Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YML109W (ZDS2)94292640220.0
Kwal_27.103189254366033e-65
KLLA0D01683g9443995724e-61
AAL185W10184375612e-59
YMR273C (ZDS1)9154815405e-57
Scas_650.229935405345e-56
CAGL0F03421g8171134382e-44
CAGL0J06688g8283774232e-42
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML109W
         (926 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...  1553   0.0  
Kwal_27.10318                                                         236   3e-65
KLLA0D01683g complement(148855..151689) some similarities with s...   224   4e-61
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   220   2e-59
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   212   5e-57
Scas_650.22                                                           210   5e-56
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   173   2e-44
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   167   2e-42

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score = 1553 bits (4022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 781/926 (84%), Positives = 781/926 (84%)

Query: 1   MVLMEDMQNKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLD 60
           MVLMEDMQNKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLD
Sbjct: 1   MVLMEDMQNKDGHNTVENSSGGTDSNNNIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLD 60

Query: 61  TEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLHEENIIRSEQKE 120
           TEIQNVKNLKRLSIGSMDLVIDPELEFKVN                 LHEENIIRSEQKE
Sbjct: 61  TEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQESLHEENIIRSEQKE 120

Query: 121 EQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXXXXXXXXXXXXXXXXX 180
           EQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKII                  
Sbjct: 121 EQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIRNASSSTSSSARVTSRNR 180

Query: 181 XLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI 240
            LSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI
Sbjct: 181 RLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI 240

Query: 241 STNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVD 300
           STNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVD
Sbjct: 241 STNQDIDENKLELGNNHVISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVD 300

Query: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGN 360
           KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGN
Sbjct: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESLHLNGN 360

Query: 361 HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDN 420
           HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDN
Sbjct: 361 HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDN 420

Query: 421 RRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHA 480
           RRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHA
Sbjct: 421 RRSASSPASYTQVPQEQASLNDFHEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHA 480

Query: 481 XXXXXXXXXXXXXXXXXVLIKPHNTGSMISEKLDQHVXXXXXXXXXXXXXXXXXXXXXXX 540
                            VLIKPHNTGSMISEKLDQHV                       
Sbjct: 481 SISQESSLLSTDSSNNSVLIKPHNTGSMISEKLDQHVSSSEKSNTNNSEANHGWSWLNSS 540

Query: 541 XXXXXANEQTYQQLTXXXXXXXCVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPI 600
                ANEQTYQQLT       CVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPI
Sbjct: 541 NGSLNANEQTYQQLTDDEDDEECVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPI 600

Query: 601 FQIHSEEAKXXXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLEKRLAK 660
           FQIHSEEAK                   TAPAVVEKKVELPTDTQASTHKKNSLEKRLAK
Sbjct: 601 FQIHSEEAKSVVITPSVVSSSESQPSKPTAPAVVEKKVELPTDTQASTHKKNSLEKRLAK 660

Query: 661 LFKRKQHNGTCXXXXXXXXXXXXXXXXXXXXXXXXXXFRKSPKKKPQEAEVERPSSPTKT 720
           LFKRKQHNGTC                          FRKSPKKKPQEAEVERPSSPTKT
Sbjct: 661 LFKRKQHNGTCKSDVKVIKKSVKKELKKKASHSSLSKFRKSPKKKPQEAEVERPSSPTKT 720

Query: 721 ITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISELXXXXXXXXXXXXVNYD 780
           ITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISEL            VNYD
Sbjct: 721 ITTEDIDTASVIEPEVRSSNASTLLPDSHTSHSSEFVVETISELDGDDSFDISGGDVNYD 780

Query: 781 VEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFT 840
           VEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFT
Sbjct: 781 VEVHSSISRDTTAGLEEDIGAEREDNTSPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFT 840

Query: 841 DSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYL 900
           DSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYL
Sbjct: 841 DSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYL 900

Query: 901 NLVNHTLYMEQVGTGDIAFNGDSALG 926
           NLVNHTLYMEQVGTGDIAFNGDSALG
Sbjct: 901 NLVNHTLYMEQVGTGDIAFNGDSALG 926

