Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YML099C (ARG81)88086543370.0
Scas_626.683987721530.0
Sklu_2397.884888620890.0
KLLA0D10197g85689019220.0
Kwal_27.968884188818170.0
AAL175W88387716950.0
CAGL0H06875g7025147116e-82
KLLA0F10373g348461311e-07
Scas_597.4475471312e-07
YBR240C (THI2)450541241e-06
Kwal_14.1631443441186e-06
Kwal_23.2905881411179e-06
YLR014C (PPR1)904501152e-05
AFL033W382521123e-05
KLLA0C16489g728561133e-05
Sklu_1373.2608391123e-05
Scas_521.28901271115e-05
Sklu_2321.3906411098e-05
KLLA0F20680g787391099e-05
AGL099C747451071e-04
Kwal_55.20674252411042e-04
YDR207C (UME6)836331072e-04
CAGL0L04400g987431052e-04
YLR256W (HAP1)1502571043e-04
Scas_721.94869461034e-04
CAGL0C01199g922461035e-04
KLLA0D11286g678871035e-04
CAGL0F05357g601391026e-04
KLLA0A10329g6391231026e-04
CAGL0D02904g887481026e-04
Kwal_26.6732676401017e-04
Scas_573.41478491018e-04
CAGL0B03421g1355521018e-04
AFR117C1152441000.001
KLLA0A04169g775331000.001
Scas_674.12*909391000.001
Scas_659.10757721000.001
Scas_596.470139990.001
Sklu_2191.271834980.002
ADR403C97034980.002
Scas_679.2677546980.002
KLLA0A03421g88045980.002
Kwal_23.317861148980.002
KLLA0D05038g673103980.002
KLLA0C10923g77551970.002
KLLA0A01804g94565970.002
AGL091W86633960.003
YDR213W (UPC2)91354960.003
YLR228C (ECM22)81446960.003
Scas_556.6102233950.004
YOR363C (PIP2)99640950.004
KLLA0D00484g100437950.004
Sklu_2376.692242950.004
Scas_717.3390451940.005
YJL089W (SIP4)82951940.005
Scas_663.1294433940.005
CAGL0F07865g84446940.005
YLR266C (PDR8)70142930.006
YDR421W (ARO80)95041940.006
Kwal_26.709583848930.006
Kwal_56.2456675535930.006
Kwal_23.312278846930.007
ABL099W80045930.007
KLLA0F22990g125337930.007
ADR405C80759920.008
Scas_711.3193229920.008
Kwal_55.2072282769920.009
Sklu_2064.292234900.014
Sklu_2301.151740890.019
AGL206C73557890.019
KLLA0A03443g97550890.019
CAGL0M12298g99447880.024
KLLA0F02387g72737880.024
YBL005W (PDR3)976114880.025
Kwal_23.652959838880.026
KLLA0F14322g71780880.026
YMR280C (CAT8)143341880.026
KLLA0F00572g59735870.030
Scas_590.2117238870.032
KLLA0D12650g65158870.033
Kwal_26.680594478870.034
Sklu_2434.1098334870.035
KLLA0F09559g65843870.035
AFR171W61293860.036
YLR278C134138870.037
CAGL0K05841g137246860.045
Kwal_56.2305877545860.048
AGR061C61237850.053
ADR404C87534850.054
YDL170W (UGA3)52841850.056
KLLA0F10835g75666850.057
ACL058W81738850.063
ADR199C94451850.067
YBL066C (SEF1)105736850.069
KLLA0F22880g116452840.072
KLLA0F02750g114850840.076
Kwal_14.2619116725840.077
YOR162C (YRR1)81048840.079
KLLA0C17050g95535840.079
KLLA0F04213g76839840.082
Kwal_26.810997037840.084
Scas_526.31109107840.089
CAGL0G09757g142338840.092
Kwal_34.1575162828830.094
CAGL0K11902g83135830.097
KLLA0D01452g144544830.11
CAGL0J07150g102233830.11
Scas_688.1776924820.13
Sklu_1622.277835820.14
YOR337W (TEA1)75944820.14
ADR365W70144820.14
YAL051W (OAF1)106240820.14
CAGL0E05434g81637820.14
YDR034C (LYS14)79035820.14
KLLA0C04620g126947820.14
AER183C87966820.14
Scas_696.44116441820.15
YLL054C76929810.15
YKL222C70543810.15
YLR451W (LEU3)88647810.16
Kwal_47.1723394838810.18
AGL233C87245810.18
KLLA0D10593g92542810.18
YHR056C (RSC30)88328810.19
Kwal_47.1808974528810.19
CAGL0F03025g92853800.21
YMR019W (STB4)94953800.21
Kwal_14.81956832800.21
YPR196W47029800.21
YOL089C (HAL9)103051800.22
KLLA0E19701g68144800.22
Scas_630.1470148800.23
YGL013C (PDR1)106854800.24
YCR106W (RDS1)83228800.25
YBR297W (MAL33)46843790.26
KLLA0C19228g59169790.27
Scas_588.1183526790.27
Sklu_2296.691961790.27
AGL361C69629790.30
YOR172W (YRM1)78639790.30
Kwal_23.642573544790.30
KLLA0D10153g65544790.31
Scas_657.385623790.32
AER370W80144790.34
Kwal_27.10232120944790.35
Sklu_2411.1168742780.35
Scas_605.1161860780.36
AFL160C64845780.37
Scas_702.7111350780.37
ABL121C128529780.39
Scas_699.793539780.41
ACR028C60129780.42
CAGL0F09229g83540780.44
CAGL0H01507g79471770.46
CAGL0H00396g94032770.47
KLLA0C14212g104050770.49
Scas_550.5*83228770.50
YKL015W (PUT3)97935770.51
KLLA0D09977g63426770.52
ABR174W86432770.53
CAGL0A04455g109850770.53
AFR096W85244770.54
Scas_638.14104333770.60
CAGL0I02552g100548760.61
Scas_661.2374166760.64
YIL130W96448760.65
YPL248C (GAL4)88129760.65
Scas_518.591965760.70
Scas_637.799839760.78
CAGL0F02519g83229750.79
Kwal_56.2467064330750.82
CAGL0I07755g105350750.83
Scas_720.5889029750.84
YNR063W60728750.86
AGR280C110638750.87
Scas_715.3111536750.96
Kwal_55.2188488241741.2
KLLA0F18084g86029731.4
KLLA0A06039g65728731.5
Kwal_47.1693966941731.6
Kwal_47.1768185446731.8
Scas_625.5114147721.9
Kwal_26.666457947721.9
KLLA0A02585g37029712.2
Scas_709.5175939712.3
AGR369W105136722.3
KLLA0D12672g86529712.3
KLLA0F19602g60335712.5
KLLA0F13904g57979712.7
CAGL0L04576g86521712.8
KLLA0E20405g113836713.0
Scas_680.2573840703.1
Kwal_47.1750692446703.3
Scas_449.163629703.3
YPL133C (RDS2)44664693.7
ADL273C62360694.2
YGR288W (MAL13)47329694.5
Kwal_23.351457929694.8
Kwal_26.744871423685.3
YDR520C77254685.8
KLLA0E14036g67842686.1
YOR204W (DED1)60485686.4
KLLA0A09251g68849686.5
CAGL0H01683g69933669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YML099C
         (865 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...  1675   0.0  
Scas_626.6                                                            833   0.0  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                          809   0.0  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...   744   0.0  
Kwal_27.9688                                                          704   0.0  
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...   657   0.0  
CAGL0H06875g complement(682518..684626) some similarities with s...   278   6e-82
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    55   1e-07
Scas_597.4                                                             55   2e-07
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    52   1e-06
Kwal_14.1631                                                           50   6e-06
Kwal_23.2905                                                           50   9e-06
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    49   2e-05
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    48   3e-05
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    48   3e-05
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            48   3e-05
Scas_521.2                                                             47   5e-05
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           47   8e-05
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    47   9e-05
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    46   1e-04
Kwal_55.20674                                                          45   2e-04
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    46   2e-04
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    45   2e-04
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    45   3e-04
Scas_721.94                                                            44   4e-04
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    44   5e-04
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    44   5e-04
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    44   6e-04
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    44   6e-04
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    44   6e-04
Kwal_26.6732                                                           44   7e-04
Scas_573.4                                                             44   8e-04
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    44   8e-04
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    43   0.001
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    43   0.001
Scas_674.12*                                                           43   0.001
Scas_659.10                                                            43   0.001
Scas_596.4                                                             43   0.001
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         42   0.002
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    42   0.002
Scas_679.26                                                            42   0.002
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    42   0.002
Kwal_23.3178                                                           42   0.002
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    42   0.002
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    42   0.002
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    42   0.002
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    42   0.003
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    42   0.003
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    42   0.003
Scas_556.6                                                             41   0.004
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    41   0.004
KLLA0D00484g 44879..47893 no similarity, hypothetical start            41   0.004
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              41   0.004
Scas_717.33                                                            41   0.005
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    41   0.005
Scas_663.12                                                            41   0.005
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    41   0.005
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    40   0.006
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    41   0.006
Kwal_26.7095                                                           40   0.006
Kwal_56.24566                                                          40   0.006
Kwal_23.3122                                                           40   0.007
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    40   0.007
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    40   0.007
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    40   0.008
Scas_711.31                                                            40   0.008
Kwal_55.20722                                                          40   0.009
Sklu_2064.2 , Contig c2064 873-3641                                    39   0.014
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                39   0.019
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    39   0.019
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    39   0.019
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    39   0.024
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    39   0.024
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    39   0.025
Kwal_23.6529                                                           39   0.026
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    39   0.026
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    39   0.026
KLLA0F00572g complement(42710..44503) some similarities with ca|...    38   0.030
Scas_590.2                                                             38   0.032
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    38   0.033
Kwal_26.6805                                                           38   0.034
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         38   0.035
KLLA0F09559g complement(876719..878695) some similarities with s...    38   0.035
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    38   0.036
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    38   0.037
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    38   0.045
Kwal_56.23058                                                          38   0.048
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    37   0.053
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    37   0.054
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    37   0.056
KLLA0F10835g 997512..999782 no similarity, hypothetical start          37   0.057
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    37   0.063
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    37   0.067
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    37   0.069
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    37   0.072
KLLA0F02750g complement(250368..253814) some similarities with s...    37   0.076
Kwal_14.2619                                                           37   0.077
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    37   0.079
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    37   0.079
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    37   0.082
Kwal_26.8109                                                           37   0.084
Scas_526.3                                                             37   0.089
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    37   0.092
Kwal_34.15751                                                          37   0.094
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    37   0.097
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    37   0.11 
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    37   0.11 
Scas_688.17                                                            36   0.13 
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            36   0.14 
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    36   0.14 
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    36   0.14 
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    36   0.14 
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    36   0.14 
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    36   0.14 
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    36   0.14 
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    36   0.14 
Scas_696.44                                                            36   0.15 
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    36   0.15 
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    36   0.15 
YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription fac...    36   0.16 
Kwal_47.17233                                                          36   0.18 
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    36   0.18 
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    36   0.18 
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    36   0.19 
Kwal_47.18089                                                          36   0.19 
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    35   0.21 
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    35   0.21 
Kwal_14.819                                                            35   0.21 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    35   0.21 
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    35   0.22 
KLLA0E19701g complement(1739869..1741914) some similarities with...    35   0.22 
Scas_630.14                                                            35   0.23 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    35   0.24 
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    35   0.25 
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    35   0.26 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    35   0.27 
Scas_588.11                                                            35   0.27 
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       35   0.27 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    35   0.30 
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    35   0.30 
Kwal_23.6425                                                           35   0.30 
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    35   0.31 
Scas_657.3                                                             35   0.32 
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    35   0.34 
Kwal_27.10232                                                          35   0.35 
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      35   0.35 
Scas_605.11                                                            35   0.36 
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    35   0.37 
Scas_702.7                                                             35   0.37 
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    35   0.39 
Scas_699.7                                                             35   0.41 
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    35   0.42 
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    35   0.44 
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    34   0.46 
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    34   0.47 
KLLA0C14212g complement(1229219..1232341) some similarities with...    34   0.49 
Scas_550.5*                                                            34   0.50 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    34   0.51 
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    34   0.52 
ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH] complement(7...    34   0.53 
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    34   0.53 
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    34   0.54 
Scas_638.14                                                            34   0.60 
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    34   0.61 
Scas_661.23                                                            34   0.64 
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    34   0.65 
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    34   0.65 
Scas_518.5                                                             34   0.70 
Scas_637.7                                                             34   0.78 
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    33   0.79 
Kwal_56.24670                                                          33   0.82 
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    33   0.83 
Scas_720.58                                                            33   0.84 
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    33   0.86 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    33   0.87 
Scas_715.3                                                             33   0.96 
Kwal_55.21884                                                          33   1.2  
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    33   1.4  
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    33   1.5  
Kwal_47.16939                                                          33   1.6  
Kwal_47.17681                                                          33   1.8  
Scas_625.5                                                             32   1.9  
Kwal_26.6664                                                           32   1.9  
KLLA0A02585g complement(226562..227674) some similarities with c...    32   2.2  
Scas_709.51                                                            32   2.3  
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    32   2.3  
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    32   2.3  
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    32   2.5  
KLLA0F13904g complement(1287758..1289497) some similarities with...    32   2.7  
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    32   2.8  
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    32   3.0  
Scas_680.25                                                            32   3.1  
Kwal_47.17506                                                          32   3.3  
Scas_449.1                                                             32   3.3  
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...    31   3.7  
ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C (...    31   4.2  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    31   4.5  
Kwal_23.3514                                                           31   4.8  
Kwal_26.7448                                                           31   5.3  
YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Prote...    31   5.8  
KLLA0E14036g complement(1239566..1241602) some similarities with...    31   6.1  
YOR204W (DED1) [4997] chr15 (722911..724725) ATP-dependent RNA h...    31   6.4  
KLLA0A09251g 808253..810319 some similarities with sp|P38699 Sac...    31   6.5  
CAGL0H01683g 162753..164852 similar to tr|Q04411 Saccharomyces c...    30   9.0  

