS 365
           VTNGKPV     +CI GFDNT FI  TSS LFNQFLLR+NST LP+F+   AT+ L+  +
Sbjct: 316 VTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWA 375

Query: 366 DNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDV 425
              +D+A+Y PNPFK+  ++ +N ++SI++SE+L+LVDGGED++N+PL+PLLQ++R+LD+
Sbjct: 376 HEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDI 435

Query: 426 IFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGC 485
           IFA+DNSAD    WPDG+SLV+TY+RQF  QG  ++FP++PD NTF+NLGLNK+PTFFGC
Sbjct: 436 IFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGC 495

Query: 486 DARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDD 545
           +A N+T L+YIPPL+VY PNS +SFN NQS FK+SYS  +   MI NGFE AT  NFTDD
Sbjct: 496 NATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDD 555

Query: 546 SDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGTIDSRSVSGVGND 596
            +F+GC+ CAI++RKQ+ L+  LPSEC +C   YCW+GT+D   +  +  D
Sbjct: 556 PEFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDELKQD 606

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/560 (57%), Positives = 420/560 (75%), Gaps = 4/560 (0%)

Query: 28  SYVPANVTCDDDINLVREAS-GLSDNETEWLKKRDAYTKEALHSFLNRATSNFSDTSLLS 86
           SY P NV+C D+ N +R A+ GLS  E EWLKKRD  T++AL +FL RA +N S T + S
Sbjct: 21  SYTPQNVSCPDNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVS-TEITS 79

Query: 87  TLFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQGATYLAGL 146
            LF +++ N+PK+ +A +GGGYR            DNRTDGANEHGLGGLLQ ATY+AGL
Sbjct: 80  ALF-NDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGL 138

Query: 147 SGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRWXXXXXXX 206
           SGGNWLT TLA+NN+TSVQ I++   ++++IW+I++S L P   +  KT +RW       
Sbjct: 139 SGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQV 198

Query: 207 XXXXXAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADG 266
                AGFN+++ D+W RALAY ++P+L   G G TWS+LR+ ++F NGEMP PI+VADG
Sbjct: 199 QGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADG 258

Query: 267 RYPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNT 326
           RYPGTTVINLNAT+FE  PFE+GSWDP+LNAF+D+KYLGT VT+GKP  + +CI GFD+ 
Sbjct: 259 RYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKPETE-RCINGFDDA 317

Query: 327 GFITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPFKEANFLQ 386
            FI  TSS+LFN+F +  +S    +++  L++  ++ +   ++DIA+YAPNPFK + ++ 
Sbjct: 318 SFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVD 377

Query: 387 KNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYWPDGASLV 446
            N T+SI++S+ LFLVDGGED Q IP VPLL++ER+LD+IFA+D   +T D +P G  ++
Sbjct: 378 SNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMM 437

Query: 447 NTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPLIVYIPNS 506
            TY+RQF  QG  ++FPYVPD+ TFVNLGL  KP+F+GCDA NLTDLEYIPPLIVYIPNS
Sbjct: 438 KTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNS 497

Query: 507 RHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRRKQQNLNA 566
            HSF  N STFK++Y+ SER+GMI+N FEA T  N T+D+D++ CVGCAIIRRKQQ+LN 
Sbjct: 498 YHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNL 557

Query: 567 TLPSECSQCFTNYCWNGTID 586
           TLP  C +CFTNYCWNGTID
Sbjct: 558 TLPDICDKCFTNYCWNGTID 577

>Scas_92.0d
          Length = 236

 Score =  327 bits (839), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 175/206 (84%)

Query: 237 GGVGYTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPFEMGSWDPTLN 296
           GG  YTWSTLREADVFKN EMPFPI+VADGRYPGT VINLNAT+FEFNPFEMGSWD +L 
Sbjct: 19  GGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLR 78

