Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR005W (TAF4)38838217780.0
CAGL0J11726g3362439651e-130
Scas_611.23362459451e-127
ACL016C3612447132e-91
Kwal_56.225054032486972e-88
KLLA0C05962g3663116881e-87
YPL254W (HFI1)48855810.054
AFL171W43255770.16
CAGL0H00616g45155750.25
KLLA0B10351g43278701.1
YJR107W32861672.2
Scas_699.1343355663.5
Kwal_23.605943258663.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR005W
         (382 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA po...   689   0.0  
CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces...   376   e-130
Scas_611.2                                                            368   e-127
ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH] (331298..33...   279   2e-91
Kwal_56.22505                                                         273   2e-88
KLLA0C05962g complement(527216..528316) similar to sp|P50105 Sac...   269   1e-87
YPL254W (HFI1) [5196] chr16 (69485..70951) Component of the ADA ...    36   0.054
AFL171W [3024] [Homologous to ScYPL254W (HFI1) - SH] complement(...    34   0.16 
CAGL0H00616g 59437..60792 similar to sp|Q12060 Saccharomyces cer...    33   0.25 
KLLA0B10351g complement(904656..905954) similar to sp|Q12060 Sac...    32   1.1  
YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unkno...    30   2.2  
Scas_699.13                                                            30   3.5  
Kwal_23.6059                                                           30   3.9  

>YMR005W (TAF4) [3970] chr13 (276045..277211) Component of RNA
           polymerase II general transcription factor TFIID [1167
           bp, 388 aa]
          Length = 388

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/382 (89%), Positives = 341/382 (89%)

Query: 1   MANSPKKPSDGTGVSASDTPKYQHTVPETKPAFNLSPGKASELSHSLPSPSQIKSTAHVS 60
           MANSPKKPSDGTGVSASDTPKYQHTVPETKPAFNLSPGKASELSHSLPSPSQIKSTAHVS
Sbjct: 1   MANSPKKPSDGTGVSASDTPKYQHTVPETKPAFNLSPGKASELSHSLPSPSQIKSTAHVS 60

Query: 61  STHNDAAGNTDDSVLPKNVSPTTNLRVESNGDTNNMFSSPAGLALPXXXXXXXXXXXXXX 120
           STHNDAAGNTDDSVLPKNVSPTTNLRVESNGDTNNMFSSPAGLALP              
Sbjct: 61  STHNDAAGNTDDSVLPKNVSPTTNLRVESNGDTNNMFSSPAGLALPKKDDKKKNKGTSKA 120

Query: 121 XXXDGKXXXXXXXXXXXXXDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKI 180
              DGK             DPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKI
Sbjct: 121 DSKDGKASNSSGQNAQQQSDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKI 180

Query: 181 PNHLPFLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRH 240
           PNHLPFLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRH
Sbjct: 181 PNHLPFLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRH 240

Query: 241 RRKAVKINSGRRSEVSAALRAIALIQXXXXXXXXXXXIALGLEKEDYENKIDSEETLHRA 300
           RRKAVKINSGRRSEVSAALRAIALIQ           IALGLEKEDYENKIDSEETLHRA
Sbjct: 241 RRKAVKINSGRRSEVSAALRAIALIQKKEEERRVKKRIALGLEKEDYENKIDSEETLHRA 300

Query: 301 SNVTAGLRAGSKKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIV 360
           SNVTAGLRAGSKKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIV
Sbjct: 301 SNVTAGLRAGSKKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIV 360

Query: 361 MRDLLFALENRRNSVQTIISKG 382
           MRDLLFALENRRNSVQTIISKG
Sbjct: 361 MRDLLFALENRRNSVQTIISKG 382

>CAGL0J11726g 1140123..1141133 similar to sp|P50105 Saccharomyces
           cerevisiae YMR005w MPT1 required for protein synthesis,
           hypothetical start
          Length = 336

 Score =  376 bits (965), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 207/243 (85%), Gaps = 2/243 (0%)

Query: 140 DPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKV 199
           DPNKMQDVL SAG+D++EEEALL+S++N SK+Q   N V IP H PFLHP+QVSN+M+KV
Sbjct: 90  DPNKMQDVLISAGVDLKEEEALLSSTVNVSKTQ--QNAVVIPPHPPFLHPDQVSNFMKKV 147

