Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLR142W (PUT1)47646824830.0
CAGL0M04499g46945614790.0
Scas_506.456441614870.0
KLLA0D16962g46743714460.0
Kwal_27.1130747943713620.0
AGL165W46344513550.0
Sklu_1345.190942374e-24
Scas_707.3038347750.36
CAGL0L07458g36441720.82
ADR137W661116720.95
KLLA0C14696g95193711.3
KLLA0A00594g1748100683.2
Kwal_27.1043338276673.6
Sklu_2302.3244113645.8
ACL031C614115656.7
YPL264C35376647.5
CAGL0H03047g74195649.5
Scas_703.34457144639.6
ADL086C552105639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR142W
         (468 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR142W (PUT1) [3551] chr12 (425187..426617) Proline oxidase (pr...   961   0.0  
CAGL0M04499g 494202..495611 highly similar to sp|P09368 Saccharo...   574   0.0  
Scas_506.4                                                            577   0.0  
KLLA0D16962g 1437692..1439095 similar to sp|P09368 Saccharomyces...   561   0.0  
Kwal_27.11307                                                         529   0.0  
AGL165W [4147] [Homologous to ScYLR142W (PUT1) - SH] complement(...   526   0.0  
Sklu_1345.1 YLR142W, Contig c1345 1520-1792                            96   4e-24
Scas_707.30                                                            33   0.36 
CAGL0L07458g complement(820608..821702) similar to sp|P38241 Sac...    32   0.82 
ADR137W [1878] [Homologous to ScYMR061W (RNA14) - SH] complement...    32   0.95 
KLLA0C14696g 1284151..1287006 some similarities with sp|P46676 S...    32   1.3  
KLLA0A00594g complement(53304..58550) gi|5531276|emb|CAB50890.1 ...    31   3.2  
Kwal_27.10433                                                          30   3.6  
Sklu_2302.3 YNL148C, Contig c2302 2208-2942 reverse complement         29   5.8  
ACL031C [1018] [Homologous to ScYER080W - SH] (309369..311213) [...    30   6.7  
YPL264C (YPL264C) [5187] chr16 complement(43283..44344) Protein ...    29   7.5  
CAGL0H03047g 285868..288093 weakly similar to sp|P53148 Saccharo...    29   9.5  
Scas_703.34                                                            29   9.6  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...    29   9.9  

>YLR142W (PUT1) [3551] chr12 (425187..426617) Proline oxidase
           (proline dehydrogenase), first step in synthesis of
           glutamate from proline [1431 bp, 476 aa]
          Length = 476

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/468 (100%), Positives = 468/468 (100%)

Query: 1   MIASKSSLLVTKSRIPSLCFPLIKRSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPN 60
           MIASKSSLLVTKSRIPSLCFPLIKRSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPN
Sbjct: 1   MIASKSSLLVTKSRIPSLCFPLIKRSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPN 60

Query: 61  SINFLQTLPKKELFQLGFIGIATLNSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKE 120
           SINFLQTLPKKELFQLGFIGIATLNSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKE
Sbjct: 61  SINFLQTLPKKELFQLGFIGIATLNSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKE 120

Query: 121 VIECGKRLQKRGISNMMLSLTIENSEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQLE 180
           VIECGKRLQKRGISNMMLSLTIENSEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQLE
Sbjct: 121 VIECGKRLQKRGISNMMLSLTIENSEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQLE 180

Query: 181 SKPINDIAPGYIALKPSALVDNPHEVLYNFSNPAYKAQRDQLIENCSKITKEIFELNQSL 240
           SKPINDIAPGYIALKPSALVDNPHEVLYNFSNPAYKAQRDQLIENCSKITKEIFELNQSL
Sbjct: 181 SKPINDIAPGYIALKPSALVDNPHEVLYNFSNPAYKAQRDQLIENCSKITKEIFELNQSL 240

Query: 241 LKKYPERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDS 300
           LKKYPERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDS
Sbjct: 241 LKKYPERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDS 300