>Kwal_27.10318
          Length = 925

 Score =  236 bits (603), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 166/436 (38%), Positives = 242/436 (55%), Gaps = 47/436 (10%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           EKRKS+VLIAA+SLD+E+Q+VKNLKR+S GSMDL +DPE+EF+++               
Sbjct: 31  EKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRMSPSHSQRSS------- 83

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIXXX 165
                 + +  E + E+ ++D+D+  + + + ++DSI++T  EYL +      E+     
Sbjct: 84  ----SSDAVSLESQAEEPNQDDDS--DDNLSYLNDSIELTAHEYLEEPRDFLVER----- 132

Query: 166 XXXXXXXXXXXXXXXXLSGVKTLA-HDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKP 224
                           LSGV+         ++ N  D    ++TQNL WVPA+QHPNVKP
Sbjct: 133 --SSVSKSEDSHNGRNLSGVRRGGMSKKPRELSNGGDD---NVTQNLFWVPANQHPNVKP 187

Query: 225 ENYLELIQDTLQNIQISTNQDIDENKLELGNNHVI---------SNRKRTG--SVVRRPS 273
           ENYLEL+QDTL  + I +  +   +K   GNN  +         S++ R+G  S+VRRPS
Sbjct: 188 ENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPS 247

Query: 274 RLKTSYTKFDD----EPPLADKPQE-GEIQVDKRISSSDIKTIRSVSLKEITEELTKISN 328
            L+ SYT+ +D    E   +D+  E  + +++  I +    T    SLK+ITEELT+ISN
Sbjct: 248 GLRKSYTELEDLLQHEIQDSDENNENAQSELNNIIKNRPRATSSGSSLKDITEELTRISN 307

Query: 329 NAGLTDSDAVTLARSLSMSGSFTNESLH----LNGNHTENDNEFASNMFNETGLTIPERS 384
            AG TD DAV LAR+LSM+ S+  E        N +HT  D+E+AS +  + GL IP RS
Sbjct: 308 KAGFTDGDAVCLARTLSMASSYDGEQSQANQSANTDHTP-DSEYASTILTKNGLAIPARS 366

Query: 385 SLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSPASYTQVPQEQASLNDFH 444
           SLRRSKFNTY+IR    S       +       N+ R+        +   +   S+NDF+
Sbjct: 367 SLRRSKFNTYRIRTPNGS--SVTSSSLRSTSLPNEERKDPEGYIEKSDRLRSPTSVNDFN 424

Query: 445 EIFDHYRRTSTDWSTE 460
           EI+DHYR+ S   ++E
Sbjct: 425 EIYDHYRQGSVGSTSE 440

 Score =  176 bits (447), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 81/113 (71%), Positives = 94/113 (83%), Gaps = 4/113 (3%)

Query: 804 EDNTS--PTAPQIS--TLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMF 859
           EDN    P AP     TLPPRKLTF DVVKP+  N+P+KF+DS+FGFPLP +T STV+M 
Sbjct: 794 EDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMI 853

Query: 860 DHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           DHRL INVERAIYRLSHLKL DP RELRQQV+LSNFMY+YLNLVNH+LY++Q+
Sbjct: 854 DHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQL 906

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  224 bits (572), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 153/399 (38%), Positives = 213/399 (53%), Gaps = 73/399 (18%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           +KRKS+VLIAA+SLD E+++VKNLKRLSIGSMDL++DPELE++V+               
Sbjct: 7   DKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVSSRQGTGTATDQDTGT 66

Query: 106 XXLHEENI----IRSEQKE-EQGSEDND-------------------AYEEGDATN--VD 139
             +   +I     +SEQ E E G++DN                    A EE D +    D
Sbjct: 67  PYIATSSIKTETTKSEQGEQEYGNDDNQETQLSHSSLSEDDTTTAGAAVEEEDDSYSFTD 126

Query: 140 DSIDITQTEYL------------HDEETLEKEKIIXXXXXXXXXXXXXXXXXXXLSGVKT 187
           DS+D+T  EYL            +  E L + +++                         
Sbjct: 127 DSMDVTNAEYLDKDAQANMINNNYRHEPLPRRRVLSGSISRSISGTSSTSDG-------- 178

Query: 188 LAHDVVLDVENDHDSKMVDLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDID 247
                     ND       L QNLLWV ADQHPNVKPENYLEL+Q+TL+N+ +       
Sbjct: 179 ----------NDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTA 228