Query: 297 AFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANL 356
           AFT+VKYLGT V NG P  KGQCIAGFDNTGFI  TSS+LFNQFLL+LN+T LPSFI  L
Sbjct: 79  AFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFLLQLNTTGLPSFIYKL 138

Query: 357 ATDFLEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPL 416
           A  FL  LSD+ DDIA+YAPNPFK    + +N T SI+ESE L+LVDGGED QNIPLVPL
Sbjct: 139 ANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQNIPLVPL 198

Query: 417 LQKERELDVIFALDNSADTDDYWPDG 442
           LQ+ERELDVIFALDNSADT+ YWP+G
Sbjct: 199 LQEERELDVIFALDNSADTNQYWPNG 224

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  233 bits (593), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 147/413 (35%), Positives = 219/413 (53%), Gaps = 59/413 (14%)

Query: 212 AGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGR-YPG 270
            GF++S  D WGRAL       L           L     FK  ++PFPI V++ +  P 
Sbjct: 189 KGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENCRNFKEFKVPFPIIVSNCKNSPS 248

Query: 271 TTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFIT 330
            TV+      FEF PFE GSWD  LN F  +KYLG+ + +GK     +C  GFD+ GFI+
Sbjct: 249 KTVV------FEFTPFEFGSWDEYLNEFIKLKYLGSKIVSGKTF---RCFNGFDDIGFIS 299

Query: 331 ATSSTLFNQFLLRL-----NSTD---------LPSFIANLATDF-LEDLSDN---SDDIA 372
           ATSS++FN  L+ +     NS+          + +F   L  D   +D+ +N     D A
Sbjct: 300 ATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLRLVKDMGAKDVPNNPLTRPDYA 359

Query: 373 IYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNS 432
           +Y PNPF +         + + +  +L+LVDGGE+ +NIP+ PLL  +R+LDVIFALD+S
Sbjct: 360 LYRPNPFYKL----LTVNNELTKENHLYLVDGGENGENIPIRPLLLPQRKLDVIFALDSS 415

Query: 433 ADTDDYWPDGASLVNTYQR-QFGSQGLNLS----------FPYVPDVNTFVNLGLNKKPT 481
           +D+++Y P+G  L N Y     G + LN++           PY+P+  +FV   L  +P 
Sbjct: 416 SDSNNY-PNGTILRNLYNNFHNGQESLNITREGITSNIDLLPYIPNSKSFVEQQLFSRPV 474

Query: 482 FFGCD----------ARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIK 531
            FGC               T+   +PP+++Y  N  HS++ N STFK SY+ SE  GM++
Sbjct: 475 AFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSYSSNTSTFKQSYNSSEIEGMLR 534

Query: 532 NGFEAATMGNFTDDSDFLGCVGCAIIRRK--QQNLNATLPSECSQCFTNYCWN 582
           NG     +  F  ++ +  C+GC II+R+  ++   A LP  C QC+ +YC+N
Sbjct: 535 NG---QDIFGFDANNTYHKCLGCIIIKREYDRRQTTAELPEFCHQCYQDYCFN 584

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 15/66 (22%)

Query: 135 GLLQGATYLAGLSGGNWLTSTLAWN--NWTSVQAIVDNTTESNSIWDISHSILTPDGINI 192
           GLL    Y++GLSGG+W+ ++L  +  N+ S+Q            W +  S+L   G+  
Sbjct: 15  GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQK-----------WKLDDSLLK--GVPN 61

Query: 193 FKTGSR 198
           F+ G++
Sbjct: 62  FEVGNK 67

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  225 bits (574), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 208/407 (51%), Gaps = 57/407 (14%)

Query: 213 GFNISLADVWGRALAYNFWPSLH--RGGVGYTWSTLREADVFKNGEMPFPITVADGRYPG 270
           GF +S  D WGRAL    W  ++     +         +++  N E P PI +A+ +   
Sbjct: 206 GFPVSFTDYWGRAL----WKKIYVNESMISSMSELFARSEITNNYEAPLPIIIANCK--N 259