Query: 301 GDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDL 360
           GDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDL
Sbjct: 301 GDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDL 360

Query: 361 IINGEDSYFGHLVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLIT 420
           IINGEDSYFGHLVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLIT
Sbjct: 361 IINGEDSYFGHLVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLIT 420

Query: 421 NHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRSDNGWPLIKAIAK 468
           NHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRSDNGWPLIKAIAK
Sbjct: 421 NHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRSDNGWPLIKAIAK 468

>CAGL0M04499g 494202..495611 highly similar to sp|P09368
           Saccharomyces cerevisiae YLR142w PUT1 Proline oxidase,
           hypothetical start
          Length = 469

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/456 (62%), Positives = 347/456 (76%), Gaps = 14/456 (3%)

Query: 23  IKRSYVSKTPTHSNTAANLMVE---TPAANANGNSVMAPPNSINFLQTLPKKELFQLGFI 79
           I R YVS+T   SN       +    P      +    PP+S+ +L+TL + E+F LG I
Sbjct: 12  IARRYVSQTAQTSNAMVADTTDPMMNPMQPKLSSHSQLPPSSVAYLKTLSRAEVFSLGMI 71

Query: 80  GIATLNSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKEVIECGKRLQKRGISNMMLS 139
           G+AT +   LN +IKLFPY+P+P+IK FVS LYCGG+N  EV   G++LQKRGISNMMLS
Sbjct: 72  GLATTSKPVLNLVIKLFPYVPMPLIKMFVSRLYCGGDNINEVKTFGEKLQKRGISNMMLS 131

Query: 140 LTIENSEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQLE-----SKPINDIAPGYIAL 194
           LTIE+SEGTK++    ++ IV+ETI SVH +L PN++ QLE     +K IN+IAPGYIAL
Sbjct: 132 LTIEDSEGTKNID---INYIVEETIKSVHGVLKPNLVNQLEKCGNDAKKINEIAPGYIAL 188

Query: 195 KPSALVDNPHEVLYNFSNP--AYKAQRDQLIENCSKITKEIFELNQSLLKKYPERKAPFM 252
           KPSALV NPH+VL NF+NP   + AQR++LI+NCS+I +EI++LN  LLKKYP R APF 
Sbjct: 189 KPSALVSNPHDVLMNFNNPDPHWVAQREKLIDNCSRIAQEIYDLNNDLLKKYPSRTAPFC 248

Query: 253 VSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQ 312
           V+TIDAEKYDLQ +GVYELQRILFQKFN  SS ++S +GTWQLYL DS   +  E   A 
Sbjct: 249 VATIDAEKYDLQNSGVYELQRILFQKFNKLSSPMVSVIGTWQLYLVDSAAQLAREHARAM 308

Query: 313 ENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDLIINGEDSYFGHL 372
           + GYKLG+KLVRGAYIHSE  R+ IIF  K GTDENYD ++T V+ DL+ NG  SY+GHL
Sbjct: 309 KEGYKLGVKLVRGAYIHSETKRDSIIFKTKEGTDENYDAVMTTVIQDLLKNGTKSYYGHL 368

Query: 373 VVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLITNHGAKNIIKYVP 432
           VVASHNY SQML T +LK   +N   K+NIVLGQLLGM+DNVT+DLIT HGAKNIIKYVP
Sbjct: 369 VVASHNYGSQMLATKILKDAPEN-VGKANIVLGQLLGMSDNVTHDLITKHGAKNIIKYVP 427

Query: 433 WGPPLETKDYLLRRLQENGDAVRSDNGWPLIKAIAK 468
           WGPPLETKDYLLRRLQENGDAV+SDNG+PL+KA+ K
Sbjct: 428 WGPPLETKDYLLRRLQENGDAVKSDNGFPLVKAVIK 463

>Scas_506.4
          Length = 564

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/416 (68%), Positives = 335/416 (80%), Gaps = 7/416 (1%)