Query: 248 ENKLELGNNHVISNRKRT----GSVVRRPSRLKTSYTKF---DDEPPLADKPQEGEIQVD 300
                   + + + RKR+     S+ RRPSRL+TSYT+    D++  + D+P        
Sbjct: 229 NETQAQSLSGLKTLRKRSMQSGNSLARRPSRLRTSYTELSEDDEDKGMTDQPLAA----- 283

Query: 301 KRISSSDIKTIRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTNESL--HLN 358
              ++  + + R+VSLK+ITEELTK+SN AGLTD+DAVTLAR+L ++   T +S    L+
Sbjct: 284 ---AAPTMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTGQGLS 340

Query: 359 GNHTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIR 397
            N  + + EFAS MF ++G T+P R SLRRSKFNTY+I+
Sbjct: 341 NNLADEEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQ 379

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 81/110 (73%), Positives = 93/110 (84%)

Query: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876
           LPPRKLTF DV+KPD  N+P+KFTDSAFGFPLP +T STVIMFDHRL I+VERAIYRLSH
Sbjct: 824 LPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYRLSH 883

Query: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTGDIAFNGDSALG 926
           LKLSDP R LRQQVLLSNFMY+YLNLVNH+LY++Q+    +  NG   +G
Sbjct: 884 LKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEEHMGNNGSMNMG 933

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  220 bits (561), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 165/437 (37%), Positives = 228/437 (52%), Gaps = 36/437 (8%)

Query: 42  KELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXX 101
           ++  EKRKS+VLIAA+SLD E+QNVKNLKR+SIGSMDL++DPE+EF++N           
Sbjct: 67  RQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSASPR 126

Query: 102 XXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDA-TNVDDSIDITQTEYLHDEETLEKEK 160
                   E   + +EQ  EQG E     E  DA ++   S D  + E L    ++   +
Sbjct: 127 NSLTEESLEWFQLSAEQ--EQGGELPLHAESIDAHSSAGGSSDTARDELLTSASSVVPSE 184

Query: 161 IIXXXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPADQHP 220
            +                   +S    L      D  +   +     + NLLWV ADQHP
Sbjct: 185 ELSCSHPLSPPAAAKKSTL--MSSRSKLGRQHT-DTTHTKQATGEPFSSNLLWVRADQHP 241

Query: 221 NVKPENYLELIQDTLQNIQISTNQDIDENKLELGNNHVISNRKRTG---SVVRRPSRLKT 277
           NVKPENYLEL+ DTL N++I       ++ ++  N  V +    T    S+VR+ SRL+ 
Sbjct: 242 NVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVANGESSTASARSLVRKQSRLRK 301

Query: 278 SYTKFD--DEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNAGLTDS 335
           S+T+ +  +E    D     EI V KR        +R  SLKEITEELT+ISNNAGLTDS
Sbjct: 302 SFTEVEAIEESQFTDS-IGSEIPVGKR--------MRVSSLKEITEELTRISNNAGLTDS 352

Query: 336 DAVTLARSLSMSGSFTNESLHLN---GNHTENDNEFASNMFNETGLTIPERSSLRRSKFN 392
           DA+TLAR+L +     +E    +    +    +NE+AS++  + GL IP RSSLRRSKF 
Sbjct: 353 DAITLARTLGIGSQSADEHATFSECVPSAEAEENEYASSILAKNGLAIPARSSLRRSKFT 412

Query: 393 TYKIRLEGS-SLPQAVKLNSLMNIQTNDNRRS-------ASSPASYTQVPQEQASL---- 440
           TY+IR  GS S P   K  S  ++     R S       A+   S+ ++  E  SL    
Sbjct: 413 TYRIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSHPRLSGENTSLAPQS 472

Query: 441 -NDFHEIFDHYRRTSTD 456
            N  ++I+DHY  + TD
Sbjct: 473 PNSINDIYDHYNTSDTD 489

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 88/97 (90%)

Query: 816 TLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLS 875
           +LPPRKL F+DV++P+  N+P+KFT SAFGFPLP +T STVIMFDHRL I VERAIYRLS
Sbjct: 895 SLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLS 954

