Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLR381W (CTF3)73370837930.0
Scas_719.47397438351e-101
Kwal_23.34856887214868e-52
CAGL0H05027g7022494355e-45
AER042W6762283797e-38
KLLA0E05291g6243392844e-26
CAGL0F08701g185112692.0
KLLA0D02728g667113702.5
CAGL0G05489g533113693.0
ADR289C80760684.9
AAR042W47057668.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR381W
         (720 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR381W (CTF3) [3760] chr12 (879723..881924) Kinetochore protein...  1465   0.0  
Scas_719.4                                                            326   e-101
Kwal_23.3485                                                          191   8e-52
CAGL0H05027g 481654..483762 similar to tr|Q12748 Saccharomyces c...   172   5e-45
AER042W [2547] [Homologous to ScYLR381W - SH] complement(709326....   150   7e-38
KLLA0E05291g complement(479196..481070) weakly similar to sgd|S0...   114   4e-26
CAGL0F08701g 863663..864220 some similarities with sp|P33411 Sac...    31   2.0  
KLLA0D02728g complement(231163..233166) weakly similar to sgd|S0...    32   2.5  
CAGL0G05489g 520095..521696 similar to sp|Q07657 Saccharomyces c...    31   3.0  
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    31   4.9  
AAR042W [228] [Homologous to ScYBR130C (SHE3) - SH] complement(4...    30   8.1  

>YLR381W (CTF3) [3760] chr12 (879723..881924) Kinetochore protein
           required for chromosome segregation during mitosis [2202
           bp, 733 aa]
          Length = 733

 Score = 1465 bits (3793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/708 (100%), Positives = 708/708 (100%)

Query: 13  TNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFL 72
           TNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFL
Sbjct: 13  TNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFL 72

Query: 73  PDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNIS 132
           PDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNIS
Sbjct: 73  PDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNIS 132

Query: 133 SSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQ 192
           SSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQ
Sbjct: 133 SSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQ 192

Query: 193 RFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQ 252
           RFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQ
Sbjct: 193 RFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQ 252

Query: 253 NTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDV 312
           NTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDV
Sbjct: 253 NTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDV 312

Query: 313 DYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQI 372
           DYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQI
Sbjct: 313 DYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQI 372

Query: 373 ETPQEVIPIIISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVCGGILPLWKPELISGT 432
           ETPQEVIPIIISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVCGGILPLWKPELISGT
Sbjct: 373 ETPQEVIPIIISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVCGGILPLWKPELISGT 432

Query: 433 REFFVKFMASIFMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDKLIALGLTLLHDMQSL 492
           REFFVKFMASIFMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDKLIALGLTLLHDMQSL
Sbjct: 433 REFFVKFMASIFMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDKLIALGLTLLHDMQSL 492

Query: 493 LTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIVGPDIMNKVFSSDDPL 552
           LTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIVGPDIMNKVFSSDDPL
Sbjct: 493 LTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIVGPDIMNKVFSSDDPL 552

Query: 553 LLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFK 612
           LLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFK
Sbjct: 553 LLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFK 612

Query: 613 QILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTKIKFTSGIINEETFNN 672
           QILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTKIKFTSGIINEETFNN
Sbjct: 613 QILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTKIKFTSGIINEETFNN 672

Query: 673 FFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLFT 720
           FFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLFT
Sbjct: 673 FFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLFT 720

>Scas_719.4
          Length = 739

 Score =  326 bits (835), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 229/743 (30%), Positives = 385/743 (51%), Gaps = 63/743 (8%)

Query: 13  TNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFL 72
           TNAN  TP   LK  L+ LY  S+++GL+S  L  L+  +C + ++   TK+ I++   L
Sbjct: 13  TNANSTTPNTQLKAELNELYTLSRKHGLTSTNLIKLITFICHSGLLSEETKLIIIKKYLL 72

Query: 73  PDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNIS 132
           P+GY+ K ++  I+ +LG PT  S  +      LQ+ALC WLVH+  L P     ++ I 
Sbjct: 73  PNGYINKSVIDLIVKNLGQPT--STKQKYPSKELQAALCNWLVHISILIP-----KYTID 125