Query: 57  APPNSINFLQTLPKKELFQLGFIGIATLNSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGE 116
           +PP+S ++L+TL   ELF LG IGIAT+N  FLN IIKLFPYIPIP+IK FVS LYCGG 
Sbjct: 147 SPPDSTHYLKTLSFHELFSLGCIGIATINKQFLNLIIKLFPYIPIPLIKIFVSKLYCGGI 206

Query: 117 NFKEVIECGKRLQKRGISNMMLSLTIENSEGTKSLSSTPVDQIVKETISSVHNILLPNII 176
              EV++CG+ LQ RGI+NMMLSLTIENSEG K   +  ++ I++ETI+S+H +L PN++
Sbjct: 207 TPTEVLKCGQNLQLRGITNMMLSLTIENSEGGKQ--NIDINHIIQETINSIHTVLKPNLL 264

Query: 177 GQLES-KPINDIAPGYIALKPSALVDNPHEVLYNFSN---PAYKAQRDQLIENCSKITKE 232
            Q+E    INDIAPGYIALKPSALVDNP EVL NF N   P +  +R QLIENCSKI + 
Sbjct: 265 NQIEKVDDINDIAPGYIALKPSALVDNPREVLLNFQNETDPIWVEKRTQLIENCSKINEI 324

Query: 233 IFELNQSLLKKYPERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGT 292
           IF+LN  L K YPERKAPF V TIDAEK+DLQ NGVY LQRIL QKFNP SS L+SC+GT
Sbjct: 325 IFQLNNDLFKLYPERKAPFFVCTIDAEKFDLQINGVYALQRILMQKFNPVSSPLVSCIGT 384

Query: 293 WQLYLRDSGDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRI 352
           WQLYLRDS  H+  E+KLA+ENGYKLGLKLVRGAY+HSE NR+ II  +K  TD NYD+I
Sbjct: 385 WQLYLRDSKQHLNEEIKLAKENGYKLGLKLVRGAYMHSELNRDSIIHSNKFDTDMNYDQI 444

Query: 353 ITQVVNDLIINGEDSYFGHLVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMAD 412
           +  ++ DL  NG+ S +GHLVVASHNY+SQ++ T LLK ++ + YA SN+VLGQLLGMAD
Sbjct: 445 VMDIIKDLSKNGDQSIYGHLVVASHNYKSQLIATKLLKESK-SLYANSNVVLGQLLGMAD 503

Query: 413 NVTYDLITNHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRSDNGWPLIKAIAK 468
           NVT+DL+ NHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVR+DNGWPL KA+ K
Sbjct: 504 NVTHDLVYNHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVRADNGWPLCKAVFK 559

>KLLA0D16962g 1437692..1439095 similar to sp|P09368 Saccharomyces
           cerevisiae YLR142w PUT1 proline oxidase singleton, start
           by similarity
          Length = 467

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/437 (62%), Positives = 335/437 (76%), Gaps = 6/437 (1%)

Query: 33  THSNTAANLMVETPAANANGNSVMAPPNSINFLQTLPKKELFQLGFIGIATLNSFFLNTI 92
           + +N   + M    A +    S    P     L+TL K ELF LG IG+ T+N   L+ +
Sbjct: 31  SQTNATKSTMAPATAIHDMAASQHTVPAPDAHLRTLSKSELFSLGMIGVCTINKPMLDLV 90

Query: 93  IKLFPYIPIPVIKFFVSSLYCGGENFKEVIECGKRLQKRGISNMMLSLTIENSEGTKSLS 152
           IKLFPY+P+ ++K F+S LYCGG+   EV+E GKRLQ RGI+NMMLSLTIE++EGTK++ 
Sbjct: 91  IKLFPYVPLFMVKLFISPLYCGGDTPAEVVETGKRLQNRGINNMMLSLTIEDAEGTKNVD 150