Query: 876 HLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           HLKLSDP RELRQQVLLSNFMYSYLNLVNH+LY++Q+
Sbjct: 955 HLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 991

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  212 bits (540), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 178/481 (37%), Positives = 241/481 (50%), Gaps = 119/481 (24%)

Query: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXX 105
           +KRKS+VLIAA+SLD EI++VKNLKRLSIGSMDL+IDPEL+ K                 
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGES------------ 71

Query: 106 XXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDS--IDITQTEYLHDEETLEKEKIIX 163
                     S ++   G+  + A    D T V+++   D T  E LH       E    
Sbjct: 72  ----------SGRRSWSGTTSSSASMPSDTTTVNNTRYSDPTPLENLHGRGNSGIE---- 117

Query: 164 XXXXXXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLL-----WVPADQ 218
                               G+K   H           S    L  N+L     WVPA+Q
Sbjct: 118 ---------SSNKTKQGNYLGIKKGVH-----------SPSRKLNANVLKKNLLWVPANQ 157

Query: 219 HPNVKPENYLELIQDTLQNIQIS-----------TNQDIDEN-------KLELGNNHVIS 260
           HPNVKP+N+LEL+QDTLQNIQ+S            N DI++N         E   N+ I+
Sbjct: 158 HPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTIN 217

Query: 261 -----NRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDK---RISSSDIKTIR 312
                +R    S++RRPS L+ SYT+FDD     +K       V+K   RIS   IK  R
Sbjct: 218 LNRGLSRHGNASLIRRPSTLRRSYTEFDDNEDDDNKGDSASETVNKVEERISK--IKE-R 274

Query: 313 SVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTN-------ESLHLNGN----- 360
            VSL++ITEELTKISN+AGLTD+DA+TLAR+LSM+GS+++       E  +  G+     
Sbjct: 275 PVSLRDITEELTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFST 334

Query: 361 ---HTENDNEFASNMFNETGLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQT 417
              +T +D EFASNM     +T PERSSLRRS+FNTY+IR    S  Q  ++   ++   
Sbjct: 335 SQANTLDDGEFASNMPINNTMTWPERSSLRRSRFNTYRIR----SQEQEKEVEQSVDEMK 390

Query: 418 NDNRRSASSPASYTQV-------PQEQ-----------ASLNDFHEIFDHYRRTSTDWST 459
           ND+        +  +V       P  Q            S+ DF +I++HYR++S +W  
Sbjct: 391 NDDEERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQ 450

Query: 460 E 460
           E
Sbjct: 451 E 451

 Score =  181 bits (460), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 3/109 (2%)

Query: 808 SPTAPQI---STLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLG 864
           +P AP +   S LPPRKLTF DV KPD  N+P++FTDSAFGFPLP++T STVIMFDHRL 
Sbjct: 794 APAAPPLKHTSILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLP 853

Query: 865 INVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVG 913
           INVERAIYRLSHLKLS+  R LR+QVLLSNFMY+YLNLVNHTLYMEQV 
Sbjct: 854 INVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902

>Scas_650.22
          Length = 993

 Score =  210 bits (534), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 182/540 (33%), Positives = 258/540 (47%), Gaps = 142/540 (26%)

Query: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI------------------------- 240
           DLT+NLLWVPA+QHPNVKPENYLEL+QDTLQNI +                         
Sbjct: 195 DLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENIDISK 254

Query: 241 ---STNQDIDENKLELGNNHV-ISNRKRTGSVVRRPSRLKTSYTKFDDEPPLADKPQEGE 296
              S  + ID +   L    + I+NR R  S+VRRPSRL+TSYT+F+++       +E E
Sbjct: 255 SNMSEEEPIDRHPQSLDKTFLEITNRNR--SLVRRPSRLRTSYTEFEEDD--YSNSEESE 310

Query: 297 IQVDK-RISSSDIKTI----------------RSVSLKEITEELTKISNNAGLTDSDAVT 339
            + ++ ++SS + K                  RSVSLK+ITEELT ISN AGLTDSDA+T
Sbjct: 311 AKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAIT 370