Query: 271 TTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFIT 330
             ++N    +FEF PFE GSW+  L  F ++KYLG+N T G       C+ GFD+ GFIT
Sbjct: 260 EDLVN---AVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGV---AQSCVQGFDDIGFIT 313

Query: 331 ATSSTLFNQFLLRL------NSTDLPSFIANLATDFLEDLSDNSD-------DIAIYAPN 377
           ATSS+LFN  L+        +S      I  L + F  +L +  +       D A++ PN
Sbjct: 314 ATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNKPNSFFGTRSDFALFQPN 373

Query: 378 PFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDD 437
           PF    +      S +  S+ L+LVDGGED +NIPL P LQ ER++D+IFALD+S+   +
Sbjct: 374 PF----YRYPGVDSPLTNSDKLYLVDGGEDGENIPLRPFLQPERQVDLIFALDSSSGRIN 429

Query: 438 YWPDGASLVNTYQRQFGS------------QGLNLSFPYVPDVNTFVNLGLNKKPTFFGC 485
           Y P G  L N Y     +            Q +    PY+P    F   GL K+P  FGC
Sbjct: 430 Y-PTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAKGLLKRPVAFGC 488

Query: 486 -----DARNLTDLE---YIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAA 537
                  RN +       +PP++ Y  N   ++N N STFK+ Y+ SE  GM++NG   A
Sbjct: 489 YPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSEVQGMLENG---A 545

Query: 538 TMGNFTDDSDFLGCVGCAIIRRKQQNLNAT--LPSECSQCFTNYCWN 582
           ++    +++ +  CVGC +++R   N+NA+  LP  C QCF  YC+N
Sbjct: 546 SLFTHDNNTAYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN 592

>Kwal_0.173
          Length = 507

 Score =  217 bits (553), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 202/411 (49%), Gaps = 62/411 (15%)

Query: 212 AGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGRYPGT 271
           +GF IS  D WG AL  +  P+   G +    +   ++  F+  E+P PI VA+ +    
Sbjct: 119 SGFPISFTDYWGEALVTSIAPTHTTGSIS---AFADKSQRFQRYEVPLPIFVANCKND-- 173

Query: 272 TVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITA 331
              NL   +FEF PFE GSW   +  F  ++YLG+ +T G P    +CI GFD  GF+TA
Sbjct: 174 ---NLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTP---QKCIIGFDEVGFVTA 226

Query: 332 TSSTLFNQFLLRLNSTDLPSFIANLATDFL-----------------EDLSDNSDDIAIY 374
           TSS+LFN  L+ +     PS     A   +                 E    +  + AIY
Sbjct: 227 TSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANIMSHPEYAIY 286

Query: 375 APNPFKEANFLQKNATSSIIESE-YLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSA 433
            PNPF      +  ATS ++     L+LVDGGED +NIP+ PLL  ER+LDVIFALD+S+
Sbjct: 287 QPNPF-----YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLDVIFALDSSS 341

Query: 434 DTDDYWPDGASLVNTYQRQFGSQGLNLSFPY-----VPDVNTFVNLGLNKKPTFFGCD-- 486
           D   + P+G  L N YQ  +G      + PY     +P    FV   L  +P  FGC   
Sbjct: 342 DVCSF-PNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSRPVAFGCHME 400

Query: 487 ----------ARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEA 536
                      RN + LE +PP+++Y  N+ HSF  N STFK+ YS  E   M++NG   
Sbjct: 401 SYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFASNLSTFKLKYSKIEVEQMLRNG--- 456

Query: 537 ATMGNFTDDSDFLGCVGCAIIRRKQQN-----LNATLPSECSQCFTNYCWN 582
             + +F D   +  C+ C +++R             LP  C  CF+ YC+N
Sbjct: 457 KHIFSFDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  196 bits (498), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/392 (33%), Positives = 201/392 (51%), Gaps = 49/392 (12%)