Query: 153 STPVDQIVKETISSVHNILLPNIIGQLES-KPINDIAPGYIALKPSALVDNPHEVLYNFS 211
              ++ IV ETI SVH IL P ++ QLES K IN I PGYIALKPSALV NP +VL NF+
Sbjct: 151 ---INYIVSETIKSVHTILKPLLVEQLESGKDINSIPPGYIALKPSALVANPAQVLLNFN 207

Query: 212 NPAYKAQRDQLIENCSKITKEIFELNQSLLKKYPERKAPFMVSTIDAEKYDLQENGVYEL 271
           NP +K QRD+L+ NCSKIT+E++ LNQ LL KYPERK+PF VSTIDAEKYDLQ+ GVYEL
Sbjct: 208 NPEWKTQRDELVNNCSKITQEVYNLNQELLAKYPERKSPFFVSTIDAEKYDLQKAGVYEL 267

Query: 272 QRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQENGYKLGLKLVRGAYIHSE 331
           QRILF KFNP SS LISCVGTWQLYL DS   +  + + A++ GYKLGLKLVRGAYIHSE
Sbjct: 268 QRILFSKFNPASSPLISCVGTWQLYLVDSAADLAKDYERAKKEGYKLGLKLVRGAYIHSE 327

Query: 332 KNRNQIIFGDKTGTDENYDRIITQVVNDLIINGEDSYFGHLVVASHNYQSQMLVTNLLKS 391
            NR+ +++  K GTD NY++++T  + DL++NGE SY+GHLVVASHNY SQML T LL +
Sbjct: 328 PNRS-VVYATKEGTDANYNKVMTTAIKDLLVNGEKSYYGHLVVASHNYDSQMLATKLL-A 385

Query: 392 TQDNSYAKSNIVLGQLLGMADNVTYDLITNHGAKNIIKYVPWGPPLETKDYLLRRLQENG 451
            Q NS  K+N+ L QLLGM+DNVT+DLITNH  +NIIKYVPWGPPLETKDYLLRRLQENG
Sbjct: 386 DQKNSVGKANVTLAQLLGMSDNVTHDLITNHKVENIIKYVPWGPPLETKDYLLRRLQENG 445

Query: 452 DAVRSDNGWPLIKAIAK 468
           DAVR+DNG PLIKA+ K
Sbjct: 446 DAVRADNGIPLIKAVLK 462

>Kwal_27.11307
          Length = 479

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/437 (57%), Positives = 328/437 (75%), Gaps = 7/437 (1%)

Query: 35  SNTAANLMVETPAANANGNSVMA--PPNSINFLQTLPKKELFQLGFIGIATLNSFFLNTI 92
           S   A L +E   A  +    MA   P S   L++L  KEL  LG IG+AT+N   L+ +
Sbjct: 32  STNKATLKMEAARAQVDTTKPMAVRTPTSEAHLESLSAKELISLGVIGMATINKPMLDLV 91

Query: 93  IKLFPYIPIPVIKFFVSSLYCGGENFKEVIECGKRLQKRGISNMMLSLTIENSEGTKSLS 152
           +K+FP++P+ ++K  VSSLYCGG+NFKEV E G+RL++RGI+NMMLSLTIE++EG K++ 
Sbjct: 92  LKMFPFVPVWLMKLLVSSLYCGGDNFKEVRETGERLRQRGINNMMLSLTIEDAEGVKNID 151

Query: 153 STPVDQIVKETISSVHNILLPNIIGQLESKP-INDIAPGYIALKPSALVDNPHEVLYNFS 211
              ++ IV ETI S+H IL PN+   L+S   IN I PGY+ALKPSALV NP+E L +F+
Sbjct: 152 ---INHIVSETIGSLHEILKPNLQAGLDSASDINSIPPGYLALKPSALVSNPYETLLHFN 208