Query: 133 SSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQ 192
            S+W HLWQF +LQ+ +T ++IW  T   ++KPWKL I+++ A++PGY ++   ATLIL+
Sbjct: 126 LSVWSHLWQFHYLQRSVTLILIWFTTLTTEIKPWKLKILEQIALNPGYENSEAYATLILR 185

Query: 193 RFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQ 252
           R+  L+  S++I   I TI+C+ K +K  ++ + +  F   LK++L   +P  F   +++
Sbjct: 186 RYLTLLEKSNRIQALIKTIDCDIKFIKVLQSFQFEDEFRRNLKKVLIAVNPIEFNKRSIE 245

Query: 253 NTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDV 312
            ++     +I QL  D   PL+L     Y   +  + L ++  L +L + W ++ +P   
Sbjct: 246 KSLRY---QIIQLQDDPERPLQLIYKERY-SDNEIIQLEEIACLGELQRRWGEIELPKSG 301

Query: 313 DYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQI 372
           + +     N  +     V++R   +H  + + L        S  YEW   QL RCF  + 
Sbjct: 302 EAIFTNENNLAIQFYPMVLTRS--RHDNNDVQL----EQFWSKMYEWISTQLTRCFQDKK 355

Query: 373 ETPQEVIPI---IISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVCGGILPLWKPELI 429
               E I +   I+    +   L  ++I  F  L+ L  ++     +C  + P+ +   I
Sbjct: 356 MKSLEKITVFDHIMKGCQLHTNLIRKVIDEFLILENLSANKDLFMSICTIVFPIIRRPGI 415

Query: 430 SGTRE---FFVKFM-------------ASIFMWSTRDGHDNNCTFSETCFYVLQMITNWV 473
           +   E   F  K +             + I +WST      N   S     ++ M+ NW+
Sbjct: 416 NDEMESTNFQKKILQIINICNLSNNTNSEIKIWST----SQNTILSIVSNSIILMLKNWL 471

Query: 474 L----DDKLIALGLTLLHDMQSLLTLDKIFNNATSNRFSTMAFISSLDILTQLSK----- 524
           L    D  LI+  L +L+D++ +L  + +  ++  NR  T+  IS LD+L+ ++      
Sbjct: 472 LESDVDMALISYVLDILNDIRKVLLSNLV--HSVENRHITITTISLLDLLSFIATNFHEQ 529

Query: 525 ----QTKSDYAIQYL---IVGPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKF 577
               +T  +   QYL   I+    MNK+ + DDPLLL+A CRYLV+ K  L+     + +
Sbjct: 530 FNDPETPDEIVQQYLKQIILKNSTMNKLCTIDDPLLLNACCRYLVSVKELLVYREPDDLY 589

Query: 578 VRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIP 637
           V++QNQYI+DLTNYL+RN++  SK +F +   F K++++NLY+P  + K +  F+I GIP
Sbjct: 590 VQLQNQYILDLTNYLWRNRIYKSKKIFNIPSKFIKEVVKNLYLPDINSKTSAIFSIFGIP 649

Query: 638 ALSYICIIILRRLETAENTKIKFTSGIINEETFNNFFRVHHDEIGQHGWIKGVNNIHDLR 697
           + SY+    L +LE   +  + +   +I EE F  F     D   +  WI  +++ + L+
Sbjct: 650 STSYLSQQALDQLERNNSVTMNYCE-LITEEGFKRFTSELSD---KSLWISNISDFNQLK 705

Query: 698 VKILMHLSNTANPYRDIAAFLFT 720
            ++L  +S T   Y  IA FLFT
Sbjct: 706 PELLKIIS-TMQCYNHIALFLFT 727

>Kwal_23.3485
          Length = 688

 Score =  191 bits (486), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 183/721 (25%), Positives = 309/721 (42%), Gaps = 119/721 (16%)

Query: 39  GLSSPQLQALVRLLCETSIIDTVTKVYIVENCFLPDGYLTKELLLEIINHLGTPTVFSRY 98
           G+S   +  ++  LCET+ I T TK+ ++    LP+G +    +  ++  LG  T+    
Sbjct: 37  GVSVTLIDEVIGYLCETTAISTSTKILLIREALLPNGPVPSSTVYTVLKQLGVKTLSMPL 96

