Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR006C (PLB2)70662430130.0
YMR008C (PLB1)66456220230.0
Scas_611.164656019620.0
Kwal_56.2251064156118500.0
Sklu_1900.165858418380.0
CAGL0J11770g65958918370.0
CAGL0J11748g69559518360.0
YOL011W (PLB3)68657018160.0
Scas_685.367756417960.0
KLLA0C05940g64056017670.0
Scas_644.870458217250.0
CAGL0E02321g70458416870.0
Scas_92.0d2362077141e-89
Sklu_2442.195844355711e-64
AAL027W5924185712e-64
Kwal_0.1735074355162e-57
YNL012W (SPO1)6314814872e-52
KLLA0F12232g6804154503e-47
CAGL0H03575g5144004329e-46
Scas_695.105533814199e-44
Scas_690.1*63678731.00
Kwal_56.2413946365731.2
KLLA0C09603g11079681.3
YPL217C (BMS1)118365703.0
CAGL0L01903g128753675.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR006C
         (694 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...  1165   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   783   0.0  
Scas_611.1                                                            760   0.0  
Kwal_56.22510                                                         717   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        712   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   712   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   711   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   704   0.0  
Scas_685.3                                                            696   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   685   0.0  
Scas_644.8                                                            669   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   654   0.0  
Scas_92.0d                                                            279   1e-89
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     224   1e-64
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   224   2e-64
Kwal_0.173                                                            203   2e-57
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   192   2e-52
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   177   3e-47
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   171   9e-46
Scas_695.10                                                           166   9e-44
Scas_690.1*                                                            33   1.00 
Kwal_56.24139                                                          33   1.2  
KLLA0C09603g complement(833552..833884) similar to sp|Q9Y909 Aer...    31   1.3  
YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein i...    32   3.0  
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    30   5.6  

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/624 (91%), Positives = 571/624 (91%)

Query: 1   MQLRNILQXXXXXXXXXXXXXXXXTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLK 60
           MQLRNILQ                TTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLK
Sbjct: 1   MQLRNILQASSLISGLSLAADSSSTTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLK 60

Query: 61  KRDAYTKEALHSFLSRAXXXXXXXXXXXXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXX 120
           KRDAYTKEALHSFLSRA                    VPKIGIACS              
Sbjct: 61  KRDAYTKEALHSFLSRATSNFSDTSLLSTLFSSNSSNVPKIGIACSGGGYRAMLGGAGMI 120

Query: 121 XXXDNRTDGANEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIW 180
              DNRTDGANEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIW
Sbjct: 121 AAMDNRTDGANEHGLGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIW 180

Query: 181 NITKSIVNPGGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAG 240
           NITKSIVNPGGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAG
Sbjct: 181 NITKSIVNPGGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAG 240

Query: 241 SALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAF 300
           SALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAF
Sbjct: 241 SALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAF 300

Query: 301 TDVKYLGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFAN 360
           TDVKYLGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFAN
Sbjct: 301 TDVKYLGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFAN 360

Query: 361 KYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIK 420
           KYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIK
Sbjct: 361 KYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIK 420

Query: 421 KERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTN 480
           KERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTN
Sbjct: 421 KERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTN 480

Query: 481 KPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAAT 540
           KPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAAT
Sbjct: 481 KPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAAT 540

Query: 541 MGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPELSGNST 600
           MGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPELSGNST
Sbjct: 541 MGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPELSGNST 600

Query: 601 YQSGAIASAISEATDGIPITALLG 624
           YQSGAIASAISEATDGIPITALLG
Sbjct: 601 YQSGAIASAISEATDGIPITALLG 624

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/562 (65%), Positives = 444/562 (79%), Gaps = 1/562 (0%)

Query: 30  YAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXXXX 89
           Y P+ + C  DD +LVR ASGLS  ET+WLKKRDAYTKEALHSFL+RA            
Sbjct: 29  YVPANVTC-DDDINLVREASGLSDNETEWLKKRDAYTKEALHSFLNRATSNFSDTSLLST 87

Query: 90  XXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSGLS 149
                   +PKI +ACS                 DNRTDGANEHGLGGLLQ +TYL+GLS
Sbjct: 88  LFGSNSSNMPKIAVACSGGGYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQGATYLAGLS 147

Query: 150 GGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQEVQ 209
           GGNWLT TLAWNNWTSVQ IVD+ +ES+SIW+I+ SI+ P G N+  T  RW+ I  +VQ
Sbjct: 148 GGNWLTSTLAWNNWTSVQAIVDNTTESNSIWDISHSILTPDGINIFKTGSRWDDISDDVQ 207

Query: 210 AKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADGR 269
            K DAGFNISL+D+W RAL+YNF+PSL   G   TWS+LR+ DVFKNGEMP PITVADGR
Sbjct: 208 DKKDAGFNISLADVWGRALAYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGR 267

Query: 270 YPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNAG 329
           YPGTTVINLNATLFEF PFEMGSWDP+LNAFTDVKYLGTNVTNGKPVNK QC++G+DN G
Sbjct: 268 YPGTTVINLNATLFEFNPFEMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTG 327

Query: 330 FVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFVDR 389
           F+ ATS++LFN+F L  +++     I + A  ++ +LS + DDIAIYA NPFK+  F+ +
Sbjct: 328 FITATSSTLFNQFLLRLNSTDLPSFIANLATDFLEDLSDNSDDIAIYAPNPFKEANFLQK 387

Query: 390 NYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMTN 449
           N TSSI++++ LFLVDGGED QN+PLVPL++KER+LDV+FALD S +TD+ WP G  + N
Sbjct: 388 NATSSIIESEYLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTDDYWPDGASLVN 447

Query: 450 TYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNTK 509
           TY+RQ+  QG  ++FPYVPDVNTF+NLGL  KPTFFGCDA+NLTDLEYIPPL+VYIPN++
Sbjct: 448 TYQRQFGSQGLNLSFPYVPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPLIVYIPNSR 507

Query: 510 HSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLNAT 569
           HSFNGNQST KM+Y+ +ERLGMI+NGFEAATMGNFTDDS+FLGC+GCAIIRRKQ++LNAT
Sbjct: 508 HSFNGNQSTFKMSYSDSERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRRKQQNLNAT 567

Query: 570 LPPECTKCFADYCWNGTLSTSA 591
           LP EC++CF +YCWNGT+ + +
Sbjct: 568 LPSECSQCFTNYCWNGTIDSRS 589

>Scas_611.1
          Length = 646

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/560 (62%), Positives = 429/560 (76%), Gaps = 1/560 (0%)

Query: 28  DGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXX 87
           + Y P+ + C  D+ +L+R A+ LS  E  WL KRDA T EAL SFL R+          
Sbjct: 25  NSYVPANVTC-DDNINLIREANSLSDDEKSWLTKRDAITSEALESFLKRSTSNFSDTSLI 83

Query: 88  XXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSG 147
                      P+IG+ACS                 DNRTDGANEHGLGGLLQ +TYL+G
Sbjct: 84  SQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVAAMDNRTDGANEHGLGGLLQGATYLAG 143