Query: 212 NPAYKAQRDQLIENCSKITKEIFELNQSLLKKYPERKAPFMVSTIDAEKYDLQENGVYEL 271
           +P +K+QR+ LI NC+ IT+E++ LNQ   K YPERK PF V+ IDAEKY LQ+ GVYEL
Sbjct: 209 DPEWKSQRETLINNCTAITQEVYNLNQEFAKLYPERKIPFFVAVIDAEKYALQKAGVYEL 268

Query: 272 QRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQENGYKLGLKLVRGAYIHSE 331
           QRILFQKFNP  S  +SCVGTWQLYL DS   +  + + A++ GYKLGLK+VRGAYIHSE
Sbjct: 269 QRILFQKFNPKESSQVSCVGTWQLYLTDSAADLTKDYERAEKEGYKLGLKIVRGAYIHSE 328

Query: 332 KNRNQIIFGDKTGTDENYDRIITQVVNDLIINGEDSYFGHLVVASHNYQSQMLVTNLLKS 391
            NR+ II+ D+ GTD N++ ++ +V++DL+  G+DS +GHLVVASHNY+SQ+L T +LK 
Sbjct: 329 PNRDTIIYPDQAGTDANFNGVMKKVIDDLVSKGQDSTYGHLVVASHNYESQLLATEILKG 388

Query: 392 TQDNSYAKSNIVLGQLLGMADNVTYDLITNHGAKNIIKYVPWGPPLETKDYLLRRLQENG 451
             D    K+N+VLGQLLGMADNVT+DLI NH A NIIKYVPWGPP ETKDYL RR+QENG
Sbjct: 389 -HDGEIGKANVVLGQLLGMADNVTHDLINNHNATNIIKYVPWGPPAETKDYLFRRMQENG 447

Query: 452 DAVRSDNGWPLIKAIAK 468
           DAVR+DNG+PL+ ++ K
Sbjct: 448 DAVRADNGFPLVISVVK 464

>AGL165W [4147] [Homologous to ScYLR142W (PUT1) - SH]
           complement(387159..388550) [1392 bp, 463 aa]
          Length = 463

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 326/445 (73%), Gaps = 14/445 (3%)

Query: 25  RSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPNSINFLQTLPKKELFQLGFIGIATL 84
           R YVS+T T  NT A +        A        P +   L+TL ++EL  LG IG  T 
Sbjct: 27  RGYVSQTQTKQNTVAVV--------AGAAERFVAPAADAHLKTLSQRELVALGVIGCVTT 78

Query: 85  NSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENFKEVIECGKRLQKRGISNMMLSLTIEN 144
           N+  L  + + FPY+P PV K  +S+LYCGG+   EV E G+ L +RG+ NMMLSLT+E+
Sbjct: 79  NARLLKLVTQAFPYVPTPVAKLLISALYCGGDTMAEVRETGRALARRGVGNMMLSLTVED 138

Query: 145 SEGTKSLSSTPVDQIVKETISSVHNILLPNIIGQL-ESKPINDIAPGYIALKPSALVDNP 203
           SEGTK++    +D IV+ET+ S+H +LLP++  QL  +  +N + PGY+ALKPSALV +P
Sbjct: 139 SEGTKNID---IDYIVEETVRSLHGVLLPHMEEQLARAADVNSVPPGYLALKPSALVSDP 195

Query: 204 HEVLYNFSNPAYKAQRDQLIENCSKITKEIFELNQSLLKKYPERKAPFMVSTIDAEKYDL 263
              L +F++PA++ +RD L+ N S+I  E+++LNQ +L +YP RK+PF V+TIDAEKY++
Sbjct: 196 ANTLLHFADPAWREKRDALVANFSRIVGEVYKLNQEMLARYPGRKSPFFVATIDAEKYEV 255

Query: 264 QENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQENGYKLGLKLV 323
           Q  GVYELQR++F K+NP SS ++SC+GTWQLYLRD+   ++ + + A+  GYKLGLKLV
Sbjct: 256 QCAGVYELQRLMFAKYNPVSSPIVSCIGTWQLYLRDAAADLVAQAERAEREGYKLGLKLV 315