Query: 200 GKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSEVSAAL 259
            K QNFNL+ TKN EILDMMSSACE+Y+RDI+TN IV+SRHRRK VK+N GRRS+V+AAL
Sbjct: 148 AKTQNFNLSFTKNTEILDMMSSACESYLRDIITNTIVVSRHRRKGVKVNYGRRSQVAAAL 207

Query: 260 RAIALIQXXXXXXXXXXXIALGLEKEDYENKIDSEETLHRASNVTAGLRAGSKKQYGWLT 319
           R+IA+ Q           IALGLEKEDYENK+DSEETLHRASNVTA LRAGSKKQYGWLT
Sbjct: 208 RSIAINQKKEEERRMKKRIALGLEKEDYENKMDSEETLHRASNVTATLRAGSKKQYGWLT 267

Query: 320 SSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRRNSVQTII 379
           SS+NKP S+G KS+GKVA++I ARGESGLKFREAREEPGIVMRDLLFALE+RR  V  II
Sbjct: 268 SSINKPASIGVKSAGKVATEIAARGESGLKFREAREEPGIVMRDLLFALEHRRIGVHNII 327

Query: 380 SKG 382
           SKG
Sbjct: 328 SKG 330

>Scas_611.2
          Length = 336

 Score =  368 bits (945), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/245 (71%), Positives = 205/245 (83%), Gaps = 2/245 (0%)

Query: 140 DPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKV 199
           DPNKMQDVLFSAG+D+REEEALLNSSI ASK+++ T +V+IP+H PFLHP+QV+ +M++V
Sbjct: 86  DPNKMQDVLFSAGVDIREEEALLNSSIIASKNKINTMDVRIPSHPPFLHPDQVARFMQRV 145

Query: 200 GKEQNFNLTP--TKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSEVSA 257
            KEQ        +K PE+L MMS+ACE YMRDILTNA+VISRHRR+A+K+N+GRRSE+S 
Sbjct: 146 AKEQQRRTRQDFSKYPELLSMMSTACETYMRDILTNALVISRHRRRAIKLNAGRRSEISM 205

Query: 258 ALRAIALIQXXXXXXXXXXXIALGLEKEDYENKIDSEETLHRASNVTAGLRAGSKKQYGW 317
            LR IAL +           IALGLEKED ENKIDSEETLHRASNVTAGLRAGSKKQYGW
Sbjct: 206 ILRNIALKEKKDEEKRVKKRIALGLEKEDLENKIDSEETLHRASNVTAGLRAGSKKQYGW 265

Query: 318 LTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRRNSVQT 377
           LTSSV+KPT+   KS+GKVASDI ARGE+GLKFREAREEPGIVMRDLL+ALENRRN V  
Sbjct: 266 LTSSVSKPTNTSVKSAGKVASDIAARGETGLKFREAREEPGIVMRDLLYALENRRNGVHN 325

Query: 378 IISKG 382
           +ISKG
Sbjct: 326 VISKG 330

>ACL016C [1033] [Homologous to ScYMR005W (MPT1) - SH]
           (331298..332383) [1086 bp, 361 aa]
          Length = 361

 Score =  279 bits (713), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 178/244 (72%), Gaps = 2/244 (0%)

Query: 140 DPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKV 199
           DP+K+ D L SAG+D++EEEALL+S++   KS  Q +N +IP H PFLHP  V++ M+KV
Sbjct: 113 DPDKLSDALLSAGVDIKEEEALLSSTVTTMKSNSQVSNSQIPLHPPFLHPSHVASMMKKV 172

Query: 200 GKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSEVSAAL 259
             EQNFN   +K+ E+L +MS+ACE Y+RDI+TN+I+ISRHRRKAVK+NSGRRSE +  L
Sbjct: 173 AAEQNFNQDFSKSSELLSLMSTACELYIRDIITNSIIISRHRRKAVKLNSGRRSETTRVL 232

Query: 260 RAIALIQXXXXXXXXXXXIALGLEKEDYENKIDSEETLHRASNVTAGLR-AGSKKQYGWL 318
           R +AL Q           IALGLEKE  + K+DS ETLHRASN TA +  AG KK+Y WL
Sbjct: 233 RDLALKQREQEERRVKRRIALGLEKEITDTKLDSGETLHRASNATANMMIAGGKKKYSWL 292