Query: 340 LARSLSMSGSFTNESLHLNGNHTEN----DNEFASNMFNETGLTIPERSSLRRSKFNTYK 395
           LAR+LSM+ SF++ +++L  +  +N    ++EFASNMF + GLTIPERSSLRRSKFNTY+
Sbjct: 371 LARTLSMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTYR 430

Query: 396 IRLEGSSLPQAVKLNSLMN--------IQTNDNRRSASSPASYTQ----VPQEQASLNDF 443
           IR   SS     K + L+           T+D +R   SP S+T     +    +S    
Sbjct: 431 IRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQR---SPVSFTNRDSYLATTTSSPGSI 487

Query: 444 HEIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHAXXXXXXXXXXXXXXXXXVLIKPH 503
            +++DHY+  +     E+++  D+ N  + + DL+HA                 +L+KP 
Sbjct: 488 SDLYDHYQDNA-----ESKQGNDNDN-EARQGDLSHASISQESSFLSNESSNDSILVKPL 541

Query: 504 NTGSMISEKLDQHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXANEQTYQQLTXXXXXXXC 563
            + SMI E LD                                ++  YQ+++        
Sbjct: 542 GSKSMIHENLDN-------------------------GQDHDDDQPAYQKVSKLNPTIPD 576

Query: 564 VDNEKADFVNLSVS-RRAKSTKRASERIN------------HSKNRHSPIFQIHSEEAKX 610
               K      S S  RA S + A+  +N             SK+RH PI     +  K 
Sbjct: 577 TSRSKHKRNGWSWSGNRANSEEDATVLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLK- 635

Query: 611 XXXXXXXXXXXXXXXXXXTAPAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRKQH-NG 669
                                  + K+ ELP +    +HK+ ++EKR  KLF+RK H NG
Sbjct: 636 -----------------------INKEAELPKE----SHKRETIEKRFVKLFRRKGHDNG 668

 Score =  187 bits (474), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/109 (79%), Positives = 92/109 (84%), Gaps = 4/109 (3%)

Query: 817 LPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSH 876
           LP RKLTF DV +PD  NAPI+FTDSAFGFPLPM+T STVIMFDHRLGINVERAIYRLSH
Sbjct: 850 LPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSH 909

Query: 877 LKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTG----DIAFNG 921
           LKLSD  RELRQQVLLSNFMY+YLNLVNHTLYMEQV       D+A  G
Sbjct: 910 LKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITG 958

 Score =  102 bits (254), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 10/125 (8%)

Query: 28  NIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEF 87
           N  +  +RKT  S +   +KRKS+VLIAA+SLD E+Q+VKNLKRLSIGSMDL+IDPELEF
Sbjct: 4   NTNLLPLRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEF 63

Query: 88  KVNXXXXXXXXXXXXXXXXXLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQT 147
           +VN                        RS +  EQ +E  D   +  + ++DDSI++TQT
Sbjct: 64  RVNNDKSNQSTPIGSYE----------RSNENLEQINEPEDNENDESSVSIDDSIELTQT 113

Query: 148 EYLHD 152
           EYLHD
Sbjct: 114 EYLHD 118

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  173 bits (438), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 2/113 (1%)

Query: 801 AEREDNT--SPTAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIM 858
           ++RE+ T  S TA +    PPRKLTF DV K D +NAPI+FTDSAFGFPLP +T STVIM
Sbjct: 703 SQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTVIM 762

Query: 859 FDHRLGINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQ 911
           FDHRL I+VERAIYRLSHLKLS+  R LR+QVLLSNFMYSYLNLVNHTLYMEQ
Sbjct: 763 FDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  141 bits (355), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 157/290 (54%), Gaps = 54/290 (18%)

Query: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQISTNQDIDE---NKLELGNNHVISNR 262
           ++ QNLLWV ADQHPNVKPENY+EL+QD L NIQI   ++ D+   + L+  + +  SN 
Sbjct: 149 EVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNN 208

Query: 263 KRT---GSVVRRPSRLKTSYTKFDDEPPLADKPQEGEIQVDKRISSSDIKTIRSVSLKEI 319
           KR+     +VRRPS L+ SYT+FD+   + D   + +   +  + S+     +  +LK+I
Sbjct: 209 KRSPNNTGLVRRPSLLRKSYTEFDE---VKDSDIKEQSSTNNNVDSTPHN--KKFTLKDI 263