Query: 324 RGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDLIINGEDSYFGHLVVASHNYQSQM 383
           RGAY+HSE NR+ +I   K  TDE+Y+ ++ +V+ DL+ NGE S FGHLVVASHNYQSQM
Sbjct: 316 RGAYLHSEPNRD-VIHPTKEATDEHYNEVMAKVIQDLLANGEHSVFGHLVVASHNYQSQM 374

Query: 384 LVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLITNHGAKNIIKYVPWGPPLETKDYL 443
           L T LL++    S  KSN+VLGQLLGMADNVTYDLI NHGA+NIIKYVPWGPP ETKDY+
Sbjct: 375 LATMLLQA-HGESVGKSNVVLGQLLGMADNVTYDLIHNHGARNIIKYVPWGPPKETKDYM 433

Query: 444 LRRLQENGDAVRSDNGWPLIKAIAK 468
            RRLQENGDAVR+DNGWPL+KA+ +
Sbjct: 434 HRRLQENGDAVRADNGWPLVKAVCR 458

>Sklu_1345.1 YLR142W, Contig c1345 1520-1792
          Length = 90

 Score = 95.9 bits (237), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/94 (47%), Positives = 65/94 (69%), Gaps = 5/94 (5%)

Query: 25  RSYVSKTPTHSNTAANLMVETPAANANGNSVMAPPNSINFLQTLPKKELFQLGFIGIATL 84
           R+YVS+TP+H    +   V  P++     +  A P+S   L+TL K+ELF LG IG+AT 
Sbjct: 2   RTYVSQTPSHKTVVSMDSVAPPSS-----APFAAPSSDAHLKTLSKRELFSLGIIGVATT 56

Query: 85  NSFFLNTIIKLFPYIPIPVIKFFVSSLYCGGENF 118
           ++  LN +IK+FPY+P+P++K  VSSLYCGG+NF
Sbjct: 57  SNLMLNLVIKMFPYVPMPIVKLLVSSLYCGGDNF 90

>Scas_707.30
          Length = 383

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 294 QLYLRDSGDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQIIFG 340
           Q  LR   D ++   KLA E+GY  G K   G +IHS +    ++ G
Sbjct: 155 QASLRKYTDTLVTRAKLAGEDGYAYGHKFNGGQFIHSPRGNKCLVLG 201

>CAGL0L07458g complement(820608..821702) similar to sp|P38241
           Saccharomyces cerevisiae YBR065c ECM2, start by
           similarity
          Length = 364

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 164 ISSVHNILLPNIIGQLESKPINDIAPGYIALKPSALVDNPH 204
           + S+ +ILL N+  +LE KP+ND      AL+   L DNPH
Sbjct: 134 VDSIEDILL-NLREKLEGKPLNDENEPISALQNKELGDNPH 173

>ADR137W [1878] [Homologous to ScYMR061W (RNA14) - SH]
           complement(946464..948449) [1986 bp, 661 aa]
          Length = 661

 Score = 32.3 bits (72), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 266 NGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQENGYKLGLKLVRG 325
           N VYEL+R  F+KF P + K+      +QL     G+++L  L+       + G+ ++ G
Sbjct: 536 NNVYELERRFFEKF-PEAEKIEVFTDRYQL----QGENLLKRLEFPYLMD-EYGIPVLSG 589

Query: 326 AYIHSEKNRNQIIFGD----KTGTDENYDRIITQVVNDLIINGEDSYFGHLVVASH 377
             +    +   I+F D    K    E  + +  +++  L +  +  YF  +V+  H
Sbjct: 590 YAVKRSLHSAGIVFDDNGSSKRQRQEQTEAVPMEIIELLKVLPKRQYFKTIVLDPH 645

>KLLA0C14696g 1284151..1287006 some similarities with sp|P46676
           Saccharomyces cerevisiae YDR310c SUM1 suppressor of SIR
           mutations singleton, hypothetical start
          Length = 951