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score = 1675 bits (4337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 810/865 (93%), Positives = 810/865 (93%)

Query: 1   MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
           MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP
Sbjct: 1   MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60

Query: 61  MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP 120
           MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP
Sbjct: 61  MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP 120

Query: 121 PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKXXXXXXXXXXXXXXXXXX 180
           PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAK                  
Sbjct: 121 PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKSLESSASISLSSLPSSST 180

Query: 181 XXFPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL 240
             FPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL
Sbjct: 181 ISFPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL 240

Query: 241 LSAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAASA 300
           LSAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAASA
Sbjct: 241 LSAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAASA 300

Query: 301 NDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEESRM 360
           NDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEESRM
Sbjct: 301 NDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEESRM 360

Query: 361 PKSMLELTSYSSDLPPELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKT 420
           PKSMLELTSYSSDLPPELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKT
Sbjct: 361 PKSMLELTSYSSDLPPELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVLEKNPWKT 420

Query: 421 LYFPRXXXXXXXXXXXXQXXXXXXXXXXXXXXVSCFHLQSKYPRNYKLQKYFLGLGIELR 480
           LYFPR            Q              VSCFHLQSKYPRNYKLQKYFLGLGIELR
Sbjct: 421 LYFPRALMALGDLAGLGQSSNSRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELR 480

Query: 481 NQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMK 540
           NQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMK
Sbjct: 481 NQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVESRMK 540

Query: 541 LRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSS 600
           LRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSS
Sbjct: 541 LRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATTSSS 600

Query: 601 EPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADXXXXXXXXXIFTNIATESYYNK 660
           EPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSAD         IFTNIATESYYNK
Sbjct: 601 EPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSSTTPPIFTNIATESYYNK 660

Query: 661 SDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSL 720
           SDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSL
Sbjct: 661 SDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTYLPVPRKFNELSL 720

Query: 721 NFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFL 780
           NFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFL
Sbjct: 721 NFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSLNCQFL 780

Query: 781 QNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGV 840
           QNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGV
Sbjct: 781 QNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEFRRWAAKLAESGV 840

Query: 841 GSYWGARQVMLEVWRRRKEDEPGDN 865
           GSYWGARQVMLEVWRRRKEDEPGDN
Sbjct: 841 GSYWGARQVMLEVWRRRKEDEPGDN 865

>Scas_626.6
          Length = 839

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/877 (51%), Positives = 555/877 (63%), Gaps = 65/877 (7%)

Query: 1   MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
           M  S+K   K+  RAKTFTGCWTCR RKVKCDLR P C RC+KS L CGGYDIKLRWSK 
Sbjct: 1   MRKSAKTQTKRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKL 60

Query: 61  MQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP 120
           ++FDPYGV +P   P+   N S S +EPQYQRRNIDFV+Y EEY++HEDMDDEL++LH P
Sbjct: 61  VKFDPYGVQLP---PSPNGN-SASNEEPQYQRRNIDFVKYKEEYIFHEDMDDELSILHAP 116

Query: 121 PIEKISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKXXXXXXXXXXXXXXXXXX 180
           P EKI+D KTWIIKKFGVF+GTDKIDKQYAPRKKR +   +                   
Sbjct: 117 PTEKIADGKTWIIKKFGVFRGTDKIDKQYAPRKKRRKPAPSTVSKRKTLKTGNKLSAKES 176

Query: 181 XXFPIRHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDAL 240
              PI +IED           + +    V   P+ +D+D    N+  YEWISSELRDD L
Sbjct: 177 AGKPI-NIEDS------PSKPMSNHQSPVNNIPSFVDFDLAMNNVPSYEWISSELRDDVL 229

Query: 241 LSAVTLQGHHLGHTQPQEISLEE--NSNVVSGEEHVNAKEHGCAFEADNQGSSTLPNKAA 298
           LSA  +QG  +        S +   N   VS     N    G     D+  + T PN   
Sbjct: 230 LSAFAIQGASINDVPDSTTSAKTSINQGTVSTGLFSNIPIDGTNSIGDD--TQTSPN--- 284

Query: 299 SANDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEES 358
             ND   Q  L LLF    + +     + ++                  K  L  P  +S
Sbjct: 285 --NDYTIQNALNLLFHNKQTPTSPSTSKGMV------------------KTLLDAPQSDS 324

Query: 359 RMPKSMLELTSYSSDLPPELVDI---------IPKTDLTVHGLARFLLNHYFNNVADKMT 409
            MP++++E+ +  S L  E+ +          IP + + VHG+ +FLLN+Y  NVAD MT
Sbjct: 325 HMPRTIMEIIN-PSPLELEIFEALNKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMT 383

Query: 410 VVVLEKNPWKTLYFPRXXXXXXXXXXXXQXXXXXXXXXXXXXXVSCFHLQSKYPRNYKLQ 469
           VV L +NPWK LYFPR                           VSCF+L+SK+ +N K  
Sbjct: 384 VVPLSRNPWKKLYFPRALQALGDLVGLGYTTNSRNSLLNALLAVSCFNLKSKFEKNSKEY 443

Query: 470 KYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHLA 529
            YFL LGIELR QASNFL +CLN+  ++ EKYKDVLTAILSMNSIDVVWGTM DCQ HL 
Sbjct: 444 NYFLNLGIELRKQASNFLNICLNSTVTV-EKYKDVLTAILSMNSIDVVWGTMEDCQRHLT 502

Query: 530 LCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEED-DNYK 588
           +CEDFVE RM  RP+IS K +TLHRIFSFLKLIQDSTALDKVR KEIVI   ++  D  K
Sbjct: 503 ICEDFVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNK 562

Query: 589 PLDTSNATTSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADXXXXXXXXXI 648
             D     TS++         G FRE+LN+ +GKI IE+++   +N   +         +
Sbjct: 563 VADPFVKDTSNN--------GGQFRESLNKLNGKIQIEYIRNDDSN-DNNEQSASSSPPM 613

Query: 649 FTNIATESYYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTY 708
           F NIA+ESYY         S++D +I+ TD+LYGLPNSLILLFSDCVRIVRHNEYYN+ Y
Sbjct: 614 FANIASESYYKPGQ----KSESDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKY 669

Query: 709 LPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYY 768
           L VPR+F E+ LNFEKRLLKWK EW F++EN++   FI+ T E +YHHTMSFY+ L+IYY
Sbjct: 670 LAVPREFTEICLNFEKRLLKWKPEWAFYKENTD--EFIDDTIEGVYHHTMSFYYGLVIYY 727

Query: 769 FTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEF 828
           F+MA+ LN QFLQ+YV KVL HLN + +L+D K VKIVPL+WQGF+AGC+   ++ QQEF
Sbjct: 728 FSMAKHLNNQFLQSYVEKVLLHLNKLTDLIDHKSVKIVPLMWQGFIAGCSSNMQDLQQEF 787

Query: 829 RRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDN 865
           R+WAAKLAESG+GSYWGARQVM EVWRRR  DEP DN
Sbjct: 788 RKWAAKLAESGMGSYWGARQVMFEVWRRRMNDEPNDN 824

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/886 (50%), Positives = 566/886 (63%), Gaps = 83/886 (9%)

Query: 6   KNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDP 65
           K+  +K  RAKTFTGCWTCR RKVKCDL  P C+RCE+S   CGGYDIKLRWSKP++FD 
Sbjct: 5   KSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDR 64

Query: 66  YGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKI 125
           YGV +P   P+  +  SGS DEPQ+QRRNI FVRY +EY ++EDMDDEL+ LH+PP+E I
Sbjct: 65  YGVQLP---PSPNSPDSGS-DEPQFQRRNIAFVRYQDEYEFYEDMDDELSALHSPPLENI 120

Query: 126 SDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKXXXXXXXXXXXXXXXXXXXXFPI 185
           + +KTWII KFGVF+GT+K+ K+Y PRKKR R                            
Sbjct: 121 AGDKTWIINKFGVFRGTEKVKKKYVPRKKRKRNVSYNRGGS------------------- 161

Query: 186 RHIEDKLRNKGHVKTGILSANDGVPPTPNLLDYDWNNLNITGYEWISSELRDDALLSAVT 245
             +  KL +   VK+   S+     PT +L D+D++++N TG+EWIS+ELRDDALLSA  
Sbjct: 162 --VSSKLSSTTSVKSKGSSSISNSTPT-DLFDFDFSSMNFTGHEWISNELRDDALLSASA 218