Query: 148 LSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQE 207
           LSGGNWLT TL WNNWTSVQ I+++M+  DSIW+I+ SI+NPGG N+  T ERW+ I   
Sbjct: 144 LSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWDISHSIINPGGWNILETGERWDHISDA 203

Query: 208 VQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVAD 267
           VQAK DAGFNISL+D+W RALSYNFFPSL   G   TWS+LRD DVFKN EMP PI+VAD
Sbjct: 204 VQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQGYTWSTLRDADVFKNAEMPFPISVAD 263

Query: 268 GRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDN 327
           GRYPGTTVINLNAT+FEF PFEMGSWDP+LN FTDVKYLGTNV+NGKP+ + +C++G+DN
Sbjct: 264 GRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFTDVKYLGTNVSNGKPITEGKCIAGFDN 323

Query: 328 AGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFV 387
            GF+  TS++LFN+F L  ++++    I   A+ ++N+LS D +DIAIY+ NPF+D +F+
Sbjct: 324 TGFITGTSSTLFNQFLLHINSTSLPSFITKLASHFLNDLSADYNDIAIYSPNPFRDADFI 383

Query: 388 DRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCM 447
             NY+ SIV + DLFLVDGGED QN+PLVPL++KER+LDV+FALD S +T++SWP G  +
Sbjct: 384 ASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLLQKERELDVIFALDNSADTNQSWPDGASL 443

Query: 448 TNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPN 507
            NTYERQ+  QG GMAFPYVPD NTF+NLGL  +PTFFGCDA+NLTDLEYIPPLVVYIPN
Sbjct: 444 VNTYERQFGMQGNGMAFPYVPDKNTFVNLGLNKRPTFFGCDARNLTDLEYIPPLVVYIPN 503

Query: 508 TKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLN 567
            +HSFNGNQST KM+Y+ +ER  MI+NGFE+AT GNFTDDS+FLGCIGCAI+RRKQ+S+N
Sbjct: 504 ARHSFNGNQSTFKMSYSTSERFSMIQNGFESATRGNFTDDSDFLGCIGCAIMRRKQQSMN 563

Query: 568 ATLPPECTKCFADYCWNGTL 587
           ATLP EC +CF +YCWNGT+
Sbjct: 564 ATLPTECNQCFTNYCWNGTI 583

>Kwal_56.22510
          Length = 641

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/561 (58%), Positives = 417/561 (74%), Gaps = 3/561 (0%)

Query: 28  DGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXX 87
           D Y P  + C +DD +LVR AS LS  ET+WLKKRDAYTKEAL +FL RA          
Sbjct: 22  DSYVPGNVSC-ADDINLVRKASSLSPNETEWLKKRDAYTKEALRTFLDRATSNFSNSSLV 80

Query: 88  XXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSG 147
                     +P+I +ACS                 DNRT+GA EHGLGGLLQS+TYL+G
Sbjct: 81  DNVWKSGK--IPRIAVACSGGGYRAMLSGAGMLSAMDNRTNGATEHGLGGLLQSTTYLAG 138

Query: 148 LSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQE 207
           LSGGNWL G+LAWNNWTSVQ I+D     D +W+I+ SI+NPGG N+  +  RW+ I   
Sbjct: 139 LSGGNWLVGSLAWNNWTSVQHIIDTRGTDDELWDISNSILNPGGVNILTSANRWDQISDA 198

Query: 208 VQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVAD 267
           V+AK DAGFN SL+D+W RALSY+FFP+L   G   TWS+LRD DVFKNGEMP PI+VAD
Sbjct: 199 VEAKGDAGFNTSLADVWGRALSYDFFPTLYKGGLGYTWSTLRDADVFKNGEMPFPISVAD 258

Query: 268 GRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDN 327
           GRYPGT +I+LN+TLFEF PFEMGSWDPSLNAFTDVKYLGT V NG PV + QCV+G+DN
Sbjct: 259 GRYPGTQIIDLNSTLFEFNPFEMGSWDPSLNAFTDVKYLGTEVKNGTPVTQGQCVAGFDN 318

Query: 328 AGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFV 387
            GFV+ TS++LFN+F L+ +T++    +  F   ++ +LS+D +DIAIY  NPF+DT +V
Sbjct: 319 TGFVMGTSSTLFNQFLLQLNTTSVSSFLKGFIQDFLQDLSEDSNDIAIYNPNPFRDTAYV 378

Query: 388 DRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCM 447
           D+NYT  IV++++LFLVDGGEDG+N+PLVPLI+++RD+DV+FALD S +TDE WP+G+ +
Sbjct: 379 DKNYTHGIVNSENLFLVDGGEDGENIPLVPLIQQDRDVDVIFALDNSADTDEYWPAGLSL 438

Query: 448 TNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPN 507
            +TYERQ+  QGK +AFPYVPDV+TF+N GL  KP FFGCDA N +DL Y PPL+VY+PN
Sbjct: 439 MHTYERQFGPQGKDIAFPYVPDVDTFVNEGLNTKPVFFGCDATNTSDLAYTPPLIVYMPN 498

Query: 508 TKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLN 567
            + S+N N ST KM+Y+ ++R+ M +NGFEA T  N TDDSNF+GC+ CA++RRKQES N
Sbjct: 499 NRQSYNSNTSTFKMSYSSSQRMKMYQNGFEAITRNNLTDDSNFMGCVACAVLRRKQESQN 558

Query: 568 ATLPPECTKCFADYCWNGTLS 588
            T P ECTKCF +YCW+G  S
Sbjct: 559 MTFPEECTKCFQNYCWDGKTS 579

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/584 (58%), Positives = 425/584 (72%), Gaps = 10/584 (1%)

Query: 28  DGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXX 87
           + Y P  + C  DD +LVR A GLST E++WLKKR+ YT  AL  FL+RA          
Sbjct: 21  NSYTPGNVTC-DDDINLVREAVGLSTDESEWLKKREVYTNSALEDFLNRATENFTDNSIV 79

Query: 88  XXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSG 147
                      P+IG+ACS                 DNRT G+ EHGLGGLLQS+TYL+G
Sbjct: 80  KTLFNSSS--APRIGVACSGGGYRAMLSGAGMLAAMDNRTRGSVEHGLGGLLQSTTYLAG 137

Query: 148 LSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQE 207
           LSGGNWL GTLAWNNWTSVQ I+D M + D IW+I+ SI++PGG+N+  T  RW+ I   
Sbjct: 138 LSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIWDISNSIISPGGTNVLETTSRWDDISDA 197

Query: 208 VQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVAD 267
           V AK DAGFN SL+D+W RALSY+FFP+LP+ G A TWS+LR+ DVFKN EMP PI+VAD
Sbjct: 198 VDAKQDAGFNASLTDVWGRALSYDFFPTLPNGGDAYTWSTLREADVFKNAEMPFPISVAD 257

Query: 268 GRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDN 327
           GRYPGT VINLNAT+FEF PFEMGSWD SL AFT+VKYLGT V NG P  K QC++G+DN
Sbjct: 258 GRYPGTQVINLNATVFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFDN 317