Query: 99  RIQTPPVLQSALCKWLVHVYFLFPVHSEREHNISSSIWLHLWQFSFLQKWITPLVIWQAT 158
           + +    +Q  LCKWLVHVY      S  E   + S+W  LWQ+ FLQ WIT L+ W   
Sbjct: 97  KREVARDIQVELCKWLVHVYIFMEDISIYEK--TYSMWFQLWQYDFLQTWITYLLFWSTN 154

Query: 159 TPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQRFQCLVGASSQITESIITINCNRKTL 218
             +  K W++S I R +   GY +    ATL+LQ+F+ LV  + +  E+I  I CN   L
Sbjct: 155 RRL-AKDWRVSYILRVSSKNGYTNCKALATLLLQKFK-LVMQNEKAEEAIKKIQCNNGRL 212

Query: 219 KSHRNLKLDAHFL----SILKRILSRAHPANFPADTVQNTIDMYLSEIHQLGADSIYPLR 274
           K+ ++      FL    S+L+     +  A F         D+      QL  ++     
Sbjct: 213 KTLKHDFWAPRFLENWSSVLETCGCMSKVAFF---------DLVKDLTTQLSFEA----- 258

Query: 275 LQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDVDYMMKPSLNSNVLLPRKVMSRD 334
              + + V +   V+L    ++E LA+N     +  D++              R + +RD
Sbjct: 259 -AEIDQKVDTQDIVTLNSTVNIETLAENIESFKVSKDIE--------------RLLTTRD 303

Query: 335 SLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQIETPQEVIPIIISVSSMDNKLSS 394
             + ++  +  +  +    S   EWC  +LK       E  ++             KL +
Sbjct: 304 --RTIFVFLATLDQADPFWSDLEEWCTIRLKLLLFRGRENTEK------------EKLVT 349

Query: 395 RIIQTFC-----NLKYL-----KLDELTLKK-------VCGGILPLWKP-------ELIS 430
           R I T C     +L  L     K++EL L          C  +  L          E I 
Sbjct: 350 RAILTACLLVPKDLNTLVAISDKVEELQLADWYPLSDPYCSAVFILTGNTSEDSALERIV 409

Query: 431 GTREFF--VKFMASI--------FMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDKLIA 480
             R+ F   KF A          F     + H+    +S+T  Y+               
Sbjct: 410 NARQNFKGKKFYAFCQNLLSEIYFSCDMPNCHERAGAYSKTIKYI--------------- 454

Query: 481 LGLTLLH-DMQSLLTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIVGP 539
             LTLLH D+  LL           +R  T+ F   + +L++L  Q   D  +       
Sbjct: 455 --LTLLHEDVLRLL----------PDRHITLTFRLVVKLLSRLGDQGVFDALLSSSYPSK 502

Query: 540 DIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLS 599
            ++N + +S DP+ LS+   +L+ ++  +M      + VR+ N  ++DL+NYL+RNK+ S
Sbjct: 503 HVLNILMASSDPIALSSLADFLIVSQKIVMATGKDKRLVRLHNHCVLDLSNYLWRNKMNS 562

Query: 600 SKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTKIK 659
           + +LFGV   FF+ ++  L    ++FK+  + T+  IPA S+  +  ++  E A ++K+ 
Sbjct: 563 TGTLFGVPTLFFRNVINGLNQFNSEFKSKSWLTLLSIPAFSFYSMKAVKSFEEASSSKVS 622

Query: 660 FTSGIINEETFNNFFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLF 719
           F  G + E  F+   R          W+  +    +L+  IL H+      Y++I  FLF
Sbjct: 623 F-KGPLTEINFDTLRRTTK----TSDWLDTIATFQELKNAILAHM-KYHGAYKEIPEFLF 676

Query: 720 T 720
           +
Sbjct: 677 S 677

>CAGL0H05027g 481654..483762 similar to tr|Q12748 Saccharomyces
           cerevisiae YLR381w, start by similarity
          Length = 702

 Score =  172 bits (435), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 152/249 (61%), Gaps = 4/249 (1%)

Query: 14  NANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFLP 73
           +AN       +K  L ++Y ++ ++GL++ +L+ ++  +  T +I   TK+YI+ NC  P
Sbjct: 14  SANATVTTDFIKVQLEIIYHQTIKFGLTNLELRNIIHFITTTQLITDETKLYIIHNCLYP 73