Query: 246 LQGHHLG-HTQPQEISLEENSNVVSGEEHVNAK-EHGCAFEADNQGSST--LPNKAASAN 301
           +QG      T P   +  E+S      +  NA  +H    +  NQ S+     N   ++ 
Sbjct: 219 VQGIPTNTFTFPAGGNHTESSATADFNDAKNASGQHHGQHQHRNQQSNIQGTVNGGFASI 278

Query: 302 DKLYQ--QNLKLLFQKNSSNSEEPDPQ---------ALIDDVFVNIEPRSLPASDLNKIT 350
           D + +  Q  +LL  +N    ++   Q         A  +D F ++ P +      N I+
Sbjct: 279 DPIAEVSQVYRLLSHRNEDKDKDVQEQQKHDTHQTIASQEDEFPSLVPLN------NLIS 332

Query: 351 LAPPNEESRMPKSMLELTSYSSDLP-PELVDI---------IPKTDLTVHGLARFLLNHY 400
           +  P  ESRMP+S+LE+    S +P P + ++         +P T L VHGLARFLLN+Y
Sbjct: 333 IHAPGGESRMPESVLEIVP--SVVPDPSIFNLQSDKNILLRLPTTGLHVHGLARFLLNYY 390

Query: 401 FNNVADKMTVVVLEKNPWKTLYFPRXXXXXXXXXXXXQXXXXXXXXXXXXXXVSCFHLQS 460
             NVAD MTVV L  NPWKT+YFPR                           VSCF+LQS
Sbjct: 391 LQNVADLMTVVALPTNPWKTIYFPRALKALGDLAGIGYTSNSRNSLLNALLAVSCFNLQS 450

Query: 461 KYPRNYKLQKYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGT 520
           K+P+N    +++L LGIE R+QASNFL+ CLN+ S+  E+YKD+LTAILSMNSIDVVWGT
Sbjct: 451 KFPKNTPQMRFYLYLGIEFRSQASNFLKKCLNS-SAHQERYKDILTAILSMNSIDVVWGT 509

Query: 521 MADCQDHLALCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILP 580
           MADCQ HL +CEDFVE RMK RP ISEK K LHRIFSFLKLIQDSTALDKVR  EIVI  
Sbjct: 510 MADCQYHLTICEDFVEERMKTRPKISEKAKALHRIFSFLKLIQDSTALDKVREGEIVI-- 567

Query: 581 SEEDDNYKPLDTSNATTSSSEPRVDV-VQEGLFREALNENDGKIHIEFVKEPITNVSADX 639
             +DD     D +      S+   D+ + +G F+E+LN+ DGKI IEFVK+P ++ S   
Sbjct: 568 --KDDE----DVTGEQLQESQTGQDLNIADGEFKESLNQKDGKIRIEFVKQPQSSSSGST 621

Query: 640 XXXXXXXXIFTNIATESYYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVR 699
                   IFTNI +E+YY        +S T ++I+ TD+LYGLPNSLIL FSDCVR+VR
Sbjct: 622 P-------IFTNITSETYYYPK-----MSTTTQDILSTDALYGLPNSLILCFSDCVRLVR 669

Query: 700 HNEYYNLTYLPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMS 759
           H EYY +  LP PRK+ +L   FEKRLL WKSEW+F++ ++  + F+N T E +YHHTMS
Sbjct: 670 HREYYKMNKLPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHT--REFVNDTIEGVYHHTMS 727

Query: 760 FYFSLIIYYFTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCAC 819
           FY+SLIIYYFTMAR LN Q LQ+YV KVL HLN + +L+D K VK+VPLIWQGF+AGC+ 
Sbjct: 728 FYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLIDHKNVKVVPLIWQGFIAGCSS 787

Query: 820 TDENRQQEFRRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDN 865
            D N Q  F++WAAKLA SG+GSYWGARQ+M EVWRRR   E  DN
Sbjct: 788 VDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEENDN 833

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/890 (47%), Positives = 533/890 (59%), Gaps = 93/890 (10%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPIPQN 73
           R KTFTGCWTCR RKVKCDLR P C+RCEK  L CGGYD+KLRW++P+QFD  G     N
Sbjct: 7   RVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG-----N 61

Query: 74  SPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKISDNKTWII 133
             AT T +    DEPQYQRRN+DFVRY EEYVY+EDMDDEL+ L +PP+E IS++KTWII
Sbjct: 62  VTATPTGIKDP-DEPQYQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLELISEDKTWII 120

Query: 134 KKFGVFKGTDKIDKQYAPRKKRNRKRVAKXXXXXXXXXXXXXXXXXXXXFPIRHIEDKLR 193
           KKFGVFKGTDK+ K+Y PRKKR + +V                        I   + KL 
Sbjct: 121 KKFGVFKGTDKVKKRYVPRKKRKKNQVFINA--------------------IEKAQKKLA 160

Query: 194 NKGH-VKTGILSANDGVP-PTP-------------------NLLDYDWNNLNITGYEWIS 232
           NK + VKT    + +G    TP                   +L ++D N+L   G EWIS
Sbjct: 161 NKKNKVKTADSDSKEGTNLCTPEDMESSSANDDHTSAQQLHSLFEFDMNSLLFPGNEWIS 220

Query: 233 SELRDDALLSAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADNQGSST 292
           +ELRDDALLSA  +QG  +     ++ +  +        +++  K++G      N G + 
Sbjct: 221 NELRDDALLSASAVQGETIPFMGIRQNNTPDTPQTPLTVDNM-GKKNGSVNGNCNDGRT- 278

Query: 293 LPNKAASANDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDL-NKITL 351
               + + N+    +  +LLF +  S S++P P  +  +        ++    L N + L
Sbjct: 279 ----SGNDNEDELARVYRLLFHRRGS-SDQPPPPTITSETKSGHAKETIGIVPLRNFVEL 333

Query: 352 APPNEESRMPKSMLELTSYSSDLPP---------ELVDIIPKTDLTVHGLARFLLNHYFN 402
             P   S MP+S +E+       P           L+DI P T + VHGLARFLLN+Y  
Sbjct: 334 NVPG--STMPRSAIEVIHSQVPDPSIFNRPGNTNPLLDI-PTTGVHVHGLARFLLNYYLQ 390

Query: 403 NVADKMTVVVLEKNPWKTLYFPRXXXXXXXXXXXXQXXXXXXXXXXXXXXVSCFHLQSKY 462
           NVAD MTVVVL  N WKT+YFPR                           VSCF+LQSK+
Sbjct: 391 NVADLMTVVVLPTNSWKTIYFPRALKALGDLTGIGYTSNSRNSLLNALLAVSCFNLQSKF 450

Query: 463 PRNYKLQKYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMA 522
           P+N    K+FL LGIE R QAS+FL+ CL+   +  E+YKD+LTAILSMNSIDVVWGTMA
Sbjct: 451 PKNSPEMKFFLTLGIEFRTQASSFLKRCLSNTVN-QERYKDILTAILSMNSIDVVWGTMA 509

Query: 523 DCQDHLALCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSE 582
           DCQ HLA+CEDFVE+RMK RP IS K K LHRIFSFLKLIQDST+LDKVR KEIVIL   
Sbjct: 510 DCQVHLAICEDFVENRMKTRPKISAKAKALHRIFSFLKLIQDSTSLDKVRTKEIVIL--- 566

Query: 583 EDDNYKPLDTSNATTSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEP-------ITNV 635
             DN   +D+  ++  S       +  G F+E+LN  DGKI IEF   P       +   
Sbjct: 567 --DNNSSIDSHISSGIS-------LSNGEFKESLNREDGKIVIEFFSSPSSGKPSPVAFP 617

Query: 636 SADXXXXXXXXXIFTNIATESYYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCV 695
                       IF+NIA+ESYY         + TD NI+ TD+LYGLPNSLILLFSDCV
Sbjct: 618 KGSHDSSGVTTPIFSNIASESYYYPKS-----NDTDNNILSTDALYGLPNSLILLFSDCV 672

Query: 696 RIVRHNEYYNLTYLPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYH 755
           R+ RH EYY    +  P+ F +L   FE+R+L WKSEW+F    S    F+N T E +YH
Sbjct: 673 RLARHLEYYRQHNIVTPKAFKKLCTEFEQRILSWKSEWDFKVPGSP-DHFVNDTIEGVYH 731

Query: 756 HTMSFYFSLIIYYFTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMA 815
           HTMSFY  LIIYYFT+ + L  ++++++V  VL+ L  + EL++ K VKIVPLIWQGFMA
Sbjct: 732 HTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVLNSLIQLTELIENKGVKIVPLIWQGFMA 791

Query: 816 GCACTDENRQQEFRRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDN 865
           GCAC D N Q EF+ WAAKL +SG+GSYWGARQ+M EVWRRR   E  D+
Sbjct: 792 GCACIDSNLQLEFKEWAAKLCKSGMGSYWGARQIMFEVWRRRLNGEQNDD 841

>Kwal_27.9688
          Length = 841

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/888 (45%), Positives = 526/888 (59%), Gaps = 93/888 (10%)

Query: 4   SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQF 63
           SS    K++ R KTFTGCWTCR RKVKCDL  P+CQRCEKS L CGGYDIKLRWS  ++F
Sbjct: 6   SSDTKGKEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKF 65

Query: 64  DPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIE 123
           + +G      SPA  T      +EPQ QRRN+ FV Y +EY ++EDMD+EL+ LH+P  +
Sbjct: 66  NKFGQVDSNGSPANGT------EEPQSQRRNVGFVTYKDEYEFYEDMDEELSALHSPSQD 119

Query: 124 KISDNKTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKXXXXXXXXXXXXXXXXXXXXF 183
           KISDNKTWIIKKFGVF+GT+ +  +Y PR+KR +                          
Sbjct: 120 KISDNKTWIIKKFGVFRGTENVKTKYTPRRKRRQAG------------------------ 155

Query: 184 PIRHIEDKLRN--KGHVKTGILSANDGVPPT---PNLLDYDWNNLNITGYEWISSELRDD 238
             R  ED+++      +K   ++A+  +  +    NL D+D++++N  G+EWI++ELRDD
Sbjct: 156 --RVSEDQIKKPPTTEIKRPHINADSEITSSQSLANLFDFDFSSMNFNGHEWIANELRDD 213

Query: 239 ALLSAVTLQGHHLGH--TQPQ-EISLEENSNVVSGEEHVNAKEHGCAFEADNQGSSTLPN 295
           ALLSA  +QG  + +   +PQ + S   N+   S    ++        + ++  ++    
Sbjct: 214 ALLSASAIQGGTMDNLFQRPQGQTSFSANNRRQSSYNTLHLPRRLQPDQEESDQTNNQLQ 273

Query: 296 KAASANDKLYQQNLKLLFQKNSSNSE--EPDPQALIDDVFVNIEPRSLPASDLNKITLAP 353
           KA  A+     +  KLLF +N   S+  +  P   IDD  V   PR++   D N I +  
Sbjct: 274 KAGPADVDDISRVYKLLFHRNEDRSKVTQQAPVVPIDDQHV---PRTIVPLD-NVILINS 329