Query: 328 AGFVIATSASLFNEFSLEASTSTYY------KMINSFANKYVNNLSQDDDDIAIYAANPF 381
            GF++ TS+SLFN+FSL+++++           +  FANK++  LS+D DDIA+YA NPF
Sbjct: 318 TGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSYLYKFANKFLTGLSKDYDDIALYAPNPF 377

Query: 382 KDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESW 441
           K T +V  NYT SIV+++ L+LVDGGEDGQN+PL+PL+++ER+LDV+FALD S +T++ W
Sbjct: 378 KGTNYVFENYTRSIVESEILYLVDGGEDGQNIPLIPLLQEERELDVIFALDNSADTNQYW 437

Query: 442 PSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPL 501
           P+G  +T TYERQ+ KQG  +AFPYVPDV+TF+ LGL  +PTFFGCDA NLTDL+YIPPL
Sbjct: 438 PNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFVELGLNKRPTFFGCDATNLTDLDYIPPL 497

Query: 502 VVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRR 561
           VVY+PNTK SFN NQST K++Y+   R  MI+NGFEA T  N TDDS+F+ C+ CA+IRR
Sbjct: 498 VVYMPNTKESFNSNQSTFKLSYSSENRRAMIKNGFEAVTRNNLTDDSDFVSCVACAVIRR 557

Query: 562 KQESLNATLPPECTKCFADYCWNGTLST-SANPELSGNSTYQSG 604
           KQ+S+NATLP EC KCF +YCWN   S  SA+     N T  SG
Sbjct: 558 KQQSMNATLPEECEKCFTNYCWNDNASKGSASISSYNNQTITSG 601

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/589 (56%), Positives = 436/589 (74%), Gaps = 7/589 (1%)

Query: 30  YAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXXX- 88
           Y P+ + CP +D +L+RNA+GLS +E DWLKKRD  T+EAL SFL R             
Sbjct: 29  YVPANVTCP-NDINLLRNATGLSQSEIDWLKKRDVNTREALESFLKRVTSNFTSNSSASN 87

Query: 89  ---XXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYL 145
                       +PKIGIA S                 DNRTDGANEHGLGGLLQ++TYL
Sbjct: 88  LIDQLFSTNSSNIPKIGIAASGGGYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATYL 147

Query: 146 SGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIV 205
           +GLSGGNWLT TL+WNNWTSVQ+IVD      +IW+I+ SIV+PGG N+  T  RW+ I 
Sbjct: 148 AGLSGGNWLTTTLSWNNWTSVQDIVDSQDNDSAIWDISHSIVSPGGINIFKTGSRWDHIS 207

Query: 206 QEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITV 265
             V+ K  AGFN+SL+D+W RALSY FFP+L   G A  WS LR+ DVFKN EMP+PI+V
Sbjct: 208 DAVEDKQKAGFNVSLADVWGRALSYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPISV 267

Query: 266 ADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGY 325
           ADGRYPGT VI+LN+T+FE++PFE+GSWDPSL+AFTDV+YLGT V++GKP  + +C++G+
Sbjct: 268 ADGRYPGTAVIDLNSTVFEYSPFELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGF 327

Query: 326 DNAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTE 385
           DN GF++ TS++LFN+F L  + ++  K I + A  ++ +LS+D DDIA+YA NPF+D +
Sbjct: 328 DNVGFLMGTSSTLFNQFLLRINDTSIPKFIRNLATHFLKDLSEDYDDIAVYAPNPFRDAD 387

Query: 386 FVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGV 445
           +V+ N + S+ +++ LFLVDGGEDGQN+PLVPLI++ERDLD+VFALD S +T+E+WP G 
Sbjct: 388 YVNNNRSKSLSESEYLFLVDGGEDGQNVPLVPLIQQERDLDIVFALDNSADTEENWPDGA 447

Query: 446 CMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYI 505
            + +TY RQ+  QG+G+ FP VP  +TF+NLGL  KPTFFGCDA+N+TDLEYIPPL+VYI
Sbjct: 448 SLMHTYRRQFGFQGQGVTFPSVPGTDTFVNLGLNKKPTFFGCDARNMTDLEYIPPLIVYI 507

Query: 506 PNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQES 565
           PN++HS+NGN ST K++Y+  ERLG+IRNGFEAATM N T DSNF GCIGCAI+RRKQ++
Sbjct: 508 PNSRHSYNGNTSTFKLSYSEKERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQA 567

Query: 566 LNATLPPECTKCFADYCWNGTLSTSANPELSGNSTYQ--SGAIASAISE 612
           LN TLP EC  CF +YCWNGT+  +    ++ ++ +   SG+ A+ ++E
Sbjct: 568 LNLTLPKECETCFTNYCWNGTIDNTPAKGVTASNDFDNASGSAAADMAE 616

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/595 (56%), Positives = 450/595 (75%), Gaps = 6/595 (1%)

Query: 30  YAPSIIPCPSDDTSLVRNAS-GLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXXX 88
           Y P  + CP D+ + +RNA+ GLS AE +WLKKRD  T++AL +FL RA           
Sbjct: 22  YTPQNVSCP-DNANFIRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFANVSTEITSA 80

Query: 89  XXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSGL 148
                    VPK+GIA +                 DNRTDGANEHGLGGLLQ++TY++GL
Sbjct: 81  LFNDTEN--VPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGLGGLLQAATYMAGL 138

Query: 149 SGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQEV 208
           SGGNWLTGTLA+NN+TSVQ+I++   ++D+IWNIT S +NP   + + T+ RW +I  +V
Sbjct: 139 SGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFSKTLARWTAIGSQV 198

Query: 209 QAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADG 268
           Q K DAGFN++++DLW+RAL+Y +FP+LP+AG+ LTWSSLRD ++F NGEMP+PI+VADG
Sbjct: 199 QGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFMNGEMPMPISVADG 258

Query: 269 RYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDNA 328
           RYPGTTVINLNAT+FE TPFE+GSWDPSLNAF+D+KYLGT VT+GKP   ++C++G+D+A
Sbjct: 259 RYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP-ETERCINGFDDA 317

Query: 329 GFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFVD 388
            F++ TS+SLFNEF++   ++  Y  +N+ ++  V  + ++++DIA+YA NPFK +++VD
Sbjct: 318 SFIMGTSSSLFNEFTMSNDSAVAYTYLNTLSSTLVKGIDKENNDIAMYAPNPFKGSKYVD 377

Query: 389 RNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMT 448
            NYT+SIVD+D LFLVDGGED Q +P VPL+K+ERDLD++FA+D+   T +++P+G  M 
Sbjct: 378 SNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDVDTETSDNYPAGGPMM 437

Query: 449 NTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNT 508
            TYERQ+SKQGKGMAFPYVPD+ TF+NLGL  KP+F+GCDA NLTDLEYIPPL+VYIPN+
Sbjct: 438 KTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLTDLEYIPPLIVYIPNS 497

Query: 509 KHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLNA 568
            HSF  N ST K+NYN +ER+GMIRN FEA T  N T+D++++ C+GCAIIRRKQ+SLN 
Sbjct: 498 YHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTCVGCAIIRRKQQSLNL 557

