Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YMR002W1561336581e-89
CAGL0J11682g1591334254e-54
Sklu_2419.61581373932e-49
Kwal_56.224921521343846e-48
KLLA0C06094g1491173792e-47
Scas_686.141521253542e-43
ACL010C153973342e-40
AGL240W70873641.6
KLLA0F27357g87073596.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YMR002W
         (154 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the DU...   258   1e-89
CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces...   168   4e-54
Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement        155   2e-49
Kwal_56.22492                                                         152   6e-48
KLLA0C06094g complement(535470..535919) similar to sp|Q03667 Sac...   150   2e-47
Scas_686.14                                                           140   2e-43
ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [...   133   2e-40
AGL240W [4072] [Homologous to ScYPL029W (SUV3) - SH] complement(...    29   1.6  
KLLA0F27357g 2530948..2533560 similar to sp|P25644 Saccharomyces...    27   6.4  

>YMR002W (YMR002W) [3967] chr13 (272193..272663) Member of the
           DUF657 protein of unknown function family, which may
           bind metal, has high similarity to uncharacterized C.
           albicans Orf6.159p [471 bp, 156 aa]
          Length = 156

 Score =  258 bits (658), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 126/133 (94%), Positives = 126/133 (94%)

Query: 22  ASTMAAPVHXXXXXXXNAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGIT 81
           ASTMAAPVH       NAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGIT
Sbjct: 22  ASTMAAPVHPQQQQQPNAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGIT 81

Query: 82  GMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICDY 141
           GMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICDY
Sbjct: 82  GMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICDY 141

Query: 142 YLQQLKACQEAAR 154
           YLQQLKACQEAAR
Sbjct: 142 YLQQLKACQEAAR 154

>CAGL0J11682g 1136601..1137080 similar to sp|Q03667 Saccharomyces
           cerevisiae YMR002w, start by similarity
          Length = 159

 Score =  168 bits (425), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 93/133 (69%), Positives = 100/133 (75%), Gaps = 4/133 (3%)

Query: 22  ASTMAAPVHXXXXXXXNAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGIT 81
           A+  AAP         NA+   P AGAQ +QPG+FAQMASTAAGVAVGSTIGHTLGAGIT
Sbjct: 29  AAYPAAPPRQQPVAPANAH---PQAGAQPQQPGLFAQMASTAAGVAVGSTIGHTLGAGIT 85

Query: 82  GMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICDY 141
           GMFSGSGS     +QQQQ M N     Q  QQ  RTC+ DA+NFTRCLDENNGNFQICDY
Sbjct: 86  GMFSGSGSSEV-SDQQQQPMQNFDAAAQQQQQQFRTCDADAKNFTRCLDENNGNFQICDY 144

Query: 142 YLQQLKACQEAAR 154
           YLQQLKACQEAAR
Sbjct: 145 YLQQLKACQEAAR 157

>Sklu_2419.6 YMR002W, Contig c2419 8567-9043 reverse complement
          Length = 158

 Score =  155 bits (393), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 106/137 (77%), Gaps = 4/137 (2%)

Query: 22  ASTMAAPVHXXXXXX--XNAYSHPPAA-GAQTRQPGMFAQMASTAAGVAVGSTIGHTLGA 78
           ASTMAAP            AYSHPPAA GAQ +QPG+FAQMASTAAGVAVGS +GHT+GA
Sbjct: 20  ASTMAAPPPSSAHVQPQQTAYSHPPAAAGAQPQQPGLFAQMASTAAGVAVGSAVGHTVGA 79

Query: 79  GITGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRT-CEIDARNFTRCLDENNGNFQ 137
           G+TG+FSGSGS +AP EQQQQ     +   Q+  Q   T C++DARNFTRCL+EN+GNFQ
Sbjct: 80  GLTGLFSGSGSSAAPAEQQQQQQLAAAPAQQSLAQNQATHCDVDARNFTRCLEENDGNFQ 139

Query: 138 ICDYYLQQLKACQEAAR 154
           ICD+YLQQLKACQEAAR
Sbjct: 140 ICDFYLQQLKACQEAAR 156

>Kwal_56.22492
          Length = 152

 Score =  152 bits (384), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 103/134 (76%), Gaps = 4/134 (2%)

Query: 22  ASTMAA-PVHXXXXXXXNAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGI 80
           ASTMAA P         +AYSHP +A AQ RQPG+FAQMASTAAGVAVGS +GHT+GAG+
Sbjct: 20  ASTMAAHPPAQQHAAPSSAYSHPQSA-AQPRQPGLFAQMASTAAGVAVGSAVGHTVGAGL 78

Query: 81  TGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICD 140
           TGMFSGS S  A  EQQQQ +A    Q    Q+ GR C++DAR+FTRCL+ENNGN QICD
Sbjct: 79  TGMFSGSSSAPA--EQQQQQLAAAPAQQGFAQEQGRACDVDARSFTRCLEENNGNMQICD 136