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 19/93 (20%)

Query: 99  IPIPVIKFFVSSLYCGGENFKEVIECGKRLQKRGISNMMLSLTIENSEGTKSLSSTPVDQ 158
           +P+P+ K+ +SS               K L++       LS T ENS G +S SS P D 
Sbjct: 394 VPVPLGKYQLSS---------------KHLEELSKVPFSLSQTAENSSGAQSPSSNPPDS 438

Query: 159 IVKET----ISSVHNILLPNIIGQLESKPINDI 187
               T    IS+ +N+  P  +G + +   +D+
Sbjct: 439 ARSVTPQTIISAYNNLEQPGNVGSVSTASADDV 471

>KLLA0A00594g complement(53304..58550) gi|5531276|emb|CAB50890.1
           Kluyveromyces lactis MLP1 homologue, start by similarity
          Length = 1748

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 14/100 (14%)

Query: 168 HNILLPNIIGQLESKPINDIAPG--YIALKPSALVDNPHEVLYNFSNPAYKAQRDQLIEN 225
            N+ +   + QL+S+  N +     +I+    AL D   E L+      ++ ++ +LIE 
Sbjct: 45  ENLRITATLDQLKSQSENKLESFKIHISQLAKALEDGKDERLH------FEEEKRRLIEG 98

Query: 226 CSKITKEIFELNQSLLKKYPERKAPFMVSTIDAEKYDLQE 265
            S++TK I EL Q +     ER+   +    DA K D+ E
Sbjct: 99  NSQVTKRIIELEQEI---EVERQQKELA---DASKQDIAE 132

>Kwal_27.10433
          Length = 382

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 373 VVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTY--DLITNHGAKNIIKY 430
           ++ S+ + S M+V+  L  T      ++ I   Q+L +   +TY   LI  +  +N I  
Sbjct: 43  LLISNLFNSLMIVSTKLLETDPE--LETPITPLQILVVRMFITYLGTLIYMYWKRNSIGN 100

Query: 431 VPWGPPLETKDYLLRR 446
           VPWGPP E + +L+ R
Sbjct: 101 VPWGPP-EMRKWLILR 115

>Sklu_2302.3 YNL148C, Contig c2302 2208-2942 reverse complement
          Length = 244

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 15/113 (13%)

Query: 124 CGKRLQKRGISNMMLSLTIENSEGTKSLSSTPV--DQIVKETISSVHNILL----PNIIG 177
           C K     GIS   + L IE+++G+K L  +PV  + I+ +T  S   I +     N I 
Sbjct: 27  CKKLYDCTGISPQDMQLEIESNDGSKHLIKSPVKCEGIISDTDYSFKTIFVIDTNENSIA 86

Query: 178 QLESKPINDIAPGYIALKPSALVDNPHEVLYNFS--------NPAYKAQRDQL 222
               + +N+ +     L   A       VL N+         +PAY ++ DQL
Sbjct: 87  NQLREDMNNGSDAEFKLSEKAYQQRTDSVL-NWKKEKKLGKFDPAYASKLDQL 138

>ACL031C [1018] [Homologous to ScYER080W - SH] (309369..311213)
           [1845 bp, 614 aa]
          Length = 614

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 12/115 (10%)

Query: 194 LKPSALVDNPHEVLYNFSNPAYKAQRDQLIENCSKIT---KEIFEL------NQSLLKKY 244
           +KP  L +NP  V Y+     Y  +RD  +EN SK+    K+ +E       NQ L +  
Sbjct: 434 VKPFILHNNPQFVAYD-GPKIYDLERD--VENYSKLNAQEKDQYEFMYKRTRNQYLWESQ 490

Query: 245 PERKAPFMVSTIDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRD 299
             + A  ++S+I      L+   VY +QR   Q++      L+     W+L+ ++
Sbjct: 491 LNQNAKHLISSIAPLVKLLRSPYVYAVQRKYDQEYLLIDEALVQLKEVWELFAKN 545