Query: 213 GFNISLADVWGRALAYNFWPSLHRG-GVGYTWSTL-READVFKNGEMPFPITVADGRYPG 270
           GF IS  D WG+A+      +        +++S L   +  FK   +P PI VA+ +  G
Sbjct: 267 GFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVPIPIFVANCK-NG 325

Query: 271 TTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFIT 330
                L+  +FEF PFE GSW+  L  F  + YLG+ + +GK     +CI  FD+ GFIT
Sbjct: 326 L----LSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKA---EKCINNFDDLGFIT 378

Query: 331 ATSSTLFNQFLL------------RLNSTDLPSFIANLATDFLEDLSDNSD----DIAIY 374
           ATSS++FN  L+             + + ++   I  L  + +  +S +S     D A+Y
Sbjct: 379 ATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSISKDSSRLETDYAVY 438

Query: 375 APNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSAD 434
            PNPF    +L     + +    +L+LVDGGED +NIPL  L+  ERELDVIF LD+S+D
Sbjct: 439 QPNPF----YLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVIPERELDVIFVLDSSSD 494

Query: 435 TDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLE 494
            D+Y P+G+ L   +++    + ++  FP   +V TF +      P   GC+A   T  +
Sbjct: 495 IDNY-PNGSKLKRIFEK-LDEENVHYQFP--NNVKTFTH------PIVIGCNATKRTGHD 544

Query: 495 YIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSD--FLGCV 552
              P+I+Y  N+ H    N STFK++Y+ SE   M+  G      G F++D D  +  C+
Sbjct: 545 SFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTG-----RGVFSNDYDLYYKNCL 599

Query: 553 GCAIIRRKQQNL--NATLPSECSQCFTNYCWN 582
           GC + +R    L         C QCF +YC++
Sbjct: 600 GCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS 631

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 68/156 (43%), Gaps = 24/156 (15%)

Query: 31  PANVTCDDDINLVREASG-LSDNETEWLKKRDAYTKEALHSFLNRATSNFSDTSLLSTLF 89
           P  V C     L+REA   L   ET +LKK+   TK  L  FL   T    +    S  +
Sbjct: 20  PFQVQCPSS-PLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLT----EAKFSSKFY 74

Query: 90  GSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQGATYLAGLSGG 149
                + PKI +A SGGGYR               T   ++    GL + + Y+AGLSGG
Sbjct: 75  KRVLKDPPKIGIAISGGGYRSMLVG----------TGFISQMNDYGLFEYSDYIAGLSGG 124

Query: 150 NWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSIL 185
           +W+   L   N+  V++++         WD+   +L
Sbjct: 125 SWILMDLVVQNF-EVKSLLQE-------WDLEEDLL 152

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  182 bits (461), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 195/390 (50%), Gaps = 49/390 (12%)

Query: 213 GFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGRYPGTT 272
           GF IS  D W +AL  N         + Y+ S +R ++ FKN  +P PI VA+ R     
Sbjct: 150 GFPISFTDYWAQALVQNIKYRQLPTHLTYSKS-VRTSNYFKNYLVPIPIIVANCRNGF-- 206

Query: 273 VINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITAT 332
              L   +FEF P+E GSW+  L  F +++YLG+ + NG      QC  G D+ GFI AT
Sbjct: 207 ---LKNVIFEFTPWEFGSWEQVLGLFVNIEYLGSRIINGV---SHQCYKGLDDLGFIAAT 260

Query: 333 SSTLFNQFLL---RLNSTDLPSFIANL----------ATDFLEDLSDNSD-------DIA 372
           SS++FN  L+   +L S      IA +           T F   L  +S        D A
Sbjct: 261 SSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSSQITAALDTDYA 320

Query: 373 IYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNS 432
           +Y  NPF + +    N  + + +++YL+LVDGGED +NIP+  L+   R +D+I  +D+S
Sbjct: 321 VYRHNPFYKYS----NIKNELAQNDYLYLVDGGEDGENIPIRTLV--PRNVDMIMIMDSS 374