Query: 569 TLPPECTKCFADYCWNGTLSTSANPELSGNSTYQSGAIASAISEATDGIPITALL 623
           TLP  C KCF +YCWNGT+  +    L+ N+     AI+SAI+  TD  PI ALL
Sbjct: 558 TLPDICDKCFTNYCWNGTIDNTPTKLLTPNNQ-DPAAISSAIAAVTDDSPIGALL 611

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/570 (57%), Positives = 421/570 (73%), Gaps = 3/570 (0%)

Query: 28  DGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXX 87
           D Y P  + CP DD +LVR A+ +S  E+ WL+KR+  T  AL  FL+RA          
Sbjct: 31  DSYVPGTVSCP-DDINLVREATSISQNESAWLEKRNKVTSVALKDFLTRATANFSDSSEV 89

Query: 88  XXXXXX--XXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYL 145
                       +PKI +A S                 DNRT+GA EHGLGGLLQS+TYL
Sbjct: 90  LSKLFNDGNSENLPKIAVAVSGGGYRSMLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYL 149

Query: 146 SGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIV 205
           SG SGGNWL GTLA NNWTSVQ+I+++M   DSIW+++ SIV PGG N+  T +RW+ I 
Sbjct: 150 SGASGGNWLVGTLALNNWTSVQDILNNMQNDDSIWDLSDSIVTPGGINIFKTAKRWDHIS 209

Query: 206 QEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITV 265
             V++K +A +N SL+D+W RAL+YNFFPSL   G  LTWSS+RD  VF+N EMP PI+V
Sbjct: 210 NAVESKQNADYNTSLADIWGRALAYNFFPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISV 269

Query: 266 ADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGY 325
           ADGRYPGT VINLNAT+FEF PFEMGSWDPSLN+F +VKYLGTNV+NG P+ + +C +G+
Sbjct: 270 ADGRYPGTKVINLNATVFEFNPFEMGSWDPSLNSFANVKYLGTNVSNGVPLERGKCTAGF 329

Query: 326 DNAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTE 385
           DNAGF++ TS++LFN+F L  +++     I   A  ++ +LSQD +DIA+Y+ NPFKDT+
Sbjct: 330 DNAGFIMGTSSTLFNQFLLRINSTHLPSFITRLARHFLKDLSQDFNDIAVYSPNPFKDTK 389

Query: 386 FVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGV 445
           F+D +YT+SIVD+D LFLVDGGED +N+P++PLI+KERD+D++FA+D S +   +WP G 
Sbjct: 390 FLDSDYTTSIVDSDSLFLVDGGEDDENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGS 449

Query: 446 CMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYI 505
            + +TYERQ+ KQG+GM+FPYVPD NTF+NLGL  KPTFFGCDA NLTDL+YIPPLVVY+
Sbjct: 450 SLVHTYERQFVKQGQGMSFPYVPDTNTFVNLGLNKKPTFFGCDANNLTDLQYIPPLVVYL 509

Query: 506 PNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQES 565
           PN ++SFN NQS  K++Y+ ++R  MI+NGFE AT  NFTDD  F+GC+GCAIIRRKQ++
Sbjct: 510 PNAEYSFNSNQSAFKLSYSESQRRSMIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQA 569

Query: 566 LNATLPPECTKCFADYCWNGTLSTSANPEL 595
           LN TLPPEC  CF +YCWNGTL T+  P++
Sbjct: 570 LNITLPPECETCFKNYCWNGTLDTTPLPDV 599

>Scas_685.3
          Length = 677

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/564 (59%), Positives = 422/564 (74%), Gaps = 5/564 (0%)

Query: 28  DGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXX 87
           +GYAP+ + C +DD +L+R AS LS  E DWLKKR+  T E+L +FL R+          
Sbjct: 24  NGYAPANVTC-ADDVNLLREASDLSKDEQDWLKKRNTITAESLKTFLDRSTKNFSDSSSS 82

Query: 88  XXXXX-XXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLS 146
                      VPKIGIA S                 DNRT GAN+HGLGGLLQSSTYL+
Sbjct: 83  LLNKLFQDGDNVPKIGIAASGGGYRAMLAGAGMLAAMDNRTSGANDHGLGGLLQSSTYLA 142

Query: 147 GLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQ 206
           GLSGGNWLT TLAWNNWTSVQ+I+D+++  +SIW+I  S+ +   S +  +   W  I  
Sbjct: 143 GLSGGNWLTTTLAWNNWTSVQDIIDNITVENSIWDIDNSLFSI--SEMANS-SIWTDIAN 199

Query: 207 EVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVA 266
           +V+AK DAGFN++L+DLW RAL+YNFFP L   G+  TWS+LRD +VFKN EMP PITVA
Sbjct: 200 DVKAKQDAGFNVTLADLWGRALAYNFFPDLYHGGAGYTWSTLRDSEVFKNAEMPFPITVA 259

Query: 267 DGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYD 326
           DGRYPGTTVI+LNAT+FEF PFEMGSWDP+LN+FTDVKYLGTNV+NGKP++  QCV+G+D
Sbjct: 260 DGRYPGTTVISLNATVFEFNPFEMGSWDPTLNSFTDVKYLGTNVSNGKPIDAGQCVAGFD 319

Query: 327 NAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEF 386
           NAGFV+ TSA+LFN   L  ++S   K ++   + +  +L+   +DIAIY+ NPF+D + 
Sbjct: 320 NAGFVLGTSATLFNLMPLPFTSSMLPKSLSVLGDNFTASLADTYNDIAIYSPNPFRDADS 379

Query: 387 VDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVC 446
           V  N++ +IVD+DDLFLVDGGEDG+ +PLVPL++++R LDVVFALD + +T  SWP G  
Sbjct: 380 VKSNFSKAIVDSDDLFLVDGGEDGEVIPLVPLLQEKRGLDVVFALDFNSDTTTSWPDGSS 439

Query: 447 MTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIP 506
           +  TY+RQ+  QG+GM+FPYVPD  TF+  GL  KPTFFGCDAKNLTDLEYIPPL+VYIP
Sbjct: 440 LVATYQRQFEDQGEGMSFPYVPDTETFIKYGLNTKPTFFGCDAKNLTDLEYIPPLIVYIP 499

Query: 507 NTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESL 566
           N+++SFN N STL+++YN ++RLGMI+NGFE+AT GNFTDD  FLGCIGCAI+RRKQ+SL
Sbjct: 500 NSRYSFNSNTSTLQLSYNSSQRLGMIQNGFESATRGNFTDDPEFLGCIGCAIMRRKQQSL 559

Query: 567 NATLPPECTKCFADYCWNGTLSTS 590
           N TLP EC +CF +YCWNGTL+ S
Sbjct: 560 NETLPSECEQCFTNYCWNGTLAGS 583

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/560 (58%), Positives = 404/560 (72%), Gaps = 1/560 (0%)

Query: 28  DGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXX 87
           +GYAP ++ C  ++ +LVR A  +S  E DWLK R   T  AL  FL R           
Sbjct: 30  NGYAPGVVDC-DENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQRGFKGFTNDTSI 88

Query: 88  XXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSG 147
                      PK+ IACS                 DNRTDGAN+HGLGGLLQSSTYL+G
Sbjct: 89  IDKLLATQDTAPKVAIACSGGGYRAMLSGAGMISAMDNRTDGANDHGLGGLLQSSTYLAG 148