>YPL264C (YPL264C) [5187] chr16 complement(43283..44344) Protein
           containing two uncharacterized DUF6 domains, has high
           similarity to uncharacterized S. cerevisiae Ymr253p,
           which may be a membrane protein [1062 bp, 353 aa]
          Length = 353

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 372 LVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTY--DLITNHGAKNIIK 429
           L++ S+ + S M+V+  +        ++S I   Q+L +  ++TY   L+  H  K  + 
Sbjct: 19  LLIVSYFFNSSMVVSTKVLENDPLETSQSRINPLQILLVRMSITYCCTLVYMHWNKQSVP 78

Query: 430 YVPWGPPLETKDYLLR 445
            +PWGP    K  +LR
Sbjct: 79  DIPWGPAPCRKWLILR 94

>CAGL0H03047g 285868..288093 weakly similar to sp|P53148
           Saccharomyces cerevisiae YGL093w SPC105 spindle pole
           body protein, start by similarity
          Length = 741

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 48/95 (50%), Gaps = 20/95 (21%)

Query: 216 KAQRDQLIENCSKITKEIFELNQSLLKKYPERKAPFMVSTIDAEKYDLQENGVYELQRIL 275
           + +R QL ++ +  TK++ E+NQS+ K   +RK    ++ +D +K           +R L
Sbjct: 499 QRKRQQLEDDINSKTKQLIEINQSISKVTSKRKT---INPMDIKK-----------ERTL 544

Query: 276 FQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKL 310
              FN   +  +S +G     +R+S D I+ E KL
Sbjct: 545 LANFNLLQA--LSNIGC----IRNSNDIIVLEFKL 573

>Scas_703.34
          Length = 457

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 22/144 (15%)

Query: 309 KLAQENGYKLGLKLVRGAYIHSEKNRNQIIFGDKTGTDENYDRIITQVVNDLIINGEDSY 368
           K ++E+ + L L+ +R     + ++ NQ + G+     +N  +I      DL+   E  Y
Sbjct: 143 KESKEDAFHLALRKLRTRM--NNQDENQSVSGNLALVLDNLTKI-----TDLM---ELPY 192

Query: 369 FGHLVVASHNYQSQMLV---TNLLKSTQ-DNSYAKS-------NIVLGQLLGMADNVTYD 417
                + + +YQ  +++   TN L++   D+S  +S        I    L+G+   ++ +
Sbjct: 193 MARTCIRTGHYQEAVMLYTHTNSLRAKYPDSSIVESICQNVLKEINTTMLMGLVKLLSTN 252

Query: 418 LITNHGAKNIIKYVPWGPPLETKD 441
            IT +  K I+KY+   PP + KD
Sbjct: 253 -ITVNSMKKILKYLAAIPPFDNKD 275

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 43/105 (40%), Gaps = 14/105 (13%)

Query: 324 RGAYIHSEKNRNQIIFGDKTGT--DENYDRIITQVVNDLIINGEDSYFGHLVVASHNYQS 381
           R +Y  SE   ++++         DE +  I+  +  D           H+  ASH+ + 
Sbjct: 76  RSSYTKSEGTTSRLLMACDAAASYDETFQDIVRVIRED-----------HVENASHHIKD 124

Query: 382 QMLVTNLLKSTQDN-SYAKSNIVLGQLLGMADNVTYDLITNHGAK 425
             +   L++ T D     +  +   Q+LG   N T DL+ + G K
Sbjct: 125 AEIRVRLVEQTNDELDQVERYLQASQILGEVSNRTMDLVMSVGEK 169

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,748,285
Number of extensions: 715451
Number of successful extensions: 2447
Number of sequences better than 10.0: 37
Number of HSP's gapped: 2468
Number of HSP's successfully gapped: 37
Length of query: 468
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 363
Effective length of database: 12,961,219
Effective search space: 4704922497
Effective search space used: 4704922497
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)