Query: 74  DGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNISS 133
              + KE+++EI++ LGT T++S Y + TP  +Q+ALC+WLV+ +FL  +   RE +   
Sbjct: 74  CEVIGKEVVMEILSKLGTTTIYSPYELTTPKTVQTALCEWLVNAFFLVDIEQIREFD--- 130

Query: 134 SIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQR 193
           S W+HLW++S+LQKW+T +++W A  P +VK WK+ +I   A++ GY ++ G A +IL++
Sbjct: 131 SFWIHLWKYSYLQKWLTYIIVWTA-NPHNVKQWKIRMIHNIAINLGYSESSGYAVIILKK 189

Query: 194 FQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQN 253
           +Q + G S++I + + T+    + +   +N+KL   F      IL  + P  F  + ++N
Sbjct: 190 YQQICGYSAEINDILPTLRFPYRRIIKVQNIKLRNRFFKNTSDILITSTPDTFNMEKLEN 249

Query: 254 TIDMYLSEI 262
            + M ++ +
Sbjct: 250 RMQMLINSL 258

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 113/205 (55%), Gaps = 5/205 (2%)

Query: 516 LDILTQLSKQTKSDYAIQYLIVGPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTN 575
           L+++T +    +   ++  LI+ P+I+  +    DPLLL++ C+YL  +K  L       
Sbjct: 494 LNLVTSIIDSNELYKSVPGLIIKPNILKSLIMVFDPLLLNSCCKYLTQSKGALSVNIQDK 553

Query: 576 KFVRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITG 635
             +R  NQ ++D TNYL+RNK+LSS+SLF +S  F KQ+++NLY+P  D K+   F + G
Sbjct: 554 DLIRCHNQLLLDTTNYLWRNKILSSRSLFDISTKFIKQVVDNLYLPDCDKKDKNVFGLPG 613

Query: 636 IPALSYICIIILRRLETAENTKIKFTSGIINEETFNNFFRVHHDEIGQHGWIKGVNNIHD 695
           +P   ++ +  +RRLE     +  + +    + T + F +   ++  +  W+  + +  +
Sbjct: 614 VPTTGFVFLQAVRRLEGTHGARSHYNT----DYTSSGFKKFKSNQEEKGDWLHDIEDFDE 669

Query: 696 LRVKILMHLSNTANPYRDIAAFLFT 720
            R  +L   + + +  ++IA FL+T
Sbjct: 670 FRRVVLKEFT-SIDCVKEIAVFLYT 693

>AER042W [2547] [Homologous to ScYLR381W - SH]
           complement(709326..711356) [2031 bp, 676 aa]
          Length = 676

 Score =  150 bits (379), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 128/228 (56%), Gaps = 2/228 (0%)

Query: 14  NANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFLP 73
           +  + T P  L++ LS LYE++ ++G+S  ++  L+  LC    I   T+VYIVENC +P
Sbjct: 14  DCTKETGPSQLRSVLSDLYERAPRHGISPAKILELIGFLCSAEFIAVSTRVYIVENCLIP 73

Query: 74  DGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNISS 133
           +GYL+   + E++ HLG  T  + +++   P  Q AL KWL HV  + P + ++    + 
Sbjct: 74  NGYLSSSTVFEVLKHLGPSTPQNAFKLIVEPAFQVALVKWLCHVLVIIPDY-QKVLQRTY 132

Query: 134 SIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQR 193
            IW  LW   +LQ W T L+IW   + + V  +++ +++R   +PGYR+    A+ +L +
Sbjct: 133 PIWFQLWMVDYLQDWTTYLLIWGTESKIQVTEYRVRVLERIGSNPGYRNGKPLASFLLHK 192

Query: 194 FQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRA 241
           F  L   S  +  +I  + CN K L + + ++L++ F+  L+ +LS  
Sbjct: 193 FLQL-KPSKIVQHAIAELRCNAKRLMTVQKVQLESKFMDGLQHVLSAG 239

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 101/188 (53%), Gaps = 8/188 (4%)