Query: 148 LSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNLTYTIERWESIVQE 207
           LSGGNWL GTLA+NNWTSVQ I+++M++ +SIW+I+ SIVNPGG N+  +I RW+ I   
Sbjct: 149 LSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNPGGINIFSSISRWDDISDA 208

Query: 208 VQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVAD 267
           V+ K  AGFN S++D+W RALSYNFFPSL + G   TW++LRDVDVFKNGEMP PI+VA 
Sbjct: 209 VEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLRDVDVFKNGEMPFPISVAV 268

Query: 268 GRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGYDN 327
           GRYPGT V+NLNAT+FEF PFEMGSWD +L+ FTDV+Y GTNVTNG P    +CV+G+DN
Sbjct: 269 GRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTNVTNGTPNVTGKCVAGFDN 328

Query: 328 AGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFV 387
            GFV+ TS+SLFN+F L+ +T+     + +  + ++ + S D DDI+I+A NPF +   +
Sbjct: 329 TGFVMGTSSSLFNQFLLQLNTTDLPSFLYNLLHGFLTDASDDYDDISIWAPNPFYEITNI 388

Query: 388 DRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCM 447
             NY+ SI + D L+LVDGGEDGQN+PL PL++ ER++DV+FALD S +TD+SWP G  +
Sbjct: 389 PSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDVIFALDNSADTDQSWPDGFSL 448

Query: 448 TNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPN 507
           T TY RQ+  QGKG+AFPYVPDVNTF NLGL  +PTFFGCDA+NLTDLE IPPLVVY+PN
Sbjct: 449 TQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGCDARNLTDLESIPPLVVYMPN 508

Query: 508 TKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLN 567
           T+ SFN N ST KM+Y+ +ER  MI+NGFEA TM N T D NF+GCI CAI+RRKQESLN
Sbjct: 509 TRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKDENFMGCISCAILRRKQESLN 568

Query: 568 ATLPPECTKCFADYCWNGTL 587
            TLP EC  CF  YCWNGT+
Sbjct: 569 YTLPSECDACFEKYCWNGTV 588

>Scas_644.8
          Length = 704

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/582 (54%), Positives = 405/582 (69%), Gaps = 15/582 (2%)

Query: 28  DGYAPSIIPCPS-------DDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXX 80
           + YAPS + C         +D SL+R A  +S  E+ WL+KR   T+E L  FL+R+   
Sbjct: 27  NSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFLNRSLTS 86

Query: 81  XX------XXXXXXXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHG 134
                                   PKIGIA S                 DNRT GA  HG
Sbjct: 87  LNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHHG 146

Query: 135 LGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNL 194
           LGGLLQS+TYLSG SGGNWL GTLA+NNWTSVQ I+D+ +ESDSIW++++SIV+PGG N+
Sbjct: 147 LGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSPGGKNI 206

Query: 195 TYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVF 254
             +  RW+ I   +Q K  AGF+ SL+D+W RALSY FFPSL   G A TWSSLRD  VF
Sbjct: 207 FKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDSPVF 266

Query: 255 KNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGK 314
             G+MP PI+VADGRYPG+ V+NLNAT+FEF PFEMGSWDPSLN FTDVK+LGTNV+ GK
Sbjct: 267 TEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGK 326

Query: 315 PVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYY--KMINSFANKYVNNLSQDDDD 372
           P++  +CV G+DN  F++ TS++LFN+F L  +++  +    I   A  ++ ++SQD +D
Sbjct: 327 PIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDISQDFND 386

Query: 373 IAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALD 432
           +A Y  NPFKD  F+D NYT SIV++  L+LVDGGED +N+PL+PLI++ERDLD+VFA+D
Sbjct: 387 VATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVFAID 446

Query: 433 ISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNL 492
            S +   +WP G  + +T+ERQ+ +QG+GMAFPYVP  +TF+NLGL  KPTFFGCDA NL
Sbjct: 447 NSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGCDAHNL 506

Query: 493 TDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLG 552
           TDLEYIPPLV+Y+PN ++SF  NQS  K++Y   +R  MI NGFE AT  NFTDD +FLG
Sbjct: 507 TDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDDPDFLG 566

Query: 553 CIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPE 594
           CIGCAIIRRKQ+SLN TLP  C  CF +YCWNGTL T+  P+
Sbjct: 567 CIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTPLPD 608

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/584 (52%), Positives = 406/584 (69%), Gaps = 14/584 (2%)

Query: 25  TTGDGYAPSIIPCPSDDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXX 84
           +  D YAP +  CPSDD +LVR ASGLS  ET WL++RD  TKEALH+FL RA       
Sbjct: 21  SVADQYAPKLAYCPSDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQRATSSSQNF 80

Query: 85  XXXXXXXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTY 144
                        VP+IGIA S                 DNRT GA +HGLGG+LQS+TY
Sbjct: 81  TQLFHRIFDAGM-VPRIGIAVSGGGYRSMLTGAGILSAFDNRTRGAMDHGLGGILQSTTY 139

Query: 145 LSGLSGGNWLTGTLAWNNWTSVQEIVDHMSE-----------SDSIWNITKSIVNPGGSN 193
           ++G SGGNWL  +L+WNNWTSVQ+I+D   +            D IW+++ SIV+PGG N
Sbjct: 140 MTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDPIWDLSDSIVSPGGLN 199

Query: 194 LTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDV 253
           +  T  RW+ I   V+AK +AGFN SL+D+W RALSY FFP+L   G   TWSSLRD  +
Sbjct: 200 IIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLERGGIDYTWSSLRDSPI 259

Query: 254 FKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNG 313
           F+ G+MPLPITVADGRYPG+  I LNAT+FEF PFEMGSWDPSLNAFTDVKYLGTNVTNG
Sbjct: 260 FQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLNAFTDVKYLGTNVTNG 319

Query: 314 KPV--NKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINSFANKYVNNLSQDDD 371
           KPV     +C+ G+DN  F++ TS++LFN+F L  +++     +  +A   + + + + +
Sbjct: 320 KPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINSTHLPNFVTKWATNLLKSWAHEFN 379

Query: 372 DIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFAL 431
           D+A+Y  NPFKDT +V  N+++SIVD++ L+LVDGGED +N+PL+PL++++RDLD++FA+
Sbjct: 380 DVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVPLIPLLQRDRDLDIIFAI 439

Query: 432 DISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKN 491
           D S +    WP G  + +TYERQ+  QG+ +AFP++PD NTF+NLGL  +PTFFGC+A N
Sbjct: 440 DNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFINLGLNKRPTFFGCNATN 499

Query: 492 LTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFL 551
           +T L+YIPPLVVY PN+++SFN NQS  K++Y+  +   MI NGFE AT  NFTDD  F+
Sbjct: 500 MTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISNGFEIATRNNFTDDPEFI 559

Query: 552 GCIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPEL 595
           GCI CAI++RKQE+L+  LP EC +C A YCW+GT+  +   EL
Sbjct: 560 GCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDEL 603

>Scas_92.0d
          Length = 236

 Score =  279 bits (714), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 164/207 (79%)