Query: 354 PNEESRMPKSMLELTSYSSDLPPELV-------DII---PKTDLTVHGLARFLLNHYFNN 403
              E RMPK +LE+ +  SD+P   +       +I+   P T L VHGL RFL+N+Y  N
Sbjct: 330 SGTEGRMPKQVLEVVN--SDVPDHTIFNLPTNDNILLRLPTTGLKVHGLTRFLMNYYLQN 387

Query: 404 VADKMTVVVLEKNPWKTLYFPRXXXXXXXXXXXXQXXXXXXXXXXXXXXVSCFHLQSKYP 463
           V D MTVV L  NPW+T+YFPR                           VSCF+LQSK+P
Sbjct: 388 VVDLMTVVALPTNPWRTIYFPRAAQALGDIAGVGYTSNSRNSLLNAILAVSCFNLQSKFP 447

Query: 464 RNYKLQKYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMAD 523
           RN    +++L LGIE R QAS+FL+ CL   S+  E+YKD+LTAILSMNSIDVVWGTMAD
Sbjct: 448 RNSPEMRFYLQLGIEFRGQASDFLKACL-ASSAKQERYKDILTAILSMNSIDVVWGTMAD 506

Query: 524 CQDHLALCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEE 583
           CQ HL LCE  VE RMK RP +S K + LHRIFSFLKLIQDSTALDKV  +EIVI     
Sbjct: 507 CQYHLTLCEGLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVI----- 561

Query: 584 DDNYKPLDTSNATTSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADXXXXX 643
            D+  P        S +         G F+E+LN+ DGKI IE+VK+   + S       
Sbjct: 562 -DHRIPESVVENDVSDN--------GGEFKESLNKVDGKIRIEYVKQNRKSGST------ 606

Query: 644 XXXXIFTNIATESYY------NKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRI 697
               IF ++A+++YY         D +K +   D  ++ TD+LYGLPNS+ILLFSDCVR+
Sbjct: 607 ---PIFDSVASQTYYYPGNRMGSGDYTKSLEGND--VLSTDALYGLPNSIILLFSDCVRL 661

Query: 698 VRHNEYYNLTYLPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHT 757
            RH EYY       P  +  L   FEK+L  W SEW+FH+ NS    F+N T E +Y+HT
Sbjct: 662 ARHREYYRKHDQDPPESYEILCAEFEKKLSGWTSEWDFHKPNS--TEFVNDTIEGVYYHT 719

Query: 758 MSFYFSLIIYYFTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGC 817
           MSFY SLIIYY TMAR    Q +Q  V   L +LN + EL++ K VKIVPLIWQGF+AGC
Sbjct: 720 MSFYQSLIIYYNTMARGRRHQDIQENVRNALTYLNKLTELIN-KGVKIVPLIWQGFIAGC 778

Query: 818 ACTDENRQQEFRRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDN 865
           +  D + Q +++ WAA+LA SG+GSYWGARQ+M EVWRRR   E  DN
Sbjct: 779 SAIDTDLQLQYKEWAARLANSGMGSYWGARQIMFEVWRRRVNGENCDN 826

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/877 (43%), Positives = 508/877 (57%), Gaps = 70/877 (7%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPIPQN 73
           RAKTFTGCWTCR RKVKCDL  P CQRCEKS L CGGYDIKLRWS P++FD +G      
Sbjct: 37  RAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFG------ 90

Query: 74  SPATTTNLSGSVDEPQ--YQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKISDNKTW 131
           +     +  G  ++P   +QRRNI FVRYDEEY Y+EDMDDEL+ LH+PP+E I+D+KTW
Sbjct: 91  NQMAGEDRDGDGEQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKTW 150

Query: 132 IIKKFGVFKGTDKIDKQYAPRKKRNRKRVAKXXXXXXXXXXXXXXXXXXXXFPIRHIEDK 191
           IIK+FGVFKGTD++ ++Y PRK+R    V                           ++  
Sbjct: 151 IIKRFGVFKGTDRVKRKYVPRKRRKVNPVFADAMAREHRRKLEEREKQARRKRKGELQGS 210

Query: 192 L-----RNKGHVKTGILSANDG-----VPPTPNLLDYDWNNLNITGYEWISSELRDDALL 241
           L        G  K G  +A        V  TP L D+D++   +   EW++ EL+DD  L
Sbjct: 211 LGSGNATGAGFAKAGPPAAESAGAMSPVSATP-LFDFDFSTPGLVSSEWMAGELKDDTTL 269

Query: 242 SAVTLQGHHLGHTQPQEISLEENSNVVSGEEHVNAKEHGCAFEADN---QGSSTLPNKAA 298
           S+  L+      + P  +S+ ++ + ++ +     K     F       Q + T+   + 
Sbjct: 270 SSAMLRNTL---SFPTGLSVAQHGDGITADT-APPKSQSSIFPEQTLPLQSAGTMVPPSV 325

Query: 299 SANDKLYQQNLKLLFQKNSSNSEEPDPQALIDDVFVNIEPRSLPASDLNKITLAPPNEES 358
               K+Y    +LL     ++         +  V         P +  N     P   ES
Sbjct: 326 DEVSKVY----RLLLNNQGTDCNSSTGYKGLSGVHT-------PYTVDNVAIHGP---ES 371

Query: 359 RMPKSMLELTSYSSDLP-PELVDI---------IPKTDLTVHGLARFLLNHYFNNVADKM 408
           RMP S +E  S  S +P P +  +         +P+  + +HGL RFLL++Y  NVAD M
Sbjct: 372 RMPASAIE--SVPSIVPDPTIFTLAEHTNSLIRLPRMGMQIHGLTRFLLSYYQQNVADLM 429

Query: 409 TVVVLEKNPWKTLYFPRXXXXXXXXXXXXQXXXXXXXXXXXXXXVSCFHLQSKYPRNYKL 468
           +VV L KNPWKT+YFPR                           VSCFHLQSK+P+N K 
Sbjct: 430 SVVALPKNPWKTIYFPRAVKALGELGALGYTSHSRNALLNALLAVSCFHLQSKFPKNSKE 489

Query: 469 QKYFLGLGIELRNQASNFLRLCLNTKSSIPEKYKDVLTAILSMNSIDVVWGTMADCQDHL 528
            KYF+ LG++ RNQAS FL  CL++ +S  E YKDVLTAILSMNSIDVVWGTM+DCQ HL
Sbjct: 490 MKYFVSLGMDFRNQASGFLNACLSS-TSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHL 548

Query: 529 ALCEDFVESRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYK 588
            +CE+F+ESRMK RP +SEK + LHRIFSFLKLIQDSTALDKV+ KEI I+    D  ++
Sbjct: 549 TICEEFIESRMKSRPLLSEKARCLHRIFSFLKLIQDSTALDKVQEKEI-IMKDAGDKEFQ 607

Query: 589 PLDTSNATTSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADXXXXXXXXXI 648
              +S    S+          G + E LN+++G++ IEF+++                 +
Sbjct: 608 KNGSSTPPLSTDSSSF----TGRYVEQLNKDNGRVCIEFIEK-----DGQYFDTRGSVPL 658

Query: 649 FTNIATESYYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTY 708
           F  I T+SY ++      +++T  + +  D LYGLPNSLILLFSDCV +VRH  Y+    
Sbjct: 659 FNTIVTKSYPHE------INETRIDTLSMDVLYGLPNSLILLFSDCVSLVRHRFYFKRHN 712

Query: 709 LPVPRKFNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYY 768
              P  F    +  E+RLL WK EW F +++S+ + FIN T E +YHHTMSFY+ L+IYY
Sbjct: 713 TAQPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKAE-FINDTVEGVYHHTMSFYYGLLIYY 771

Query: 769 FTMARSLNCQFLQNYVAKVLDHLNAMEELVDQKKVKIVPLIWQGFMAGCACTDENRQQEF 828
           FTMARSL    LQNYV KVL HL  +  +++ K VKIVPL+WQGFMAGC+CTD + Q EF
Sbjct: 772 FTMARSLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLMWQGFMAGCSCTDSSMQLEF 831

Query: 829 RRWAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDN 865
           ++W A+L   G+GSYWGARQ+MLEVWRRR  D   DN
Sbjct: 832 KKWTAQLVNFGIGSYWGARQIMLEVWRRRMTDGKCDN 868

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score =  278 bits (711), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 180/514 (35%), Positives = 260/514 (50%), Gaps = 90/514 (17%)

Query: 378 LVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVL---EKNPWKTLYFPRXXXXXXXXX 434
           LV +  ++   VH   RFLL HY   V D MT+  +    KNPW  +YFPR         
Sbjct: 238 LVSLSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELI 297

Query: 435 XXXQXXXXXXXXXXXX-XXVSCFHLQSKYPRNYKLQKYFLGLGIELRNQASNFLRLCLNT 493
                              VSCF+L+     +     ++L L +ELR +AS+FL L L  
Sbjct: 298 AFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLALEQ 357

Query: 494 KSS------------IPEKYK----DVLTAILSMNSIDVVWGTMADCQDHLALCEDFVES 537
           +              I E Y     D+L AIL+MNSID+VWGTM DC ++L +CE  + S
Sbjct: 358 EEEYEEYRDILEDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLI-S 416

Query: 538 RMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNATT 597
           + K R  +S+K K+L+ I++FLKL+Q+STA++ + ++     PS        LD  N   
Sbjct: 417 KNKKRVVVSKKIKSLYTIYAFLKLMQNSTAMETITSE-----PS--------LDFHNP-- 461

Query: 598 SSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADXXXXXXXXXIFTNIATESY 657
                  D++     RE   END K                             I T+ Y
Sbjct: 462 -------DIIPYKYLRETY-ENDIK----------------------------TIFTDHY 485

Query: 658 YNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTY--LPVPRKF 715
                       T  N +G D+L  LPNSL+LLF DCV + R+  Y+      + +P +F
Sbjct: 486 ----------GSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEF 535

Query: 716 NELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARSL 775
              +  FE +L  WKSEW+F   +S G++F++ T E +YHHTMSFY+ L +YY+   ++ 
Sbjct: 536 FMKTREFEDKLSNWKSEWDFF--DSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQ 593

Query: 776 NCQFLQNYVAKVLDHLNAMEELVD----QKKVKIVPLIWQGFMAGCACTDENRQQEFRRW 831
           + + L   V KV+ HL  +E L D    ++ +K++PLIWQGF+AGC C+D   Q EF+ W
Sbjct: 594 DYESLNVEVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTW 653

Query: 832 AAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDN 865
              ++ +G GSY GA Q+M EVWRRR  +E GD+
Sbjct: 654 FDTVSLTGAGSYRGAIQIMFEVWRRRDNNELGDD 687

 Score =  157 bits (398), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 107/154 (69%), Gaps = 2/154 (1%)

Query: 10  KKMGRA-KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGV 68
           KK  R+ KT++GCWTCR RKVKCDL  P C RC +S + CGGY IKLRWS  + FD YGV
Sbjct: 3   KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62

Query: 69  PIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKISDN 128
           P+P N   TTT     V+     RRN++ VRY+EEY YHEDMD+EL+ LH PP +KI++N
Sbjct: 63  PMPSNESITTTE-GDDVETSTNLRRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIANN 121

Query: 129 KTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAK 162
           KTWIIKKFGVF+  ++     A R K +++ V K
Sbjct: 122 KTWIIKKFGVFRAIEREAIIAAKRGKTDKRPVQK 155