Query: 141 YYLQQLKACQEAAR 154
           +YLQQLKACQEAAR
Sbjct: 137 FYLQQLKACQEAAR 150

>KLLA0C06094g complement(535470..535919) similar to sp|Q03667
           Saccharomyces cerevisiae YMR002w singleton, start by
           similarity
          Length = 149

 Score =  150 bits (379), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 90/117 (76%), Gaps = 3/117 (2%)

Query: 38  NAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQ 97
           NAYSHPP   AQ +QPGMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGS S  A  +QQ
Sbjct: 34  NAYSHPPHT-AQPQQPGMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSSSAPAEQQQQ 92

Query: 98  QQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICDYYLQQLKACQEAAR 154
           Q      +   Q  Q     C++DARNFTRCL++N GN QICDYYLQQLKACQEAAR
Sbjct: 93  QVAAPVQADTFQNQQ--ATHCDVDARNFTRCLEDNGGNMQICDYYLQQLKACQEAAR 147

>Scas_686.14
          Length = 152

 Score =  140 bits (354), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 91/125 (72%), Gaps = 14/125 (11%)

Query: 38  NAYSHPPAAGA------QTRQPGMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDS 91
           NAYS PPAA A      Q RQPGMFAQMASTAAGVAVGST+GH     ++G+  G GS  
Sbjct: 32  NAYSQPPAASAGAGAGAQPRQPGMFAQMASTAAGVAVGSTVGH----AVSGLLFGGGS-- 85

Query: 92  APVEQ--QQQNMANTSGQTQTDQQLGRTCEIDARNFTRCLDENNGNFQICDYYLQQLKAC 149
           AP EQ  QQQ M   + Q   DQ+  ++C+  A++FT+CLDENNGNFQICDYYLQQLKAC
Sbjct: 86  APAEQPVQQQAMDPYASQRTLDQEPAQSCDGAAKSFTKCLDENNGNFQICDYYLQQLKAC 145

Query: 150 QEAAR 154
           QEAAR
Sbjct: 146 QEAAR 150

>ACL010C [1039] [Homologous to ScYMR002W - SH] (338678..339139) [462
           bp, 153 aa]
          Length = 153

 Score =  133 bits (334), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 75/97 (77%), Gaps = 2/97 (2%)

Query: 54  GMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQ 113
           G+FAQMASTAAGVAVGS +GHT+GAG+TG+FSGSGS  AP E Q Q +A    Q  T Q 
Sbjct: 49  GLFAQMASTAAGVAVGSAVGHTIGAGLTGLFSGSGS--APAEAQPQQLAAAPVQQDTFQT 106

Query: 114 LGRTCEIDARNFTRCLDENNGNFQICDYYLQQLKACQ 150
             R C+ DARNFTRCL++NNGNFQICDYYLQQ +  Q
Sbjct: 107 QARHCDTDARNFTRCLEDNNGNFQICDYYLQQFEGLQ 143

>AGL240W [4072] [Homologous to ScYPL029W (SUV3) - SH]
           complement(250193..252319) [2127 bp, 708 aa]
          Length = 708

 Score = 29.3 bits (64), Expect = 1.6,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 1/73 (1%)

Query: 42  HPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQNM 101
           HPP AG Q  +  +  ++A  A    + +    TL   I G+   +     P EQ  +  
Sbjct: 44  HPPQAGGQCDRRSVHLKLAELAKN-NIDAKFQSTLERAIRGLQGQALRSETPAEQPMRKE 102

Query: 102 ANTSGQTQTDQQL 114
           A    Q +  QQL
Sbjct: 103 AWARLQDELVQQL 115

>KLLA0F27357g 2530948..2533560 similar to sp|P25644 Saccharomyces
           cerevisiae YCR077c (PAT1) topoisomerase II-associated
           protein singleton, start by similarity
          Length = 870

 Score = 27.3 bits (59), Expect = 6.4,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 28/73 (38%)

Query: 63  AAGVAVGSTIGHTLGAGITGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRTCEIDA 122
             G  +G+      G G  G  SGSG   AP      ++AN     Q D + G    +D 
Sbjct: 51  GTGADLGTDFDFGYGKGELGAGSGSGRAPAPAPVSYASIANAKMNRQADCKPGFEQSLDM 110

Query: 123 RNFTRCLDENNGN 135
           +        ++GN
Sbjct: 111 QPMESLWGNSSGN 123

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.124    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,648,194
Number of extensions: 131555
Number of successful extensions: 666
Number of sequences better than 10.0: 31
Number of HSP's gapped: 653
Number of HSP's successfully gapped: 41
Length of query: 154
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 61
Effective length of database: 13,376,635
Effective search space: 815974735
Effective search space used: 815974735
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)