Query: 238 DAGSALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSL 297
           + G A TWS+LR+ DVFKN EMP PI+VADGRYPGT VINLNAT+FEF PFEMGSWD SL
Sbjct: 18  NGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSL 77

Query: 298 NAFTDVKYLGTNVTNGKPVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYYKMINS 357
            AFT+VKYLGT V NG P  K QC++G+DN GF++ TS+SLFN+F L+ +T+     I  
Sbjct: 78  RAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFLLQLNTTGLPSFIYK 137

Query: 358 FANKYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVP 417
            ANK++  LS D DDIA+YA NPFK T  V  NYT SIV+++ L+LVDGGEDGQN+PLVP
Sbjct: 138 LANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESEILYLVDGGEDGQNIPLVP 197

Query: 418 LIKKERDLDVVFALDISDNTDESWPSG 444
           L+++ER+LDV+FALD S +T++ WP+G
Sbjct: 198 LLQEERELDVIFALDNSADTNQYWPNG 224

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 143/435 (32%), Positives = 225/435 (51%), Gaps = 59/435 (13%)

Query: 192 SNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDV 251
            N   T+E + ++  EV+ K   GF++S +D W RAL       L ++ S      L + 
Sbjct: 167 KNFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENC 226

Query: 252 DVFKNGEMPLPITVADGR-YPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNV 310
             FK  ++P PI V++ +  P  TV+      FEFTPFE GSWD  LN F  +KYLG+ +
Sbjct: 227 RNFKEFKVPFPIIVSNCKNSPSKTVV------FEFTPFEFGSWDEYLNEFIKLKYLGSKI 280

Query: 311 TNGKPVNKDQCVSGYDNAGFVIATSASLFNEF-----------------SLEASTSTY-Y 352
            +GK     +C +G+D+ GF+ ATS+S+FN                   ++ A  ST+  
Sbjct: 281 VSGKTF---RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGL 337

Query: 353 KMINSFANKYVNNLSQDDDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQN 412
           +++     K V N      D A+Y  NPF     V+   T      + L+LVDGGE+G+N
Sbjct: 338 RLVKDMGAKDVPNNPLTRPDYALYRPNPFYKLLTVNNELTKE----NHLYLVDGGENGEN 393

Query: 413 LPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQ------GKGMA--- 463
           +P+ PL+  +R LDV+FALD S +++ ++P+G  + N Y   ++ Q       +G+    
Sbjct: 394 IPIRPLLLPQRKLDVIFALDSSSDSN-NYPNGTILRNLYNNFHNGQESLNITREGITSNI 452

Query: 464 --FPYVPDVNTFLNLGLTNKPTFFGCD----------AKNLTDLEYIPPLVVYIPNTKHS 511
              PY+P+  +F+   L ++P  FGC               T+   +PP+V+Y  N  HS
Sbjct: 453 DLLPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHS 512

Query: 512 FNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRK--QESLNAT 569
           ++ N ST K +YN +E  GM+RNG     +  F  ++ +  C+GC II+R+  +    A 
Sbjct: 513 YSSNTSTFKQSYNSSEIEGMLRNG---QDIFGFDANNTYHKCLGCIIIKREYDRRQTTAE 569

Query: 570 LPPECTKCFADYCWN 584
           LP  C +C+ DYC+N
Sbjct: 570 LPEFCHQCYQDYCFN 584

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 137 GLLQSSTYLSGLSGGNWLTGTLAWN--NWTSVQE 168
           GLL    Y+SGLSGG+W+  +L  +  N+ S+Q+
Sbjct: 15  GLLDCLAYISGLSGGSWILTSLILHDFNFKSLQK 48

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  224 bits (571), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 145/418 (34%), Positives = 219/418 (52%), Gaps = 63/418 (15%)

Query: 207 EVQAKSDAGFNISLSDLWARALSYNFF--PSLPDAGSALTWSSLRDVDVFKNGEMPLPIT 264
           EV+ K   GF +S +D W RAL    +   S+  + S L   S    ++  N E PLPI 
Sbjct: 198 EVRPKKIMGFPVSFTDYWGRALWKKIYVNESMISSMSELFARS----EITNNYEAPLPII 253

Query: 265 VADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSG 324
           +A+ +     ++N    +FEFTPFE GSW+  L  F ++KYLG+N T G       CV G
Sbjct: 254 IANCK--NEDLVN---AVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGV---AQSCVQG 305

Query: 325 YDNAGFVIATSASLFN-------EFSLEASTSTYYKMINSFANKYVNNLSQDDD------ 371
           +D+ GF+ ATS+SLFN       + + E+S  T  K I +  + +  NL    +      
Sbjct: 306 FDDIGFITATSSSLFNNVLIYAWKLASESSLKTM-KAIRALFSTFGVNLKNKPNSFFGTR 364

Query: 372 -DIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFA 430
            D A++  NPF     VD    S + ++D L+LVDGGEDG+N+PL P ++ ER +D++FA
Sbjct: 365 SDFALFQPNPFYRYPGVD----SPLTNSDKLYLVDGGEDGENIPLRPFLQPERQVDLIFA 420

Query: 431 LDISDNTDESWPSGVCMTNTYERQYSKQGKGMA------------FPYVPDVNTFLNLGL 478
           LD S +   ++P+G  + N Y+  ++  G                 PY+P    F   GL
Sbjct: 421 LD-SSSGRINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAKGL 479

Query: 479 TNKPTFFGC--------DAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLG 530
             +P  FGC        +A        +PP+V Y  N   ++N N ST K+ YN +E  G
Sbjct: 480 LKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSEVQG 539

Query: 531 MIRNGFEAATMGNFTDDSN--FLGCIGCAIIRRKQESLNAT--LPPECTKCFADYCWN 584
           M+ NG   A++  FT D+N  +  C+GC +++R  +++NA+  LPP C +CF  YC+N
Sbjct: 540 MLENG---ASL--FTHDNNTAYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN 592

>Kwal_0.173
          Length = 507

 Score =  203 bits (516), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/435 (31%), Positives = 215/435 (49%), Gaps = 62/435 (14%)

Query: 190 GGSNLTYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAG-SALTWSSL 248
             +N    ++ + ++  +V++K  +GF IS +D W  AL  +  P+      SA    S 
Sbjct: 95  ASNNFRQIVQTYVALHLKVKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSISAFADKSQ 154

Query: 249 RDVDVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGT 308
           R    F+  E+PLPI VA+ +       NL   +FEFTPFE GSW  ++  F  ++YLG+
Sbjct: 155 R----FQRYEVPLPIFVANCKND-----NLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGS 204

Query: 309 NVTNGKPVNKDQCVSGYDNAGFVIATSASLFNE-----FSLEASTSTYYKMINSFANKY- 362
            +T G P    +C+ G+D  GFV ATS+SLFN      + L A +    K + +  + + 
Sbjct: 205 QITAGTP---QKCIIGFDEVGFVTATSSSLFNSVLMYVWHLVAPSLDTRKAVRAIFSTFG 261

Query: 363 -----VNNLSQDDDDI------AIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQ 411
                   +S+ + +I      AIY  NPF    +     +  +   + L+LVDGGEDG+
Sbjct: 262 LGIHKTTTVSKGEANIMSHPEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGE 317