Query: 319 TSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRRNSVQTI 378
           TS  +K  +   K+ GKV+S + ARG+ G+KFREAREEPGIVMRDLL ALENRR  V   
Sbjct: 293 TSG-SKVNATDLKNPGKVSSAVAARGDLGIKFREAREEPGIVMRDLLHALENRRVGVNNT 351

Query: 379 ISKG 382
           I+KG
Sbjct: 352 IAKG 355

>Kwal_56.22505
          Length = 403

 Score =  273 bits (697), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 136/248 (54%), Positives = 179/248 (72%), Gaps = 6/248 (2%)

Query: 140 DPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTN----NVKIPNHLPFLHPEQVSNY 195
           DP+K+ D LFSAG+D+REEEALLNSS+N +KS  Q      N +IP   P LHP  ++++
Sbjct: 151 DPDKLSDALFSAGVDIREEEALLNSSMNITKSSAQAGAQAINNQIPPQPPLLHPTHIASF 210

Query: 196 MRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRSEV 255
           M+KVG EQNFN   +K  ++L +MS+ACE +M DI+TN++VISRHRR+++K+NSGRRSEV
Sbjct: 211 MKKVGSEQNFNQDFSKAHDVLSLMSTACEFFMTDIITNSLVISRHRRRSIKLNSGRRSEV 270

Query: 256 SAALRAIALIQXXXXXXXXXXXIALGLEKEDYENKIDSEETLHRASNVTAGLR-AGSKKQ 314
           S ALR +A+ Q           I++GLEKE  E K++++ETLHRASN TA +  AG KK+
Sbjct: 271 SRALRDLAIQQKEQEERRVKRRISMGLEKETAEAKMETDETLHRASNATANMMIAGGKKK 330

Query: 315 YGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENRRNS 374
           Y WL +   K  +   K  GKV+SD+ ARGE G+++REAREEPGIVMRDLL ALENRR  
Sbjct: 331 YSWLNAGA-KANNNSVKVLGKVSSDVAARGEIGIRYREAREEPGIVMRDLLNALENRRVG 389

Query: 375 VQTIISKG 382
           V  +I KG
Sbjct: 390 VNKVIPKG 397

>KLLA0C05962g complement(527216..528316) similar to sp|P50105
           Saccharomyces cerevisiae YMR005w MPT1 required for
           protein synthesis singleton, start by similarity
          Length = 366

 Score =  269 bits (688), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 196/311 (63%), Gaps = 10/311 (3%)

Query: 74  VLPKNVSPTTNLRVESNGDTNNMFSSPAGLALPXXXXXXXXXXXXXXXXXDGKXXXXXXX 133
            LPK  SPTTNL    N  T N+ ++                                  
Sbjct: 58  ALPKASSPTTNLASPRNSSTPNLKTT-------STTSKQSQKAEQKKNAGGSTGSTTAST 110

Query: 134 XXXXXXDPNKMQDVLFSAGIDVREEEALLNSSINASKSQVQTNNVKIPNHLPFLHPEQVS 193
                 DP+K+ D L SAG+D+REEEALL+S++  +K+   + N ++P+H PFLHP+ +S
Sbjct: 111 TKPQQSDPDKLSDALLSAGVDIREEEALLSSTVARTKATGISANNQVPSHPPFLHPKNIS 170

Query: 194 NYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRKAVKINSGRRS 253
           ++M+++  EQNF+    KN +IL +MS+ACE YMRD++TN++++S HRRK VK+N+GRRS
Sbjct: 171 DFMKRIASEQNFHQDFNKNTDILGLMSTACELYMRDVITNSLILSIHRRKGVKLNTGRRS 230

Query: 254 EVSAALRAIALIQXXXXXXXXXXXIALGLEKEDYENKIDSEETLHRASNVTAGLR--AGS 311
           EVS +LR +AL Q           IALGLEK+  + ++D+EET +RASN TA L    G+
Sbjct: 231 EVSRSLRDLALRQKTQEERRVQRRIALGLEKQTTDARLDTEETQYRASNATANLMIAGGN 290

Query: 312 KKQYGWLTSSVNKPTSLGAKSSGKVASDITARGESGLKFREAREEPGIVMRDLLFALENR 371
           KK+Y WLT+  +K +S   K+ G V+S + ARGE G+K+REAREEPGIVMRDLL ALENR
Sbjct: 291 KKKYSWLTAG-SKSSSTDLKNQGNVSSAVAARGEMGIKYREAREEPGIVMRDLLLALENR 349