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 12 MGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW 57
          M + + FTGCW CR +K KCD R P C  C K  + C  YD++L W
Sbjct: 1  MSKDRNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSW 45

>Scas_597.4
          Length = 475

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW 57
          K+ +A+TFTGCW CR +K +CD   P C  C +    C  YDI+L W
Sbjct: 14 KLNKARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMW 59

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW 57
          SS   P   GR  TFTGCW CR +K +CD   P C  C K    C  YDI+L W
Sbjct: 15 SSSKVPPTKGR--TFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW 65

>Kwal_14.1631
          Length = 443

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW 57
          +A++FTGCW CR +K +CD   P C  C K    C  YDI+L W
Sbjct: 8  KARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVW 50

>Kwal_23.2905
          Length = 881

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (58%)

Query: 12 MGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          MG +++   C  CR RKVKCD + P C RC  +N PC   D
Sbjct: 40 MGISRSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSID 80

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          +S +     +G +K+ T C  CR +K+KCD   P C+RC K  +PC   D
Sbjct: 16 LSKRGDSPNIGISKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLD 65

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 6  KNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW 57
          + G +K  R + FTGCW CR +K +CD   P C  C K    C  YD++L W
Sbjct: 10 RAGARK-PRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVW 59

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 7/56 (12%)

Query: 19 TGCWTCRGRKVKCDLRHPHCQRCEKSNLPC-------GGYDIKLRWSKPMQFDPYG 67
          +GC+TCR +++KCD +HP C RC+++ L C       G    K+R +     DPY 
Sbjct: 41 SGCFTCRLKRMKCDEQHPICGRCKRNLLTCIWPKEGNGKLTKKMRQAMKDNVDPYA 96

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 15  AKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
           +++ TGCW CR RK KC    PHC  C + NL C  YDI
Sbjct: 535 SRSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC-FYDI 572

>Scas_521.2
          Length = 890

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 52/127 (40%), Gaps = 8/127 (6%)

Query: 2   GISSKNGP---KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWS 58
           G S KNG         +K+ + C  CR +K+KCD + P C RC    +PC   D      
Sbjct: 19  GNSLKNGSPSSSTFNTSKSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQD 78

Query: 59  KPMQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLH 118
            P  +  Y   +     A    L    ++P   R N+     D+   Y E++ D   +L 
Sbjct: 79  VPRSYVFY---LEDRLRAMMQRLKDLGEDPIQVRGNVPATSEDDP--YEEELRDRDGILQ 133

Query: 119 TPPIEKI 125
              IEK+
Sbjct: 134 QYLIEKV 140

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 12 MGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          +G +++   C  CR +KVKCD + P C +C  +N PC   D
Sbjct: 34 LGISRSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 15  AKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
           A++ TGCW CR RK KC    P CQ C + +L C  YDI
Sbjct: 713 ARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC-FYDI 750

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 10  KKMGRA-KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
           KK G   ++ TGCW CR RK KC    P C  C + NL C  YDI
Sbjct: 668 KKAGAGTRSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC-VYDI 711

>Kwal_55.20674
          Length = 252

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 11 KMGRAKT---FTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          KMG+ ++   FT C +CR RK KC    P CQRC + ++PC
Sbjct: 9  KMGKDRSGAMFT-CKSCRQRKRKCSREKPQCQRCARLSIPC 48

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 16  KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           ++ TGCW CR RK KC    PHC  CE+  L C
Sbjct: 766 RSRTGCWICRLRKKKCTEERPHCFNCERLKLDC 798

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 9  PKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGY 51
          PKK  R K    C  CR RK+KCD + P C  C + NLP   Y
Sbjct: 27 PKK--RFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 3   ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSK 59
           +SS +   K  R +    C  CR RKVKCD   PHCQ+C K+ +    + ++  W++
Sbjct: 46  MSSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAE 102

>Scas_721.94
          Length = 869

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +S+ +  K+    K+  GC  C+ R+VKCD   P C+RC   N+PC
Sbjct: 37 VSATSTGKRKFHNKSKQGCTHCKRRRVKCDELKPACRRCLNWNVPC 82

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +S  +  K+    K+ TGC  C+ R+VKCD   P C++C   NL C
Sbjct: 30 VSKTSTGKRKFHKKSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPM 61
          G S+K   +++ R +T   C  C   K KCD + P C RC K +LPC  +  +    + +
Sbjct: 7  GKSAKEIKEQIVRKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYFTEEHVLERCL 66

Query: 62 QFDP-YGVPIPQNSPATTTNLSGSVDE 87
          Q        I Q +PA+ ++ + ++ E
Sbjct: 67 QRQSNLRSVIHQKAPASRSSTNETISE 93

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 10  KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           K+    ++ TGCW CR RK KC    P C  C++ NL C
Sbjct: 519 KRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>KLLA0A10329g 903873..905792 some similarities with
           ca|CA6113|IPF100.3 Candida albicans zinc finger protein,
           3-prime end (by homology), hypothetical start
          Length = 639

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 14/123 (11%)

Query: 15  AKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW----------SKPMQFD 64
           A+++ GC  C+  K KCD   PHC  C+K    C  Y   L+W          SK M+F+
Sbjct: 11  ARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKWGGRPFKDNRVSKKMKFE 69

Query: 65  -PYGVP--IPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPP 121
             Y V      +  A T   +  V + +        V  +EE V  + + + +  L  PP
Sbjct: 70  HTYVVEGICAVDLNAATGKQATKVKKNKKMITKKTVVVKEEEPVQEKQLQELVQELEKPP 129

Query: 122 IEK 124
           + +
Sbjct: 130 LSE 132

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          SK  P  +   K    C  CR +KVKCD  +P C+ C ++N+PC   D
Sbjct: 9  SKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVD 56

>Kwal_26.6732
          Length = 676

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query: 9  PKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          PKK    ++ TGC TCR R+ KCD R P C  CE + L C
Sbjct: 4  PKK----RSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>Scas_573.4
          Length = 1478

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSK 59
          K  R +    C  CR RKVKCD   PHCQ+C K+ +    + ++  W++
Sbjct: 33 KRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWAE 81

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 8  GPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSK 59
           PKK  R +    C  CR RKVKCD   PHC +C K+ +    + ++  W++
Sbjct: 11 APKK-KRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWAQ 61

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNL 46
          +SS     K  R +    C  CR RKVKCD   PHC +C K+ +
Sbjct: 1  MSSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGV 44

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 16 KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K+  GC  C+ R+VKCD   PHC  C+K +L C
Sbjct: 52 KSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>Scas_674.12*
          Length = 909

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K   +A+    C  CR +KVKCD   P C RC K+N  C
Sbjct: 4  KNYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>Scas_659.10
          Length = 757

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 29/72 (40%), Gaps = 11/72 (15%)

Query: 1  MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
          MG SS        R K    C  CRGRK+KCD   P C +C     P   Y         
Sbjct: 1  MGSSSTQNIGFKRRRKPIKSCAFCRGRKLKCDKNKPICNQCLMRKHPTCIYT-------- 52

Query: 61 MQFDPYGVPIPQ 72
             + + +PIPQ
Sbjct: 53 ---ETFNIPIPQ 61

>Scas_596.4
          Length = 701

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 10  KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           KK  R+++  GCW CR RK KC    P C  C++ NL C
Sbjct: 559 KKARRSRS--GCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLP 47
          R K    C  CR RK+KCD + P C  C   NLP
Sbjct: 12 RRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNLP 45

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
          C  CR  K KCD   P C RC K+N+ C  YDI+
Sbjct: 32 CQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIE 64

>Scas_679.26
          Length = 775

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +S  +  K+    K+  GC  C+ R+VKCD   P CQ+C   NL C
Sbjct: 40 VSKTSTGKRKFHNKSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
          K   R K    C  CR  K KCD + P C RC++ N PC  YD++
Sbjct: 10 KAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC-IYDLE 53

>Kwal_23.3178
          Length = 611

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 3   ISSKNGPKKMGRA--KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
            S K+ P++   +  ++ TGCW CR RK KC    P C  C + NL C
Sbjct: 525 TSPKDKPRRKNNSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes singleton, start by
           similarity
          Length = 673

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 9/103 (8%)

Query: 2   GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPM 61
            +S+   P K  R  +  GC  C+ +KVKCD   P C +C   +L C      +  +K  
Sbjct: 9   AVSNVTEPAKKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLEC------VYKTKEF 62

Query: 62  QFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEY 104
           QF   G P   N     + ++   D+ +  + + D  R + E+
Sbjct: 63  QFVVSGGP---NKSRVNSKVTSVSDKKRKNKEDGDLHRKNMEH 102

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%)

Query: 16 KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPY 66
          ++   C  CR RK+KCD + P C +C ++  PC   D   R   P  +  Y
Sbjct: 15 RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSYVVY 65

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 13/65 (20%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC------- 48
          G  S+  PKK    + +  C  C+ RKVKCDL        P C RC++ +  C       
Sbjct: 5  GNESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKR 64

Query: 49 GGYDI 53
          GG+ +
Sbjct: 65 GGFRV 69

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 16  KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           K+  GC  C+ R+VKCD   P CQ+C K  L C
Sbjct: 84  KSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
          +S+ +  K+    K+  GC  C+ R+VKCD   P C++C    L C    I LR
Sbjct: 33 VSTTSTGKRKFHNKSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLR 86

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +S  +  K+    K+ TGC  C+ R+VKCD   P C++C    L C
Sbjct: 26 VSKTSTGKRKFHNKSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDC 71

>Scas_556.6
          Length = 1022

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
          C  CR  K KCD   P C RC K NL C  YD+
Sbjct: 46 CQECRKAKTKCDKEKPACTRCVKQNLAC-VYDV 77

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
          C  CR  K KCD   P C RC K NL C  YD+  R + P
Sbjct: 25 CQACRKAKTKCDQEKPRCGRCTKQNLFC-IYDVA-RQAAP 62

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 14 RAKTFT--GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          R  T++  GC  C+    KCD R P C RCEK ++ C
Sbjct: 62 RKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDC 98

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNL 46
          S++ PKK  R +T   C  C+ RK+KCD + P C  C  +N+
Sbjct: 13 SEHFPKK-KRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANV 53

>Scas_717.33
          Length = 904

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCD---LRHPH---CQRCEKSNLPC 48
          +SK   + +   ++F  C +CR RKVKCD   L +PH   C RC +    C
Sbjct: 17 ASKRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          G SS N        K    C  CR +K+KCD   P+C  C K + PC   D
Sbjct: 28 GQSSSNAITDFSVRKA-HACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSD 77

>Scas_663.12
          Length = 944

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
          C  CR  KVKCD   P C RC K +L C  YD+
Sbjct: 40 CQGCRRSKVKCDQEKPVCSRCSKHDLEC-VYDV 71

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +S+ +  K+    K+  GC  C+ R+VKCD   P C +C K  L C
Sbjct: 36 VSTTSTGKRKFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGY 51
          KK  R K    C  CR RK+KC    P CQ+C    LP   Y
Sbjct: 20 KKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCVY 61

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 14 RAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48
          R +T+  C +CR RKVKCDL        P C RC++    C
Sbjct: 18 RRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>Kwal_26.7095
          Length = 838