Query: 535 LIVGPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYR 594
           + V PDI+N + + +DPL+++  C YLV+ K+++  +   N +VR  N+ I+D+ NYL+R
Sbjct: 483 VFVLPDIINSLVALNDPLVIALICEYLVSAKDRVKGFTVDNSYVRKLNRCILDMANYLWR 542

Query: 595 NKVLSSKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAE 654
           NK+ +    +G+   F+ +I  NLY+P  + +    +++       +I   +LRRLE  E
Sbjct: 543 NKLFTEPYTWGLPKTFWAKISSNLYLPEPEIRQKHLYSLPNFYPFRFISEEVLRRLEGQE 602

Query: 655 NTKIKFTSGIINEETFNNFFRVHHDEIGQHG--WIKGVNNIHDLRVKILMHLSNTANPYR 712
           NT++ ++  +         +R    E+  +G  W+  VNN    R ++LM +   +  Y 
Sbjct: 603 NTEVIYSKPLTEAG-----YRCWRKELELNGKTWLSKVNNYDSFRKRLLMGIQEDST-YA 656

Query: 713 DIAAFLFT 720
            +  F+ T
Sbjct: 657 GVPLFMQT 664

>KLLA0E05291g complement(479196..481070) weakly similar to
           sgd|S0004373 Saccharomyces cerevisiae YLR381w
           hypothetical protein, start by similarity
          Length = 624

 Score =  114 bits (284), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 88/339 (25%), Positives = 149/339 (43%), Gaps = 41/339 (12%)

Query: 22  QALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFLPDGYLTKEL 81
           Q +K  +  LYE +   GL    ++ L+  LC T II   TK +I+  C +P+ Y+  + 
Sbjct: 21  QQIKNCIEFLYESATTIGLGCEDIRKLIDCLCITDIIGAETKEFIITRCLVPNEYVDAKC 80

Query: 82  LLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFP-VHSEREHNISSSIWLHLW 140
           +  II+ LGTPT    Y+      LQ AL +W+ H+Y   P V  +     + SIW   W
Sbjct: 81  ITLIISKLGTPTFLHPYKTVPGRRLQVALVRWVCHIY---PWVKDKSIFKDTFSIWFEYW 137

Query: 141 QFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQRFQCL-VG 199
           +  +LQ WIT +++W       +  W+  ++     +PGY+++   +  IL  F  L   
Sbjct: 138 RLDYLQHWITYILLW-TFDDRHISKWRCKVLFNIGNNPGYKNSRAYSVYILDAFLALETD 196

Query: 200 ASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQNTIDMYL 259
               I++ I  +N N K+L+   +   D  F+   ++ LS  +  +          D   
Sbjct: 197 LKDIISDFIQMLNSNEKSLQKIASFDYDRQFVLNTRQALSAKNLLD----------DDQF 246

Query: 260 SEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDVDYMMKPS 319
            EI +   D            Y+  + T    ++ SLE+LA+NW     P D   ++K  
Sbjct: 247 EEILKNYGDR---------KAYMKPEQT----NILSLEKLARNWNNFDGPYDFTRLLK-- 291

Query: 320 LNSNVLL----------PRKVMSRDSLKHLYSSIILIKN 348
             S+V+           PR +  R  L+  + S  L ++
Sbjct: 292 FKSDVMWLKIAGHASTDPRIIQFRSYLRERHDSRTLFRD 330

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 80/181 (44%), Gaps = 11/181 (6%)

Query: 542 MNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLSSK 601
           + +V + +DPLL+S  C +LV     +    S    +   ++ I  L   L+ + V SS 
Sbjct: 444 IEQVVAVNDPLLISELCWFLVRASAAIHPKHSPEILISDIDKSIHYLVEVLWNHNVTSSG 503

Query: 602 SLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENT-KIKF 660
           S   +   +++ + ++ Y+    F +   ++   +P   ++C I  + L   E T   + 
Sbjct: 504 STL-LPNSYWESLRQSQYLSHTSFPSKLLYS---VPNFGFMCFICQKLLFEKERTLGYEH 559

Query: 661 TSGIINEETFNNFFRVHHDEIGQH-GWIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLF 719
             G  +E T   +      ++G +  W + +N   DLR K  + +  +   Y  I+ FLF
Sbjct: 560 FLGDFSERTLKQWVT----KLGSNPQWFQEINQFSDLR-KHFLRMVRSDYRYSGISEFLF 614