Query: 372 RNSVQTIISKG 382
           R  V  +I+KG
Sbjct: 350 RVGVNNVITKG 360

>YPL254W (HFI1) [5196] chr16 (69485..70951) Component of the ADA
           complex, the SAGA transcriptional activator-histone
           acetyltransferase complex, and the SLIK (SAGA-like)
           complex, interacts with Taf12p to form a histone-like
           paired complex [1467 bp, 488 aa]
          Length = 488

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 189 PEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRK 243
           P+  S Y+R VG  +   L  T +   ++++S A + Y+++I+   I   R+RRK
Sbjct: 267 PDTDSFYLRMVGIAREHGLVGTVDARCVELISLALDQYLKNIIEFTIDTVRYRRK 321

>AFL171W [3024] [Homologous to ScYPL254W (HFI1) - SH]
           complement(114799..116097) [1299 bp, 432 aa]
          Length = 432

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 189 PEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRK 243
           P+  S Y+R V   +   L  T +   ++++S A E Y++ IL +AI   R+R K
Sbjct: 257 PDNDSLYLRMVSIAREHGLVGTVDGRCVEILSLALEYYLKTILESAIDTVRYREK 311

>CAGL0H00616g 59437..60792 similar to sp|Q12060 Saccharomyces
           cerevisiae YPL254w HFI1 transcriptional coactivator,
           start by similarity
          Length = 451

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%)

Query: 189 PEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRK 243
           P+  S Y+R VG  +   +    +   +D++S A + Y+++I+  AI   R+R+K
Sbjct: 274 PDTDSFYLRIVGIAREHGIVGNIDAGCIDLISLALDVYLKNIIEMAIDTVRYRKK 328

>KLLA0B10351g complement(904656..905954) similar to sp|Q12060
           Saccharomyces cerevisiae YPL254w HFI1 transcriptional
           coactivator singleton, hypothetical start
          Length = 432

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 166 INASKSQVQTNNVKIPNHLPFLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACEN 225
           +N  K+Q+ T +        ++ P+  S Y+R +G  +   +    +   +D++S A E 
Sbjct: 241 MNGFKTQLSTES--------YVLPDNESLYLRMLGIARENGIVGQIDSRCVDIVSLALEY 292

Query: 226 YMRDILTNAIVISRHRRK 243
           Y++ I+ + I   R+R K
Sbjct: 293 YLKTIIESTIDTVRYREK 310

>YJR107W (YJR107W) [2999] chr10 (627254..628240) Protein of unknown
           function, has similarity to acylglycerol lipase [987 bp,
           328 aa]
          Length = 328

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 4/61 (6%)

Query: 146 DVLFSAGIDVREEEALLNSSINASKSQVQTNNV--KIPNHLPFLHPEQVSNYMRKVGKEQ 203
           D LF    D  E+E++L   I   K   +  +    IP   PF HP  +  ++ KVG  Q
Sbjct: 221 DELFET--DAIEKESILKDEIQFRKGYFRVVHTGDYIPMVPPFYHPAGLEMFINKVGLPQ 278

Query: 204 N 204
           N
Sbjct: 279 N 279

>Scas_699.13
          Length = 433

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 30/55 (54%)

Query: 189 PEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRK 243
           P+  S Y+R V   +   L    +   ++++S A ++Y+++I+   I   R+RRK
Sbjct: 258 PDADSLYLRMVSIAREHGLVGNVDARGIELLSMALDHYLKNIIEFTIDTVRYRRK 312

>Kwal_23.6059
          Length = 432

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 31/58 (53%)

Query: 186 FLHPEQVSNYMRKVGKEQNFNLTPTKNPEILDMMSSACENYMRDILTNAIVISRHRRK 243
           +  P+  S Y+R +   +   L    +   +++M+ A E Y+++++ +AI   R+R K
Sbjct: 256 YALPDNDSLYLRMISIAREHGLVGAVDGRCVEIMTLALEIYLKNLVESAIDTVRYREK 313

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.125    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,145,475
Number of extensions: 446566
Number of successful extensions: 1695
Number of sequences better than 10.0: 52
Number of HSP's gapped: 1680
Number of HSP's successfully gapped: 59
Length of query: 382
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 279
Effective length of database: 13,030,455
Effective search space: 3635496945
Effective search space used: 3635496945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)