Query: 412 NLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPY----- 466
           N+P+ PL+  ER LDV+FALD S +   S+P+G  + N Y+  Y         PY     
Sbjct: 318 NIPIGPLLIPERKLDVIFALDSSSDVC-SFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPL 376

Query: 467 VPDVNTFLNLGLTNKPTFFGCD------------AKNLTDLEYIPPLVVYIPNTKHSFNG 514
           +P    F+   L ++P  FGC              +N + LE +PP+++Y  N  HSF  
Sbjct: 377 IPSSEEFVARRLLSRPVAFGCHMESYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFAS 435

Query: 515 NQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQES-----LNAT 569
           N ST K+ Y+  E   M+RNG     + +F D   +  C+ C +++R  +          
Sbjct: 436 NLSTFKLKYSKIEVEQMLRNG---KHIFSFDDRPKYKRCLACLLVKRNYDRSIILGEEVR 492

Query: 570 LPPECTKCFADYCWN 584
           LP  C  CF++YC+N
Sbjct: 493 LPFFCDVCFSEYCYN 507

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  192 bits (487), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 143/481 (29%), Positives = 238/481 (49%), Gaps = 80/481 (16%)

Query: 149 SGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGS-------NLTYT---- 197
            GG+ +T   + N +  ++EI++ + E    + ITK  +NP          N T+T    
Sbjct: 184 QGGSLITS--SSNFYEQIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDA 241

Query: 198 --------IERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPD-AGSALTWSSL 248
                   ++ ++S+  +++ K   GF IS +D W +A+      +  D    + ++S L
Sbjct: 242 KIETFKKVLDFYKSLHLKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKL 301

Query: 249 RDV-DVFKNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLG 307
            +    FK   +P+PI VA+ +  G     L+  +FEFTPFE GSW+  L  F  + YLG
Sbjct: 302 VNSSKKFKECSVPIPIFVANCK-NGL----LSNVIFEFTPFEFGSWENILRLFVKLPYLG 356

Query: 308 TNVTNGKPVNKDQCVSGYDNAGFVIATSASLFN-----------EFSLEASTSTYYKM-I 355
           + + +GK    ++C++ +D+ GF+ ATS+S+FN           + S EA  +    M I
Sbjct: 357 SKIVSGKA---EKCINNFDDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGI 413

Query: 356 NSFANKYVNNLSQD----DDDIAIYAANPF-----KDTEFVDRNYTSSIVDADDLFLVDG 406
                + + ++S+D    + D A+Y  NPF     KD    ++N+         L+LVDG
Sbjct: 414 FGLGKEEIFSISKDSSRLETDYAVYQPNPFYLYPEKDNVLTNKNH---------LYLVDG 464

Query: 407 GEDGQNLPLVPLIKKERDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPY 466
           GEDG+N+PL  L+  ER+LDV+F LD S + D ++P+G  +   +E+   ++     FP 
Sbjct: 465 GEDGENIPLRTLVIPERELDVIFVLDSSSDID-NYPNGSKLKRIFEK-LDEENVHYQFP- 521

Query: 467 VPDVNTFLNLGLTNKPTFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVT 526
             +V TF +      P   GC+A   T  +   P+++Y  N  H    N ST K+ YN +
Sbjct: 522 -NNVKTFTH------PIVIGCNATKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQS 574

Query: 527 ERLGMIRNGFEAATMGNFTDDSN--FLGCIGCAIIRRKQESL--NATLPPECTKCFADYC 582
           E   M+  G      G F++D +  +  C+GC + +R  + L       P C +CF DYC
Sbjct: 575 EVSSMLPTG-----RGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYC 629

Query: 583 W 583
           +
Sbjct: 630 Y 630

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 52/134 (38%), Gaps = 17/134 (12%)

Query: 31  APSIIPCPSDDTSLVRNASG-LSTAETDWLKKRDAYTKEALHSFLSRAXXXXXXXXXXXX 89
           AP  + CPS  + L+R A   L   ET +LKK+   TK  L  FL               
Sbjct: 19  APFQVQCPS--SPLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFSSKFYKR 76

Query: 90  XXXXXXXXVPKIGIACSXXXXXXXXXXXXXXXXXDNRTDGANEHGLGGLLQSSTYLSGLS 149
                    PKIGIA S                    T   ++    GL + S Y++GLS
Sbjct: 77  VLKDP----PKIGIAISGGGYRSMLVG----------TGFISQMNDYGLFEYSDYIAGLS 122

Query: 150 GGNWLTGTLAWNNW 163
           GG+W+   L   N+
Sbjct: 123 GGSWILMDLVVQNF 136

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  177 bits (450), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 135/415 (32%), Positives = 198/415 (47%), Gaps = 55/415 (13%)

Query: 206 QEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITV 265
           ++V+ K +AGF ISL+D   +AL         D    L  S+    + FK  + P+P+ V
Sbjct: 285 RQVRQKKEAGFPISLTDYLGQALLDRLPAQKQDHLKQL--SNFVQSESFKKFDAPIPVFV 342

Query: 266 ADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSGY 325
           A+ +        L+  +FEFTPFE GSW  +++ F   KYLG+    GK     +CV+G+
Sbjct: 343 ANAKTSKGP--ELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGKLT---KCVNGF 397

Query: 326 DNAGFVIATSASLFNE--FSLEASTST------YYKMINSFANKYVNNLSQDDDDIAIYA 377
           DN GF+ ATS+SLFN   F +  + +T        K I +    +    +    D AIY 
Sbjct: 398 DNLGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIFGVFGVGFNAIRSDYAIYQ 457

Query: 378 ANPF-KDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALDISDN 436
            NPF KD E ++      I D   LFLVDGGEDG+N+PL  L    R  DV+F +D S +
Sbjct: 458 PNPFYKDPEVLNL-----ISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIVD-SSS 511

Query: 437 TDESWPSGVCMTNTYER--QYSKQGKGMAF----------PYVPDVNTFL--NLGLTNKP 482
             E+ P    + +TY+      +Q + +A           PY+P     L  N  L+  P
Sbjct: 512 DKENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFSLST-P 570

Query: 483 TFFGC-----DAKNLTDL--------EYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERL 529
             FGC     + K LTD           +PP+++Y  N   +F  N ST K+NY   E  
Sbjct: 571 IAFGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYN 630

Query: 530 GMIRNGFEAATMGNFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYCWN 584
           GM+ NG       N      +L C+GC ++ R+ + L ++    C  C    C+N
Sbjct: 631 GMLNNGHH--LFNNDDTQGEYLQCLGCVMLLRQNQELVSSF---CDACIRKVCYN 680

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  171 bits (432), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 202/400 (50%), Gaps = 53/400 (13%)

Query: 207 EVQAKSDAGFNISLSDLWARALSYNF-FPSLPDAGSALTWS-SLRDVDVFKNGEMPLPIT 264
            +++K   GF IS +D WA+AL  N  +  LP   + LT+S S+R  + FKN  +P+PI 
Sbjct: 142 HIRSKRINGFPISFTDYWAQALVQNIKYRQLP---THLTYSKSVRTSNYFKNYLVPIPII 198