Query: 433 ADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTD 492
           +D  +Y  +G  L     +    +G+   +P    V +       K+PT  GC     +D
Sbjct: 375 SDKKNY-ANGDKLKIVLNQMKEKEGIYYRYP-TKIVTS------QKRPTIIGCKPPRTSD 426

Query: 493 LEYIPPLIVYIPNSRHSFNG--NQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLG 550
            + + P++VY PNS  S     N STFKM Y+  E+  +I +G+   T G+   + D+  
Sbjct: 427 TK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVT-GH--GEHDYQK 482

Query: 551 CVGCAIIRRKQQNLNATLPSECSQCFTNYC 580
           C+ C +++R     +   P +CS C++ YC
Sbjct: 483 CMACILVKRSYDQASIIPPKQCSICYSKYC 512

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 135 GLLQGATYLAGLSGGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSIL 185
           GL   + Y+AG+SGG+W    L  N +   + I        S WD+S S+L
Sbjct: 15  GLYHYSDYIAGISGGSWSVMDLVVNKFQLGKLI--------SGWDLSTSML 57

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  176 bits (445), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 133/406 (32%), Positives = 195/406 (48%), Gaps = 53/406 (13%)

Query: 212 AGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGRYPGT 271
           AGF ISL D  G+AL  +  P+  +  +    S   +++ FK  + P P+ VA+ +    
Sbjct: 293 AGFPISLTDYLGQALL-DRLPAQKQDHLK-QLSNFVQSESFKKFDAPIPVFVANAKTSKG 350

Query: 272 TVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITA 331
               L+  +FEF PFE GSW   ++ F   KYLG+    GK     +C+ GFDN GFITA
Sbjct: 351 P--ELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGKLT---KCVNGFDNLGFITA 405

Query: 332 TSSTLFNQFLL--------RLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPFKEAN 383
           TSS+LFN  L          + S +    I  +   F    +    D AIY PNPF    
Sbjct: 406 TSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAIRSDYAIYQPNPF---- 461

Query: 384 FLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYWPDGA 443
           +      + I ++  LFLVDGGED +NIPL  L    R+ DVIF +D+S+D ++  PD  
Sbjct: 462 YKDPEVLNLISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIVDSSSDKEN-LPDMT 520

Query: 444 SLVNTY--------QRQFGSQGLNL----SFPYVPDVNTFV--NLGLNKKPTFFGC---- 485
            L +TY        Q++  +    +      PY+P     +  N  L+  P  FGC    
Sbjct: 521 KLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFSLS-TPIAFGCHLQS 579

Query: 486 -DARNLTDL--------EYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEA 536
            + + LTD           +PP+++Y  N   +F  N STFK++Y+  E  GM+ NG   
Sbjct: 580 YNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYNGMLNNGHH- 638

Query: 537 ATMGNFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWN 582
               N     ++L C+GC ++ R+ Q L   + S C  C    C+N
Sbjct: 639 -LFNNDDTQGEYLQCLGCVMLLRQNQEL---VSSFCDACIRKVCYN 680

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 55/124 (44%), Gaps = 20/124 (16%)

Query: 29  YVPANVTCDDDINL-VREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNFSDTSLLST 87
           Y P NV C  D++L   +   LS  E ++L KR    K     F       + D ++   
Sbjct: 21  YAPVNVDCPKDLSLRAAKNEKLSALEFDYLSKRTEVIKGKFEKF-------YEDLAIPGI 73

Query: 88  LFGSNSSNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQGATYLAGLS 147
               +S   P+IAVA SGGG+R                 G  +HGL    +  +Y+AG+S
Sbjct: 74  --NVDSLQFPRIAVAISGGGFRSMLISSGFVL-------GMQQHGLW---ECTSYVAGIS 121