Query: 720 T 720
           T
Sbjct: 615 T 615

>CAGL0F08701g 863663..864220 some similarities with sp|P33411
           Saccharomyces cerevisiae YGR006w PRP18 U5
           snRNA-associated protein, hypothetical start
          Length = 185

 Score = 31.2 bits (69), Expect = 2.0,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 15/112 (13%)

Query: 270 IYPLRLQSLPEYVPSDSTVSLWDVT-SLEQLAQNWPQLHIPNDVDYMMKPSLNSNVLLP- 327
           IYPL +      +PSD  VSL  V   L+Q      ++H+   ++  MK SL  NV  P 
Sbjct: 73  IYPLLVSLRKARLPSDQLVSLATVLYHLQQYESTRDKVHMQRSLESYMKLSL-GNVAWPI 131

Query: 328 ---------RKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAH 370
                    RK+  +D+  +  ++ I+     DE +  +   I  +KR   H
Sbjct: 132 GVTQVGIHERKIQRQDARNNTATAGIVANVMTDEQTRLW---ITNVKRLLTH 180

>KLLA0D02728g complement(231163..233166) weakly similar to
           sgd|S0004416 Saccharomyces cerevisiae YLR424w, start by
           similarity
          Length = 667

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 18/113 (15%)

Query: 16  NERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETS---IIDTVTKVYIVENCFL 72
           +ER   Q  +  L  + EK K+  LS P L+  +    E +   I+D +  +++++   L
Sbjct: 212 DERKVHQEER--LQSVLEKVKEKQLSQPSLEDQITECLEINDDDILDKLCTMFLLKE--L 267

Query: 73  PDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSA-----------LCKWL 114
             G  T ++ +E +NHL     F  YR+++  +L              LC WL
Sbjct: 268 NRGINTADMQVEKLNHLRAAIRFLSYRMESGYILNETQSSIYRLVYQPLCYWL 320

>CAGL0G05489g 520095..521696 similar to sp|Q07657 Saccharomyces
           cerevisiae YDL225w SHS1, start by similarity
          Length = 533

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 9/113 (7%)

Query: 469 ITNWVLDDKLIALGLTLLHDMQSLLTLDKIFNNATSNRFSTMAFIS-SLDILTQLSKQTK 527
           I ++  ++ L +  +  L D+ +    D++FN AT N+ S +A  S S +I ++  ++ K
Sbjct: 75  IISFNSNNGLPSQSMENLMDLTNSSEFDQVFNPATQNKDSGIAITSTSFEIRSKNEEKNK 134

Query: 528 SDYA--------IQYLIVGPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYP 572
            D          I  L +G +I N + +S+  L L      ++A + K+ + P
Sbjct: 135 YDVDMDTIYLNLIMTLGLGENIDNSICTSEIDLFLRQQFDTVLAEETKIRRNP 187

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 251 VQNTIDMYLSEIHQLGADSIYPLRLQS--------LPEYVPSDSTVSLWDVTSLEQLAQN 302
           +Q TI MY S IH +  DSI P  LQ         L E+V  +      D+ ++E+ AQN
Sbjct: 239 IQETIMMYASLIHGVNHDSIGPEELQEAEGELSLYLREHVVWERNTVWKDMMNIERKAQN 298

>AAR042W [228] [Homologous to ScYBR130C (SHE3) - SH]
           complement(416525..417937) [1413 bp, 470 aa]
          Length = 470

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 321 NSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQIETPQE 377
           N N +L RK      +K L   ++ ++ S +E+++ +    +QL+  FAH+ E  Q+
Sbjct: 133 NLNSMLNRKTRR---VKDLDMELVQLRTSHEEATASHNQLKYQLENKFAHETELEQQ 186

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,400,949
Number of extensions: 1022619
Number of successful extensions: 2724
Number of sequences better than 10.0: 17
Number of HSP's gapped: 2782
Number of HSP's successfully gapped: 21
Length of query: 720
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 611
Effective length of database: 12,822,747
Effective search space: 7834698417
Effective search space used: 7834698417
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)