Query: 265 VADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCVSG 324
           VA+ R        L   +FEFTP+E GSW+  L  F +++YLG+ + NG      QC  G
Sbjct: 199 VANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNIEYLGSRIINGV---SHQCYKG 250

Query: 325 YDNAGFVIATSASLFNEFSLE-------------ASTSTYYKMINSFANKYVNNLSQD-- 369
            D+ GF+ ATS+S+FN   +              A+  T   +      K+ + L     
Sbjct: 251 LDDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSSQ 310

Query: 370 -----DDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERD 424
                D D A+Y  NPF    +   N  + +   D L+LVDGGEDG+N+P+  L+   R+
Sbjct: 311 ITAALDTDYAVYRHNPF----YKYSNIKNELAQNDYLYLVDGGEDGENIPIRTLV--PRN 364

Query: 425 LDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTF 484
           +D++  +D S +  +++ +G  +     +   K+ +G+ + Y   + T        +PT 
Sbjct: 365 VDMIMIMD-SSSDKKNYANGDKLKIVLNQM--KEKEGIYYRYPTKIVTS-----QKRPTI 416

Query: 485 FGCDAKNLTDLEYIPPLVVYIPNTKHSFNG--NQSTLKMNYNVTERLGMIRNGFEAATMG 542
            GC     +D + + P++VY PN++ S     N ST KM Y   E+  +I +G+   T G
Sbjct: 417 IGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVT-G 474

Query: 543 NFTDDSNFLGCIGCAIIRRKQESLNATLPPECTKCFADYC 582
           +   + ++  C+ C +++R  +  +   P +C+ C++ YC
Sbjct: 475 H--GEHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

>Scas_695.10
          Length = 553

 Score =  166 bits (419), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 124/381 (32%), Positives = 184/381 (48%), Gaps = 59/381 (15%)

Query: 207 EVQAKSDAGFNISLSDLWARALSY---NFFPSLPDAGSALTWSSLRDVDV-FKNGEMPLP 262
            V+ K   GF +S +D W  AL     N         + +++S L + ++ F   E P+P
Sbjct: 183 RVRTKKIQGFFVSFTDYWGEALLKRLNNKDKKFSAFANTVSFSKLIESNLKFSKFEAPIP 242

Query: 263 ITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGKPVNKDQCV 322
           I VA+ R        L   +FEF+PFE GSW+  L  F  + YLG+ + NG       C 
Sbjct: 243 IFVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNG---TAKICY 294

Query: 323 SGYDNAGFVIATSASLFNEF-----------SLEASTST-----YYKMINSFANKYVNNL 366
             +D+ GF+ ATS+S+FN             SLEA  S       + +I +  +     L
Sbjct: 295 KEFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKPLTL 354

Query: 367 SQD----DDDIAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKE 422
           S      + D A+Y  NPF    F   N  +++   D L+LVDGGEDG+N+PL  LI  E
Sbjct: 355 SNTAIAPETDYAVYYHNPF----FRYPNIDNALTKDDHLYLVDGGEDGENIPLRSLIIPE 410

Query: 423 RDLDVVFALDISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKP 482
           R +DV+FA+D S + + ++ +G  +  T  R   K G     P +            N P
Sbjct: 411 RKVDVIFAIDSSSDVN-NYANGTKLI-TILRHLEKLGYHYKIPKISKKR-------INHP 461

Query: 483 TFFGCDAKNLTDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMG 542
             FGC+A +L       P+++Y  NT+HS+  N ST K+ YN TE   M++NG     M 
Sbjct: 462 LIFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNG-----MD 509

Query: 543 NFTDDSN--FLGCIGCAIIRR 561
            F D+ N  +  C+GC + +R
Sbjct: 510 IFNDNENIYYQNCLGCILSKR 530

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 137 GLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEI 169
           GL    +YLSGLSGG+W+   L  NN+   + I
Sbjct: 37  GLWDCVSYLSGLSGGSWVLMDLIVNNFNITKMI 69

>Scas_690.1*
          Length = 636

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 252 DVFKNGEMPLPITVADGRYPGTTVINLNA--TLFEFTPFEMGSWDPSLNA--FTDVKYLG 307
           +V++  ++     V +GRYP   ++NL+   ++ +F P +  +  P L A   TD+ +  
Sbjct: 197 EVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYLLADRITDLTHPE 256

Query: 308 TNVTNGKPVNKDQCVSGY 325
              T GK +++   + GY
Sbjct: 257 LIETQGKQIDRKVAIYGY 274

>Kwal_56.24139
          Length = 463

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 265 VADGRYPGTTVINLNA--TLFEFTPFEMGSWDPSLNA--FTDVKYLGTNVTNGKPVNKDQ 320
           V +GRYP   ++NL+   ++ +F P +  +  P L A   TD+ +     T GK +++  
Sbjct: 210 VINGRYPDREILNLSRFISVMKFRPLKWRNEHPYLLADRITDITHPELLETQGKQIDRKV 269

Query: 321 CVSGY 325
            + GY
Sbjct: 270 ALYGY 274

>KLLA0C09603g complement(833552..833884) similar to sp|Q9Y909
           Aeropyrum pernix Hypothetical protein APE2475, start by
           similarity
          Length = 110

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 222 DLWARALSYNFFPSLPDAGSALTWSSLRDVDVFKNGEMPLPITVADGRYPGTTVINLNAT 281
            L  RA S  +  ++PDAG  +  + +       N  +P+P     G Y  T +  L  T
Sbjct: 14  SLMIRADSPMYLSTIPDAGEKIKLAPIVAATALANKVLPVP----GGPYSNTPLGGLIPT 69

Query: 282 LFEFTPFEMGSWDPSLNAF 300
           L + + F  GS   SLN+ 
Sbjct: 70  LSKISGFFSGSSMTSLNSL 88

>YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein
           involved rRNA processing and 40S ribosomal subunit
           biogenesis, contains a GTP-binding domain, and interacts
           genetically with BMH1 [3552 bp, 1183 aa]
          Length = 1183

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 265 VADGRYPGTTVINLNA--TLFEFTPFEMGSWDPSLNA--FTDVKYLGTNVTNGKPVNKDQ 320
           V +GRYP   ++NL+   ++ +F P +  +  P + A  FTD+ +     T G  +++  
Sbjct: 210 VINGRYPDREILNLSRFISVMKFRPLKWRNEHPYMLADRFTDLTHPELIETQGLQIDRKV 269

Query: 321 CVSGY 325
            + GY
Sbjct: 270 AIYGY 274

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
           cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 324 GYDNAGFVIATSASLFNEFSLEASTSTYYKMI---NSFANKYVNNLSQDDDDI 373
           GYDN+ FV+  S ++FNEF L       YK I   + F+     ++S DDD I
Sbjct: 734 GYDNS-FVLGMSVTIFNEFKLYKLLVLPYKAICQDSEFSFNAKQSISLDDDFI 785

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,260,400
Number of extensions: 917974
Number of successful extensions: 2450
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2458
Number of HSP's successfully gapped: 36
Length of query: 694
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 585
Effective length of database: 12,822,747
Effective search space: 7501306995
Effective search space used: 7501306995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)