Query: 148 GGNW 151
           GG+W
Sbjct: 122 GGSW 125

>Scas_695.10
          Length = 553

 Score =  172 bits (435), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 123/373 (32%), Positives = 186/373 (49%), Gaps = 59/373 (15%)

Query: 213 GFNISLADVWGRALAY---NFWPSLHRGGVGYTWSTLREADV-FKNGEMPFPITVADGRY 268
           GF +S  D WG AL     N            ++S L E+++ F   E P PI VA+ R 
Sbjct: 191 GFFVSFTDYWGEALLKRLNNKDKKFSAFANTVSFSKLIESNLKFSKFEAPIPIFVANNRN 250

Query: 269 PGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGF 328
                  L   +FEF+PFE GSW+  L  F  + YLG+ + NG       C   FD+ GF
Sbjct: 251 G-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNG---TAKICYKEFDDIGF 302

Query: 329 ITATSSTLFNQFLL----RLNSTDLPSFIANLATDFLEDLSDNSD--------------- 369
           ITATSS++FN  L+    +++ + L +  +  A   L  L    D               
Sbjct: 303 ITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKPLTLSNTAIAPE 362

Query: 370 -DIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFA 428
            D A+Y  NPF    F   N  +++ + ++L+LVDGGED +NIPL  L+  ER++DVIFA
Sbjct: 363 TDYAVYYHNPF----FRYPNIDNALTKDDHLYLVDGGEDGENIPLRSLIIPERKVDVIFA 418

Query: 429 LDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDAR 488
           +D+S+D ++Y  +G  L+ T  R     G +   P +              P  FGC+A 
Sbjct: 419 IDSSSDVNNY-ANGTKLI-TILRHLEKLGYHYKIPKISKKRI-------NHPLIFGCNAP 469

Query: 489 NLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSD- 547
           +L       P+I+Y  N+ HS+  N STFK++Y+++E   M++NG     M  F D+ + 
Sbjct: 470 SL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNG-----MDIFNDNENI 517

Query: 548 -FLGCVGCAIIRR 559
            +  C+GC + +R
Sbjct: 518 YYQNCLGCILSKR 530

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 94  SNMPKIAVACSGGGYRXXXXXXXXXXXXDNRTDGANEHGLGGLLQGATYLAGLSGGNWLT 153
           SN P I VA SGGGYR              +          GL    +YL+GLSGG+W+ 
Sbjct: 6   SNPPNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVL 55

Query: 154 STLAWNNWTSVQAIVDNTTESNSIWDISHSIL--TPD 188
             L  NN+        N T+  + WD++  +L   PD
Sbjct: 56  MDLIVNNF--------NITKMINNWDLTEGLLQGIPD 84

>Scas_690.1*
          Length = 636

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 250 DVFKNGEMPFPITVADGRYPGTTVINLNA--TLFEFNPFEMGSWDPTLNA--FTDVKYLG 305
           +V++  ++ +   V +GRYP   ++NL+   ++ +F P +  +  P L A   TD+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYLLADRITDLTHPE 256

Query: 306 TNVTNGKPVNKGQCIAGFDNTGFITATSST 335
              T GK +++   I G+ +   + AT  T
Sbjct: 257 LIETQGKQIDRKVAIYGYLHGTPLPATGGT 286

>Kwal_55.19823
          Length = 379

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 19/90 (21%)

Query: 18  ENVNAWSPNNSYVPANVTCDDDINLVREASGLSDNE-TEWLKKRDAYTKEALHSFLNRAT 76
           +N++    + +YV  N   D+D+NL  E +   DN+ T+WL+    Y K  L S      
Sbjct: 30  DNIHVMRDSLNYVVDNFLVDNDLNLCIEKTSFRDNKATQWLR----YVKLLLSS------ 79

Query: 77  SNFSDTSLLSTLFGSNSSNMPKIAVACSGG 106
              +DT + S LF  N SN+    + CS G
Sbjct: 80  ---TDTLVKSMLF--NKSNL---LIHCSDG 101