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 2  GISSKNGPK-KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          G +S   P+ K  R +    C  C+ RK+KCD   P C RC K  L C
Sbjct: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57

>Kwal_56.24566
          Length = 755

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          R ++  GC+TCR R+ KCD   P C  C K  L C
Sbjct: 25 RNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKC 59

>Kwal_23.3122
          Length = 788

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +S  +  K+    K+  GC  C+ R+VKCD   P CQ+C    L C
Sbjct: 32 VSKTSTGKRKFHKKSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 4   SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           S+   PK+  R  +  GC  C+ R++KCD   P C +C + N  C
Sbjct: 180 SAVGDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNREC 224

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNL 46
          +K  R +    C  CR RKVKCD   P CQ+C K+ +
Sbjct: 14 QKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGV 50

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
          G+S K    K  R K    C +CR  K KCD   P C RC K+   C  YD++ + +KP
Sbjct: 20 GVSGKVTKTKGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVC-VYDVETQ-TKP 76

>Scas_711.31
          Length = 932

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR +K+KCD R P C  C K+ +PC
Sbjct: 44 ACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>Kwal_55.20722
          Length = 827

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPC---------GGYDIKLRWSKPMQFDPYGVPIP 71
          C  CR RK+KCD   P C RC+++ L C         GG  + +  + P   +  G    
Sbjct: 15 CLECRNRKLKCDKARPKCTRCKQNLLTCSYANDGNSPGGSKLYVDKAFPHSSEFLGT--- 71

Query: 72 QNSPATTTN 80
          Q+S +++TN
Sbjct: 72 QHSESSSTN 80

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
          C  CR RK+KCD + P C +C +  L C  YDI+
Sbjct: 25 CLECRRRKIKCDKQRPCCIQCAEQGLTC-VYDIE 57

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%)

Query: 13 GRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          G +++   C  CR +K KCD   P C RC     PC   D
Sbjct: 32 GISRSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVD 71

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 6/57 (10%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC------GGYD 52
          G++  +   K    ++  GC TCR R+ KCD   P C  C+++ L C      G YD
Sbjct: 31 GVNDDSRVLKKTEKRSRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNYD 87

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
          + NG  K  R +    C  CR  K KCD   P C RC K +L C  YD++
Sbjct: 21 TSNGACK--RQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKC-VYDVE 67

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 7  NGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
          N  +   R +    C  CR  K +CD   P C RC+K  L C  YD+
Sbjct: 13 NAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYDM 58

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
           C  CR R+ KCDL +P C RC++  L C    + LR
Sbjct: 40 ACANCRRRRKKCDLEYP-CGRCQELGLGCNINKVDLR 75

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
           transcription factor, in conjunction with Pdr1p
           regulates the expression of a network of genes involved
           in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 17/114 (14%)

Query: 10  KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVP 69
           KK  R+K  T C  CR RK+KC  ++P C  C   +  C    + L+   P + D     
Sbjct: 4   KKSTRSKVSTACVNCRKRKIKCTGKYP-CTNCISYDCTC----VFLKKHLPQKEDS-SQS 57

Query: 70  IPQNS---PATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTP 120
           +P  +   P++  N+  S D           ++ D +Y Y + M+D   ++ TP
Sbjct: 58  LPTTAVAPPSSHANVEASADVQHLDTA----IKLDNQY-YFKLMND---LIQTP 103

>Kwal_23.6529
          Length = 598

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRW 57
          GC  C+  K+KCD + P C +C K       Y + L+W
Sbjct: 13 GCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQW 50

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 32/80 (40%), Gaps = 5/80 (6%)

Query: 9   PKKMGRAKTFT-GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYG 67
           P    + K F+  C  CR +K+KCD   P C  C+K    C   D   R   P  +    
Sbjct: 50  PTASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY---- 105

Query: 68  VPIPQNSPATTTNLSGSVDE 87
             + +N       L G VDE
Sbjct: 106 TEMLENEVIKLQRLCGMVDE 125

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
            C  CR +K +CD + P C +C      C   D  LR + P
Sbjct: 69  ACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYP 109

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          + ++ TGC  CR RK KCD   P C  C+++ L C
Sbjct: 4  KKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>Scas_590.2
          Length = 1172

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K GR+   T C  CR RK KCD + P C  C K+ + C
Sbjct: 34 KKGRS---TACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 6  KNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQF 63
          K+    +   ++  GC TCR R  KCD + P C  C+++ L C   D +    +P  F
Sbjct: 17 KSSATTLVEKRSSRGCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRDNEEAQEEPHMF 74

>Kwal_26.6805
          Length = 944

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 31/78 (39%), Gaps = 11/78 (14%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPIPQNSPATTTN 80
          C +CR  K KCD   P C RC K  + C  YD+          D    P   N  AT   
Sbjct: 29 CQSCRKGKTKCDRAKPSCSRCLKHGIRC-VYDV----------DRQTPPKTPNKDATIAR 77

Query: 81 LSGSVDEPQYQRRNIDFV 98
          L   V+  Q +   ID V
Sbjct: 78 LKREVEYWQARALAIDTV 95

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
          C  CR  K KCD   P C RC K+ + C  YDI+
Sbjct: 28 CKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIE 60

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 4   SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNL 46
           S+ NG K   R K    C  CR RK+KCD + P C  C+   L
Sbjct: 74  STSNG-KVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGL 115

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 39/93 (41%), Gaps = 4/93 (4%)

Query: 8  GPKKMGRAKTFT--GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGY--DIKLRWSKPMQF 63
          G K + R   ++  GC  C+ RKVKCD   P C +C      C     + K+R+ +    
Sbjct: 7  GRKGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRCVYMVNNSKIRFKEINVL 66

Query: 64 DPYGVPIPQNSPATTTNLSGSVDEPQYQRRNID 96
             G     +  A   N +GS D  +   R +D
Sbjct: 67 SLRGRERVTDKKACARNGTGSSDPARVTMREVD 99

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K GR+++   C  CR RK +CD + P C  C K+ + C
Sbjct: 34 KKGRSRS---CLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSK 59
           R +    C  CR RKVKCD   P+C +C K+ +    + ++  W++
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQAWAE 109

>Kwal_56.23058
          Length = 775

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 4   SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           SS    K + R  +  GC  C+ R++KCD   P C +C + N  C
Sbjct: 132 SSGADGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNREC 176

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
           C TCR R+ KCDL+ P C  C+K  + C   D  LR
Sbjct: 13 ACQTCRKRRRKCDLQVP-CVNCQKFGVECLPVDQDLR 48

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
          C  CR  K KCD   P C RC +  L C GYDI+
Sbjct: 24 CIPCRKCKTKCDKLKPTCSRCAELGLYC-GYDIE 56

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 8  GPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          G +K+    +  GC TC+ RK +C    P C+ C + + PC
Sbjct: 4  GVEKLKLKYSKHGCITCKIRKKRCSEDKPVCRDCRRLSFPC 44

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFD 64
          S +G K+  R     GC  C+   +KCD   P C +C K N+ C  Y + L +    Q  
Sbjct: 9  SNSGKKRKTRYSR-KGCLQCKRSHLKCDEGQPKCGKCVKRNISC-TYQLSLVFQDVSQSK 66

Query: 65 PYGVPI 70
             +P+
Sbjct: 67 LKSMPV 72

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGY 51
          R +    C  C  RKVKC+   P C  CEK+   C  +
Sbjct: 31 RQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAYF 68

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48
          SS  G  +  R + +  C  CR RKV+CDL      R P C RC +    C
Sbjct: 16 SSNAGSGRKWR-RIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 16 KTFTGCWTCRGRKVKCDLRH--PH-CQRCEKSNLPC 48
          +  T C  CR  K+KCD     PH C RCEK  L C
Sbjct: 52 RPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGLHC 87

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 8/52 (15%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEK--SNLPCGGYDIKLRWSK 59
          KK G++     C  CR RKV+CD   P C  C K  SN+ C  Y+++ R  K
Sbjct: 3  KKNGKS-----CLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKREVK 48

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 8/50 (16%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHP---HCQRCEKSNLPC 48
          G+++K   K++ +A     C  CR RK+KCD   P    C  C K  +PC
Sbjct: 20 GVTTKPAKKRVSKA-----CDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Kwal_14.2619
          Length = 1167

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 15/25 (60%)

Query: 19 TGCWTCRGRKVKCDLRHPHCQRCEK 43
          T C TCR RKVKCD   P C  C K
Sbjct: 10 TSCLTCRRRKVKCDRSKPVCLACIK 34

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGY 51
          +S +G K   R K    C  CR RK++CD + P C  C   NL    Y
Sbjct: 40 TSTSGKK---RNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQY 84

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          R +    C  C  RK+KCD   P C+ C K+   C
Sbjct: 39 RQRQILSCVACHKRKIKCDRAKPVCESCGKNGWEC 73

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 10  KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           K + R  +  GC  C+ R++KCD   P C +C + N  C
Sbjct: 144 KIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>Kwal_26.8109
          Length = 970

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 14 RAKTFTGCWTCRGRKVKCDL--RHPHCQRCEKSNLPC 48
          R+KT   C  CRG+K +CD    +P C  C++ +  C
Sbjct: 32 RSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTC 68

>Scas_526.3
          Length = 1109

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 12/107 (11%)

Query: 11  KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPI 70
           K GR+++   C  CR RK +CD + P C  C K+ + C       R+S P       +  
Sbjct: 34  KKGRSRS---CLLCRRRKQRCDHKMPSCTACLKAAVKCVQ---PARYSSPASISITNLDS 87

Query: 71  PQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTML 117
             NS    TN+ G+  +   QR  +  ++ +  Y+ H  +D  +T +
Sbjct: 88  MTNS--INTNM-GTSSQAVAQR--LPTIKMESNYMQHR-VDSPMTTI 128

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K GR+++   C  CR RK +CD + P C  C K+ + C
Sbjct: 34 KKGRSRS---CLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>Kwal_34.15751
          Length = 628

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          C  CR RK+KC+ + P C RC K +L C
Sbjct: 15 CDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           R  +  GC  C+ R++KCD   P C +C + N  C
Sbjct: 197 RKYSRNGCAECKRRRMKCDESKPKCWQCTRLNRDC 231

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 20/44 (45%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQF 63
            C  CR +K++CD + P C +C      C   D   R + P  +
Sbjct: 182 ACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGY 225

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
          C  CR  K KCD   P C RC K  + C  YD+
Sbjct: 23 CQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDL 54

>Scas_688.17
          Length = 769

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 13/24 (54%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEK 43
           C  CR RK+ CD  HP C  C K
Sbjct: 16 ACIQCRKRKIGCDRGHPKCGNCIK 39

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           R  +  GC  C+ R++KCD   P C +C + N  C
Sbjct: 157 RKYSRNGCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activator
           of the Gal4p-type family of DNA-binding proteins [2280
           bp, 759 aa]
          Length = 759

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 13  GRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
           G  +    C  CR R+ KCDL  P C  C +  L C   D  LR
Sbjct: 62  GSTRKRLACTNCRNRRKKCDLGFP-CGNCSRLELVCNVNDEDLR 104