Query: 320 TEELTKISNNAGLTDSDAVTLARSLSMSG-SFTNESLHLN----------GNHTENDNEF 368
           TEELT+ISN AGLT++DAVTLAR+LSM+  +  +E+  L                ND+ +
Sbjct: 264 TEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNY 323

Query: 369 ASNMFNET-GLTIPERSSLRRSKFNTYKIRLEGSSLPQAVKLNSLMNIQTNDNRRSASSP 427
           AS M   T  L   E S+L+RSK+ TY IR +    P                    + P
Sbjct: 324 ASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKDP--------------------TIP 362

Query: 428 ASYTQVPQE--QASLNDFHEIFDHYRRTSTDWST--------ENEKYVDS 467
            S     Q+  +AS    ++I+DHYR  S DWS+        EN+K  D+
Sbjct: 363 VSTESQHQDVIEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDT 412

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 35/38 (92%)

Query: 50 SDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEF 87
          S+V IAA+SLD E+++VKNLKRLSIGSMDL++DPE++ 
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  167 bits (423), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 207/377 (54%), Gaps = 54/377 (14%)

Query: 50  SDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNXXXXXXXXXXXXXXXXXLH 109
           S+ L AA+SLD E+QNVKNLKRLSIGS+DL+ DPEL   V                    
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTE---------------R 65

Query: 110 EENIIRSEQKEEQGSEDNDAYEEGDATNVDD---SIDITQTEYL--HD---EETLEKEKI 161
           E+    ++      +E++D   E D ++ D+   SID T+ EYL  +D   E + E  K 
Sbjct: 66  EDTSYDADLSNGSFTEEDDTTTEIDGSDADETSASIDRTRVEYLTSYDNTQESSNESPKG 125

Query: 162 IXXXXX-----XXXXXXXXXXXXXXLSGVKTLAHDVVLDVENDHDSKMVDLTQNLLWVPA 216
           +                        L G ++L++  +   +N+  S    ++  L WVPA
Sbjct: 126 VARTRSLNLNYHANSNSDISIKERTLRGSRSLSN--LKKPKNEEQS----VSDKLFWVPA 179

Query: 217 DQHPNVKPENYLELIQDTLQNIQ-ISTN---QDIDENKLELGNNHVIS-NRKRTGSVVRR 271
           +QHPNVKPENYLEL+++TL  I+ I+T+   +  + ++ E+ N   I+ N +  GS+VRR
Sbjct: 180 NQHPNVKPENYLELVKETLNKIRDINTDGKEKSENNSEEEVSNKENINENGRLRGSIVRR 239

Query: 272 PSRLKTSYTKFDDEP-PLADKPQEGEIQVDKRISSSDIKTIRSVSLKEITEELTKISNNA 330
           PS+L+ SYT+F  E   L DK     +  ++ IS+ +    + +SLKEIT EL K SN A
Sbjct: 240 PSKLRKSYTEFSSEDLELLDKA----LSNNRIISTRNTTNSKRLSLKEITNELVKHSNKA 295

Query: 331 GLTDSDAVTLARSLSMSGSFT--NESLHLNGNHTE--------NDNEFASNMFNETGLTI 380
           GLTD +AVTLAR+LS++ S T  NE+   + ++TE        +D+ FA+ +   +    
Sbjct: 296 GLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTFATAVVGNSHSLA 355

Query: 381 PERSSLRRSKFNTYKIR 397
              SSLRRSKFNTY+++
Sbjct: 356 SNTSSLRRSKFNTYRVK 372

 Score =  162 bits (411), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 73/94 (77%), Positives = 84/94 (89%)

Query: 819 PRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVERAIYRLSHLK 878
           P+KLTF+DV KP+ +NAP++FTDSAFGFPLP +T STVIM DHRLGINVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 879 LSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQV 912
           LS+  RELRQQVLLSNFMY+YLNLV HTL +E+ 
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEA 789

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,034,681
Number of extensions: 1137782
Number of successful extensions: 5137
Number of sequences better than 10.0: 73
Number of HSP's gapped: 5219
Number of HSP's successfully gapped: 92
Length of query: 926
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 815
Effective length of database: 12,753,511
Effective search space: 10394111465
Effective search space used: 10394111465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)