>Kwal_56.24139
          Length = 463

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 250 DVFKNGEMPFPITVADGRYPGTTVINLNA--TLFEFNPFEMGSWDPTLNA--FTDVKYLG 305
           +V++  ++ +   V +GRYP   ++NL+   ++ +F P +  +  P L A   TD+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYLLADRITDITHPE 256

Query: 306 TNVTNGKPVNKGQCIAGF 323
              T GK +++   + G+
Sbjct: 257 LLETQGKQIDRKVALYGY 274

>YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein
           involved rRNA processing and 40S ribosomal subunit
           biogenesis, contains a GTP-binding domain, and interacts
           genetically with BMH1 [3552 bp, 1183 aa]
          Length = 1183

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 21/104 (20%)

Query: 224 RALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNA--TLF 281
           + L + FW  +++G   +  S                  V +GRYP   ++NL+   ++ 
Sbjct: 188 KRLKHRFWTEVYQGAKLFYLSG-----------------VINGRYPDREILNLSRFISVM 230

Query: 282 EFNPFEMGSWDPTLNA--FTDVKYLGTNVTNGKPVNKGQCIAGF 323
           +F P +  +  P + A  FTD+ +     T G  +++   I G+
Sbjct: 231 KFRPLKWRNEHPYMLADRFTDLTHPELIETQGLQIDRKVAIYGY 274

>CAGL0I00682g 50356..50925 similar to sp|P28627 Saccharomyces
           cerevisiae YMR150c IMP1 protease, start by similarity
          Length = 189

 Score = 30.4 bits (67), Expect = 3.4,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 7/65 (10%)

Query: 269 PGTTVIN-------LNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIA 321
           PGT VI         +   +EF      S  PTL+A  D  ++     NGK V  G CI 
Sbjct: 7   PGTYVIQSLCFLHVFHTYFYEFTETRGESMLPTLSATKDFVHVDKRYRNGKNVRLGDCIV 66

Query: 322 GFDNT 326
               T
Sbjct: 67  AVKPT 71

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 447 NTYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPLIV 501
           +++Q  FG +  +   PY+   N+F   G    P+  G  ARNL DLE+   LIV
Sbjct: 234 SSFQGLFGLRPTHGRLPYLKVDNSFE--GQELIPSVIGPLARNLEDLEFFMELIV 286

>KLLA0E11638g 1028781..1029998 some similarities with sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein, hypothetical start
          Length = 405

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/74 (20%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 298 FTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNSTDLPSFIANLA 357
           ++D+++L  N  +G        I  +D T   T    TL+++ + R+   D+P  +    
Sbjct: 139 YSDLRHLQVNQADGF-------ILCYDTTNPATLADMTLYHRIITRIKGDDVPIIVCGTK 191

Query: 358 TDFLEDLSDNSDDI 371
            D + +   + D++
Sbjct: 192 IDCISERKVSEDEV 205

>ADL239C [1502] [Homologous to ScYIL109C (SEC24) - SH; ScYNL049C
           (SFB2) - SH] (281426..284101) [2676 bp, 891 aa]
          Length = 891

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 14/70 (20%)

Query: 344 LNSTDLPSFIANLATDF--LEDLSDNS----DDIAIYAPNPFKEANFLQKNATSSIIESE 397
           L S  LP FI N+      L D+ D +    ++  I  P P         NATSS+ E  
Sbjct: 711 LESLPLPYFIKNIYPSVYSLHDMPDEAGLPNENGEIVLPQPI--------NATSSLFERY 762

Query: 398 YLFLVDGGED 407
            L+L+D G D
Sbjct: 763 GLYLLDTGMD 772

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,378,489
Number of extensions: 960003
Number of successful extensions: 2481
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2462
Number of HSP's successfully gapped: 40
Length of query: 652
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 544
Effective length of database: 12,857,365
Effective search space: 6994406560
Effective search space used: 6994406560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)