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 13 GRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
          G +K    C  CR R+ KCDL +P C  C +  L C   D  LR
Sbjct: 39 GVSKKRLACTNCRRRRKKCDLNYP-CSSCLRLKLECNVNDEDLR 81

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDI 53
          R +    C  C   K KCD   P C RC K  L C  YD+
Sbjct: 59 RNRILFVCQACWKSKTKCDREKPECGRCVKHGLKC-VYDV 97

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
            C  CR R+ KCDL++P C  C+K  L C   +  LR
Sbjct: 75  ACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLR 110

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           R  +  GC  C+ R++KCD   P C +C + N  C
Sbjct: 152 RKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC 186

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 8/47 (17%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC-----GGYD 52
          K GR++    C  C+ RK KCD + P C  C K+ + C      GYD
Sbjct: 34 KKGRSR---ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYD 77

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 2   GISSKNGPKKMGRAKTFT------GCWTCRGRKVKCDLRHPHCQRCEKSNLPCG-GYDIK 54
            ++ +  P+ M   KT         C  CR +K++C+   P C  CEK NL C   + IK
Sbjct: 56  ALTHRFAPEAMTETKTVMRKRVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIK 114

Query: 55  LRWSKP 60
            R + P
Sbjct: 115 RRQAAP 120

>Scas_696.44
          Length = 1164

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 18/41 (43%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
            C  CR +K +CD + P C +C      C   D   R S P
Sbjct: 80  ACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFP 120

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPCG 49
          C  C+ RK+KCD   P C +C+ S+  C 
Sbjct: 15 CLRCKQRKIKCDKLWPTCSKCKASSSICS 43

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 19/43 (44%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSN 45
          +S K    +  R K    C  CR RK+KCD   P C  C   N
Sbjct: 6  LSQKKKLDRQSRRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRN 48

>YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription
          factor regulating genes of branched chain amino acid
          biosynthesis pathways, acts as both a repressor and an
          inducer [2661 bp, 886 aa]
          Length = 886

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDL--RHPH-CQRCEKSNLPC 48
          ++N      R + F  C  CR +K KCD   R P  C +C K N+PC
Sbjct: 22 TRNRTGMNARKRKF-ACVECRQQKSKCDAHERAPEPCTKCAKKNVPC 67

>Kwal_47.17233
          Length = 948

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 17/38 (44%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGY 51
          R +    C  C  RK+KC    P C +C K N  C  +
Sbjct: 28 RQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSYF 65

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 20/45 (44%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLP 47
          ++  +G     R K    C  CR R+VKC+   P C  C    LP
Sbjct: 1  MAESDGKIVKTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLP 45

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDL--RHPH-CQRCEKSNLPC 48
          KKM + K    C  CR +K KCD   R P  C RC K  +PC
Sbjct: 39 KKMPQKKKL-ACVECRQQKSKCDAHERAPEPCSRCLKKGVPC 79

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 14/28 (50%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLP 47
           C  CR RK+ CD   P C  C K N P
Sbjct: 14 ACTQCRKRKIGCDRAKPICGNCVKYNKP 41

>Kwal_47.18089
          Length = 745

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLP 47
           C  CR RK+KCD + P C  C    LP
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKLP 55

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 9/53 (16%)

Query: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLR------HPHCQRCEKSNLPC 48
          G SS  G K      TF  C  C+ +K+KCDL        P C  C +S   C
Sbjct: 22 GSSSSQGQK---HKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 2   GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIK 54
             S +NG    GR +    C  C+ RKVKCD  +P C  C K    C  YD K
Sbjct: 71  AASKENGK---GRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC-RYDFK 118

>Kwal_14.819
          Length = 568

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 17 TFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +   C  CR RKV+C  + P C+ C K N  C
Sbjct: 12 SIISCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR R+VKCD   P C RC + NL C
Sbjct: 7  SCDCCRVRRVKCDRNRP-CDRCRQRNLRC 34

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 1   MGISSKNGPKKMGRAKTFTGCWTCRGRKVKC---DLRHPHCQRCEKSNLPC 48
           M  S KN  K++ +A     C  CR RK++C   D +   C  C K  LPC
Sbjct: 121 MSGSGKNLKKRVSKA-----CDHCRKRKIRCDEVDQQTKKCSNCIKFQLPC 166

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          S+  PK+   +K   GC TC+ RK +C    P C+ C + +L C
Sbjct: 6  SEGEPKRRRHSKK--GCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>Scas_630.14
          Length = 701

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          SK+G +K  R      C  CR RK KCD   P+C  C    +    YD
Sbjct: 12 SKDGIRKRNRVPK--SCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYD 57

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 7  NGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC------GGYDIK 54
          +G  +  R+K    C  CR RK+KC+ + P C  CE  +  C      GG  IK
Sbjct: 32 SGKIRKPRSKVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTRQGGARIK 84

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          C  C+  K KCD   P C RC++++L C
Sbjct: 15 CLQCKKIKRKCDKLRPACSRCQQNSLQC 42

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD-IKLRWSKPM 61
           C  CR R+VKCD + P C RC + N  C     +K R SKP+
Sbjct: 7  ACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRGSKPI 48

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVPIPQNSPATTT 79
           C  C+ RK KCD + P C+RC K N+ C  Y    R  K    D   + I +N      
Sbjct: 2  ACLECKKRKQKCDGQKP-CRRCTKLNVKC-IYGTDRRKDKRKIKDGSNMFIFKNQTLCND 59

Query: 80 NLSGSVDEP 88
           ++G V  P
Sbjct: 60 KINGIVPHP 68

>Scas_588.11
          Length = 835

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSN 45
           C  CR RK+ CD   P C  C K+N
Sbjct: 13 ACVQCRKRKIGCDRVKPICGNCRKTN 38

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 4  SSKNGPKKMGRA-KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQ 62
          S K  P  + R  ++   C  CR +K+KCD   P+C  C+K    C   D   R   P  
Sbjct: 11 SPKGHPLLLSRQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRG 70

Query: 63 F 63
          +
Sbjct: 71 Y 71

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          GC  C+   +KCD   P C  C K N+ C
Sbjct: 60 GCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 4  SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCE 42
          S +   K   R K    C  CR RK++CD + P C  C+
Sbjct: 14 SEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCK 52

>Kwal_23.6425
          Length = 735

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNL 46
          + ++ G +K  R K+   C  CR RK+KCD   P C  C    L
Sbjct: 20 VEAELGSRK--RRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGL 61

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%)

Query: 13 GRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
           R K    C  C+ RK KCD + P C  C K    C  Y++ L+
Sbjct: 4  SRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC-IYNVNLQ 46

>Scas_657.3
          Length = 856

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 14/23 (60%)

Query: 19 TGCWTCRGRKVKCDLRHPHCQRC 41
          T C  CR RK+KCD + P C  C
Sbjct: 43 TSCAFCRQRKLKCDQKRPICSTC 65

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 5  SKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          S++    + R +    C  CR +KVKCD RHP C  C   +  C
Sbjct: 2  SESAGLGLKRRRVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>Kwal_27.10232
          Length = 1209

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 19/44 (43%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQF 63
            C  CR +K +CD + P C +C      C   D   R + P  +
Sbjct: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 7  NGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          NG K+  R +    C  C+ RK+KCD   P C  C K+++ C
Sbjct: 16 NGSKQRLRVRK--ACEICKKRKIKCDGHQP-CTSCTKNSVQC 54

>Scas_605.11
          Length = 618

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 68  VPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYV--YHEDMDDELTMLHTPPIEKI 125
           +P P+N P     L G+ ++PQ+Q   I+F  YD+  V    +++ + +T   +PP++++
Sbjct: 97  IPGPRN-PKVELELYGAAEDPQFQSSGINFDNYDDIPVEASGDNVPEAITAFTSPPLDEL 155

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWS 58
          R      C +CR RK+KC    P C +C + N  C  Y  K+R S
Sbjct: 2  RPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIRRS 45

>Scas_702.7
          Length = 1113

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60
          K  R K    C  CR RK+KC   +P C  C      C   D+K   S P
Sbjct: 27 KRPRKKVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDDLKEDSSNP 75

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 14/29 (48%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
            C  CR +K +CD + P C +C      C
Sbjct: 77  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

>Scas_699.7
          Length = 935

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWS 58
           C  CR +K+KC    P C +C K+N  C  Y  K R S
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTRRS 49

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          GC  C+    KCD   P C +C K N+ C
Sbjct: 20 GCLQCKKSHTKCDETKPACLKCVKRNVEC 48

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%)

Query: 9  PKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           K  G+ +    C  CR RKVKCD   P C  C  ++  C
Sbjct: 9  AKLAGKDRVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNL-PCGGYDIKLRWSKPMQF--DPYGVPIPQNSPA 76
           C  CR RKV CD   P C  C ++    C   D+      P Q+  +  G P+PQN   
Sbjct: 13 ACAQCRRRKVGCDRVRPVCGNCARAGKGDCFYPDV------PGQYIQNNGGSPLPQNGSG 66

Query: 77 TTTNLSGSVDE 87
              +S +VD+
Sbjct: 67 RPEEIS-TVDQ 76

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 20 GCWTCRGRKVKCDL--RHPH-CQRCEKSNLPC 48
           C  CR +K KCD   + P  C RC+K  +PC
Sbjct: 57 ACVECRQQKSKCDAHDKAPEPCTRCQKKGVPC 88

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 1   MGISSKNGPKK--MGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           +G++  N   K  M R +    C+ CR RK +CD  +P C +C   +  C
Sbjct: 53  VGVNKNNAGNKRVMKRNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTEC 101

>Scas_550.5*
          Length = 832

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 16/28 (57%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          C  CR +K++C+   P C RC++    C
Sbjct: 15 CAACRTQKLRCNRERPSCSRCQRIGRTC 42

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          + ++   C +CR R +KC   +P CQ+C  SN  C
Sbjct: 27 QQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAIC 60

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNL 46
          C  C+ RKVKCD   P CQ C + N+
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERNV 40

>ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH]
          complement(728569..731163) [2595 bp, 864 aa]
          Length = 864

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 20 GCWTCRGRKVKCDL--RHPH-CQRCEKSNLPC 48
           C  CR +K KC+   R P  C RC K+N+PC
Sbjct: 43 ACVECRQQKSKCNAHDRAPEPCSRCAKNNVPC 74

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%)

Query: 2   GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRH---PHCQRCEKSNLPC 48
           G  S NG       +  T C  CR  K+KCD        C RC K+   C
Sbjct: 68  GSMSSNGANLGTTHRPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGFHC 117

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 19/44 (43%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQF 63
           C  CR +K+KCD   P C  C+K    C   D   R   P  +
Sbjct: 28 ACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>Scas_638.14
          Length = 1043

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 16 KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K    C  CR RK+KC  + P C  CE    PC
Sbjct: 43 KVSKACDNCRKRKIKCTGKQP-CATCEAYQCPC 74

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
          Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
          protein, hypothetical start
          Length = 1005

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 5  SKNGPKKM----GRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          + N PK+     G+ +T++ C  CR  K KC  + P C  C K+  PC
Sbjct: 13 TANDPKQKKARNGQMETYS-CARCRKLKKKCPRQLPECSNCLKAREPC 59

>Scas_661.23
          Length = 741

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 15/66 (22%)

