Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YML108W105874483e-59
Kwal_27.10328127912821e-33
AAL184W112872714e-32
KLLA0D01661g112862705e-32
CAGL0J06666g112862645e-31
Scas_650.23*115972602e-30
Sklu_767.199532288e-26
Scas_654.2127541601.5
Scas_718.6970883565.7
YMR308C (PSE1)108976558.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML108W
         (104 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown...   177   3e-59
Kwal_27.10328                                                         113   1e-33
AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..132...   108   4e-32
KLLA0D01661g complement(148193..148531) similar to sp|Q03759 Sac...   108   5e-32
CAGL0J06666g complement(636953..637291) similar to sp|Q03759 Sac...   106   5e-31
Scas_650.23*                                                          104   2e-30
Sklu_767.1 YML108W, Contig c767 652-951 reverse complement             92   8e-26
Scas_654.21                                                            28   1.5  
Scas_718.69                                                            26   5.7  
YMR308C (PSE1) [4262] chr13 complement(888951..892220) beta-Kary...    26   8.5  

>YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown
          function [318 bp, 105 aa]
          Length = 105

 Score =  177 bits (448), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 87/87 (100%), Positives = 87/87 (100%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF
Sbjct: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          DAEICIPNEGHIKYEISSDGLIVLMLD
Sbjct: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87

>Kwal_27.10328
          Length = 127

 Score =  113 bits (282), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 58/91 (63%), Positives = 67/91 (73%), Gaps = 5/91 (5%)

Query: 1   MSKSNTYRMLVLLEDDTK----INKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTW 56
           MS    YRMLVL+ED  K    ++ E E+     P   HEFVDELILPF +D++D LN W
Sbjct: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDA-PKATHEFVDELILPFEIDDMDTLNEW 73

Query: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
           FDKFDAEICIPNEG IKYEISSDGL+VL+LD
Sbjct: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLD 104

>AAL184W [3] [Homologous to ScYML108W - SH]
          complement(12906..13244) [339 bp, 112 aa]
          Length = 112

 Score =  108 bits (271), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 3/87 (3%)

Query: 1  MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKF 60
          M+  N YRM++LLE+  K +  D + ++      H+FVDEL+LP  VD+L+ LNTWFDKF
Sbjct: 1  MATDNFYRMMILLEEPHKQHSTDGRKIENAS---HDFVDELLLPIQVDDLEVLNTWFDKF 57

Query: 61 DAEICIPNEGHIKYEISSDGLIVLMLD 87
          D EICIPNEGHIKYEISSDGLIVL+LD
Sbjct: 58 DEEICIPNEGHIKYEISSDGLIVLILD 84

>KLLA0D01661g complement(148193..148531) similar to sp|Q03759
          Saccharomyces cerevisiae YML108w hypothetical protein
          singleton, start by similarity
          Length = 112

 Score =  108 bits (270), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 55/86 (63%), Positives = 63/86 (73%), Gaps = 3/86 (3%)

Query: 2  SKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFD 61
          +  N YRML+LLE+    +  D    K K    HEFVDEL LP  VDE+D LN+WFDKFD
Sbjct: 3  ATENVYRMLILLEEPISESAGD---TKKKQNATHEFVDELPLPIQVDEMDLLNSWFDKFD 59

Query: 62 AEICIPNEGHIKYEISSDGLIVLMLD 87
           +ICIPNEGHIKYEISSDGLIVL+LD
Sbjct: 60 EKICIPNEGHIKYEISSDGLIVLILD 85

>CAGL0J06666g complement(636953..637291) similar to sp|Q03759
          Saccharomyces cerevisiae YML108w, start by similarity
          Length = 112

 Score =  106 bits (264), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (75%), Gaps = 5/86 (5%)

Query: 4  SNTYRMLVLLEDDTKINKEDEKFLKGKPGK--MHEFVDELILPFNVDELDELNTWFDKFD 61
          SN YRM+VLLE+  +   ED      K  K  MHEF+DEL LPF +DE+D LN WFDKFD
Sbjct: 2  SNLYRMMVLLEEPME---EDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFD 58

Query: 62 AEICIPNEGHIKYEISSDGLIVLMLD 87
           EICIPNEGHIKYEI+SDGLIVL+LD
Sbjct: 59 DEICIPNEGHIKYEITSDGLIVLILD 84

>Scas_650.23*
          Length = 115

 Score =  104 bits (260), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 67/97 (69%), Gaps = 16/97 (16%)

Query: 1  MSKSNTYRMLVL----------LEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDEL 50
          MSK N YRMLVL           ++DT  +K  E      P K HEF++EL+LPF V EL
Sbjct: 1  MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATE------PKKTHEFIEELLLPFEVSEL 54

Query: 51 DELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
          D LN WFDKFD EICIPNEGHIKYEISSDGLIVL+LD
Sbjct: 55 DALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLD 91

>Sklu_767.1 YML108W, Contig c767 652-951 reverse complement
          Length = 99

 Score = 92.4 bits (228), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (90%)

Query: 35 HEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLD 87
          HEFVDEL+LP  VDE+D LN WFDKFD +ICIPNEG+IKYEISSDGLIVL+L+
Sbjct: 23 HEFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYIKYEISSDGLIVLILN 75

>Scas_654.21
          Length = 275

 Score = 27.7 bits (60), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 13 LEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDEL 53
          L ++  +N  +E  L    G MH F  EL   F   E++EL
Sbjct: 35 LNEEQGVNHIEESLLNALNGAMHTFAQELEHQFEAIEMEEL 75

>Scas_718.69
          Length = 708

 Score = 26.2 bits (56), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query: 9   MLVLLEDDTKINKEDEKFLKGK----PGKMHEFVDELILPFNVDELDELNTWFDKFDAEI 64
           + V+  DD   N ++E+ L         K+   + + I+P N+     LN W+DK    I
Sbjct: 283 LFVICLDDVAFNDDEEEELAKSMLCGTSKVQLDLKKSIVPLNIQSGTCLNRWYDKLQLII 342

Query: 65  CIPNEGHIKYEISS-DGLIVLML 86
               +    +E +  DG  VL L
Sbjct: 343 TKNAKAGFNFEHTGVDGHTVLRL 365

>YMR308C (PSE1) [4262] chr13 complement(888951..892220)
           beta-Karyopherin involved in nuclear import of ribosomal
           and other nuclear proteins, including Ste12p [3270 bp,
           1089 aa]
          Length = 1089

 Score = 25.8 bits (55), Expect = 8.5,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 19/76 (25%)

Query: 9   MLVLLEDDTKINKEDEKFLKGK-------------PGKMHEFVDELILPF------NVDE 49
           ++ LL +  K+N +D   LKGK               K HE   ELI         ++DE
Sbjct: 535 LMPLLLNVLKVNNKDNSVLKGKCMECATLIGFAVGKEKFHEHSQELISILVALQNSDIDE 594

Query: 50  LDELNTWFDKFDAEIC 65
            D L ++ ++  + IC
Sbjct: 595 DDALRSYLEQSWSRIC 610

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.140    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,251,304
Number of extensions: 140558
Number of successful extensions: 418
Number of sequences better than 10.0: 18
Number of HSP's gapped: 413
Number of HSP's successfully gapped: 18
Length of query: 104
Length of database: 16,596,109
Length adjustment: 75
Effective length of query: 29
Effective length of database: 13,999,759
Effective search space: 405993011
Effective search space used: 405993011
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)