Query: 14  RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC---------------GGYDIKLRWS 58
           R  +  GC  C+ R++KCD   P C +C + +  C                G   + R  
Sbjct: 125 RKYSRNGCAECKRRRMKCDETKPICWQCARLSRECVYIVKSGNKKRKSKSAGESAEKRCK 184

Query: 59  KPMQFD 64
           KPM+ D
Sbjct: 185 KPMKED 190

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 1  MGISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          M   ++ G + + R +    C  CR +KVKCD + P C  C   +  C
Sbjct: 1  MPEQAQQGEQSVKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR +K+KC    P C +C K+N  C
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC 38

>Scas_518.5
          Length = 919

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 2   GISSKNGPKKMGRAKTFTGCWTCRGRKVKCD---LRHPHCQRCEKSNLPCG-GYDIKLRW 57
            ++ + G  K  + +    C  CR RKVKC     +   C  C K+++ C   + ++L  
Sbjct: 100 NVTDQYGEGKESKKRVLKACDYCRKRKVKCGDIIAQTGKCANCTKNDVECTFKFHLQLER 159

Query: 58  SKPMQ 62
            K +Q
Sbjct: 160 KKRLQ 164

>Scas_637.7
          Length = 998

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 3/39 (7%)

Query: 13  GRAKTFTGCWTCRGRKVKCDLRHPH---CQRCEKSNLPC 48
           G+ +    C  CR RK+KCD   P    C  C K N  C
Sbjct: 98  GKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANC 136

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  C+ RK KC   +P CQ C K+N+ C
Sbjct: 35 ACDLCKKRKTKCQGGNP-CQSCRKANIQC 62

>Kwal_56.24670
          Length = 643

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 19 TGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          TGC  C+ RK +C    P C  CE+    C
Sbjct: 25 TGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 3/50 (6%)

Query: 2   GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPH---CQRCEKSNLPC 48
            IS   G     + +    C  CR RK KCD   P+   C  C K+ + C
Sbjct: 159 NISQMPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>Scas_720.58
          Length = 890

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR +K+KC    P C +C K+ + C
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKC 47

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLP 47
           C  CR RK+KCD   P C RC + N P
Sbjct: 15 ACTVCRKRKLKCDGNKP-CGRCIRLNTP 41

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          K GR+++   C  C+ RK +CD + P C  C K+ + C
Sbjct: 34 KKGRSRS---CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>Scas_715.3
          Length = 1115

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 16  KTFTGCWTCRGRKVKCDLRH---PHCQRCEKSNLPC 48
           +  T C  CR +K+KCD        C RC+K  L C
Sbjct: 101 RPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC 136

>Kwal_55.21884
          Length = 882

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 4/41 (9%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDL--RHPH-CQRCEKSNLPC 48
          + GR K    C  CR +K KCD   + P  C RC K N+ C
Sbjct: 22 RRGRRKKL-ACVECRQQKSKCDAHEKAPEPCTRCAKKNVAC 61

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR  + KCD   P C RC K  + C
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 13/28 (46%)

Query: 21 CWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          C  CR RK KCD   P C  C K    C
Sbjct: 21 CLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>Kwal_47.16939
          Length = 669

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 13 GRAKTFTGCWTCRGRKVKCD-LRHPHCQRCEKSNLPCGGYD 52
          G  K    C  C+  KVKC+ L    CQRC + +L C   D
Sbjct: 5  GNRKRTKPCSNCKKNKVKCEYLSSLPCQRCARHSLKCYYLD 45

>Kwal_47.17681
          Length = 854

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCD--LRHPHCQRCEKSNLPCGGYDIK 54
          ++ + +T   C  C  RKV+CD  +R P C  C+   L C   D+K
Sbjct: 9  RVRKPRTNRACEVCHDRKVRCDANIRVP-CTSCQTFGLVCRLRDVK 53

>Scas_625.5
          Length = 1141

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 2/47 (4%)

Query: 4   SSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPH--CQRCEKSNLPC 48
           ++ N   +  R K    C  CR +K+KCD       C  C+++   C
Sbjct: 58  AASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKC 104

>Kwal_26.6664
          Length = 579

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLR 56
          K++ R +    C  C   K KC+   P C RC + +L C  Y  +LR
Sbjct: 4  KQITRNRPVKACIKCYNGKRKCNKAKPVCGRCARLHLQC-LYSAELR 49

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR  K KCD   P C RC K N  C
Sbjct: 21 ACDACRKSKTKCDGERP-CSRCLKENKLC 48

>Scas_709.51
          Length = 759

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          +K  R +    C  C+ RKVKCD   P C  C K  + C
Sbjct: 23 RKKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC 60

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 3/36 (8%)

Query: 16  KTFTGCWTCRGRKVKCDLRH---PHCQRCEKSNLPC 48
           +  T C  CR  K+KC+        C RCE+  L C
Sbjct: 87  RPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC 122

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 14/29 (48%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
            C  CR +K KC    P C  C K NL C
Sbjct: 94  ACDACRKKKWKCSKTVPTCTNCLKYNLDC 122

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 14 RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          + K    C  CR ++ KCD+  P C  C K  + C
Sbjct: 10 KRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>KLLA0F13904g complement(1287758..1289497) some similarities with
          sp|P42950 Saccharomyces cerevisiae YJL103c,
          hypothetical start
          Length = 579

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 10 KKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGVP 69
          +K+ R    T C  C  + ++CDL  P CQ C K  +   G   + +  KP +  P  V 
Sbjct: 9  EKLNRKPIPTACVFCHEKHLQCDLGRP-CQNCSKRGI---GDTCRDKERKPRKRGPRKVK 64

Query: 70 IPQN-SPATTTNLSGSVDE 87
            +  S +T + +S ++++
Sbjct: 65 KEREVSASTKSEISNTINQ 83

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%)

Query: 21 CWTCRGRKVKCDLRHPHCQRC 41
          C  CR RK+KCD   P C  C
Sbjct: 40 CAFCRRRKLKCDNARPMCSTC 60

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 16  KTFTGCWTCRGRKVKCDL--RHPH-CQRCEKSNLPC 48
           +  T C  CR  K+KC+   + P  C RCE+  L C
Sbjct: 132 RPVTSCTHCRQHKIKCNASEKFPAPCSRCERMGLHC 167

>Scas_680.25
          Length = 738

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 9  PKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          P++  + ++++ C  CR  K KC  + P C  CEK++  C
Sbjct: 5  PQQRMKPESYS-CSRCRRLKKKCPRQTPSCANCEKAHATC 43

>Kwal_47.17506
          Length = 924

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          ++S N   K  R+K    C  CR RK+KC    P C  C+     C
Sbjct: 1  MNSGNRVVKKKRSKVSRACNNCRRRKIKCTGAQP-CLNCQTYRCEC 45

>Scas_449.1
          Length = 636

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR R+ KCDL  P C  C +  L C
Sbjct: 36 ACSNCRRRRKKCDLNFP-CANCIRLGLNC 63

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region, involved in resistance to the
          antifungal drug ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 3  ISSKNGPKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLP--CGGYDIKLRWSKP 60
          +S+ +G K+  +A  F  C  C+   V CD + P C RC K ++   C   DI +    P
Sbjct: 1  MSANSGVKRASKA--FKTCLFCKRSHVVCDKQRP-CSRCVKRDIAHLCREDDIAVPNEMP 57

Query: 61 MQFD 64
           Q +
Sbjct: 58 SQHE 61

>ADL273C [1468] [Homologous to ScYOR204W (DED1) - SH; ScYPL119C
           (DBP1) - SH] (225070..226941) [1872 bp, 623 aa]
          Length = 623

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 68  VPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYV--YHEDMDDELTMLHTPPIEKI 125
           VP+ +N       L G+ ++P +Q   I+F  YD+  V    ED+ D +T   +PP++++
Sbjct: 98  VPMKRNE-KLEVQLFGTPEDPNFQSSGINFDNYDDIPVDASGEDVPDPITEFTSPPLDEL 156

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 20 GCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
           C  CR R+VKCD + P C  C +++L C
Sbjct: 12 ACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Kwal_23.3514
          Length = 579

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 15 AKTFTGCWTCRGRKVKCDLRHPHCQRCEK 43
          +KT T C  C  RKVKCD R+  C  C K
Sbjct: 6  SKTRTPCVVCTKRKVKCD-RNIPCSNCVK 33

>Kwal_26.7448
          Length = 714

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 20  GCWTCRGRKVKCDLRHPHCQRCE 42
           GC  C+ R++KCD   P C  C+
Sbjct: 94  GCDECKRRRIKCDETLPECNNCK 116

>YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Protein
           containing a fungal Zn(2)-Cys(6) binuclear cluster
           domain, which act as transcriptional regulators [2319
           bp, 772 aa]
          Length = 772

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 23/54 (42%), Gaps = 9/54 (16%)

Query: 4   SSKNGPKKMG------RAKTFTGCWTCRGRKVKCDLRH--PHCQRCEKSNLPCG 49
           S  N PK  G      + KTF+ C TCR  K +CD       C RC    L C 
Sbjct: 50  SETNSPKNNGNKKPRKKRKTFS-CDTCRRVKTRCDFEPFIGKCYRCNVLQLDCS 102

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 17/42 (40%)

Query: 11 KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYD 52
          K  R      C  C+ R+ +CD   P C  C  + + C   D
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVD 98

>YOR204W (DED1) [4997] chr15 (722911..724725) ATP-dependent RNA
           helicase of DEAD box family involved in protein
           synthesis [1815 bp, 604 aa]
          Length = 604

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 13/85 (15%)

Query: 43  KSNLPCGGYDIKLRWSKPMQFDPYGVPIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDE 102
           +SN   GG     RW      D   VP P+N  A    + G  ++P +Q   I+F  YD+
Sbjct: 79  RSNGRSGG-----RW-----IDGKHVPAPRNEKAEIA-IFGVPEDPNFQSSGINFDNYDD 127

Query: 103 EYV--YHEDMDDELTMLHTPPIEKI 125
             V    +D+ + +T   +PP++ +
Sbjct: 128 IPVDASGKDVPEPITEFTSPPLDGL 152

>KLLA0A09251g 808253..810319 some similarities with sp|P38699
          Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
          protein, hypothetical start
          Length = 688

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 1  MGISSKNGPKKMG-RAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48
          MG  +  G +  G   K    C  CR  K KC      C  C K+N PC
Sbjct: 1  MGTETDGGGEISGPNKKASHSCSRCRRLKKKCSKDLSTCTNCAKANEPC 49

>CAGL0H01683g 162753..164852 similar to tr|Q04411 Saccharomyces
          cerevisiae YDR520c, hypothetical start
          Length = 699

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 2/33 (6%)

Query: 19 TGCWTCRGRKVKCD--LRHPHCQRCEKSNLPCG 49
          + C  CR  K +CD  + +  C RC+  NL C 
Sbjct: 50 SSCDVCRRFKTRCDFDVMYGKCYRCKVLNLECS 82

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,816,260
Number of extensions: 1296759
Number of successful extensions: 4501
Number of sequences better than 10.0: 219
Number of HSP's gapped: 4594
Number of HSP's successfully gapped: 225
Length of query: 865
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 755
Effective length of database: 12,788,129
Effective search space: 9655037395
Effective search space used: 9655037395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)