Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLR009W (RLP24)1991978171e-112
Scas_533.41961977541e-103
CAGL0J00957g1971977531e-103
KLLA0E09416g1981977521e-102
Sklu_1938.51961977491e-102
ADR346W1971447217e-98
Kwal_33.152991961416973e-94
YGR148C (RPL24B)155571609e-14
YGL031C (RPL24A)155571572e-13
Sklu_1642.21491051562e-13
Kwal_14.2299155911545e-13
CAGL0A01562g155911521e-12
AFR477C155911485e-12
KLLA0E10857g155571476e-12
Scas_648.9155901423e-11
Scas_4.166521329e-11
Sklu_1742.468555661.2
KLLA0C11055g54864651.8
CAGL0L12584g29489614.2
CAGL0H04785g67254615.0
CAGL0D03300g24678597.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR009W
         (197 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal...   319   e-112
Scas_533.4                                                            295   e-103
CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomy...   294   e-103
KLLA0E09416g complement(836948..837544) similar to sgd|S0003999 ...   294   e-102
Sklu_1938.5 YLR009W, Contig c1938 7059-7649                           293   e-102
ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH] complement...   282   7e-98
Kwal_33.15299                                                         273   3e-94
YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosoma...    66   9e-14
YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosoma...    65   2e-13
Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement         65   2e-13
Kwal_14.2299                                                           64   5e-13
CAGL0A01562g 152953..153420 highly similar to sp|P24000 Saccharo...    63   1e-12
AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C...    62   5e-12
KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA Kluyv...    61   6e-12
Scas_648.9                                                             59   3e-11
Scas_4.1                                                               55   9e-11
Sklu_1742.4 YGL145W, Contig c1742 3577-5634                            30   1.2  
KLLA0C11055g complement(950647..952293) similar to sp|P38775 Sac...    30   1.8  
CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080 S...    28   4.2  
CAGL0H04785g complement(456705..458723) similar to sp|Q04228 Sac...    28   5.0  
CAGL0D03300g complement(339318..340058) highly similar to sp|Q07...    27   7.6  

>YLR009W (RLP24) [3427] chr12 (166536..167135) Possible ribosomal
           protein with similarity to ribosomal protein L24 [600
           bp, 199 aa]
          Length = 199

 Score =  319 bits (817), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 163/197 (82%), Positives = 163/197 (82%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120

Query: 121 LRDKKLVESNPELLRIREVEIARKLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           LRDKKLVESNPELLRIREVEIARKLAK                                 
Sbjct: 121 LRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQL 180

Query: 181 XKQKILLKNRRRNTKKI 197
            KQKILLKNRRRNTKKI
Sbjct: 181 EKQKILLKNRRRNTKKI 197

>Scas_533.4
          Length = 196

 Score =  295 bits (754), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 160/197 (81%), Gaps = 3/197 (1%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK+FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKSFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTLTFAQRRNVPVRYNREL+ATTLKAM+RIEEIR KRERAFYKNRMRGNKE+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELMATTLKAMSRIEEIRVKRERAFYKNRMRGNKERDF 120

Query: 121 LRDKKLVESNPELLRIREVEIARKLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           LRDKKLVE+NPELLR+REVEIA KLA+                                 
Sbjct: 121 LRDKKLVEANPELLRMREVEIANKLAR---EQERAEMVSEEEEEEEEMDIDSEEEEEEQL 177

Query: 181 XKQKILLKNRRRNTKKI 197
            KQKILLKN++RN+KKI
Sbjct: 178 EKQKILLKNKKRNSKKI 194

>CAGL0J00957g 96608..97201 highly similar to tr|Q07915 Saccharomyces
           cerevisiae YLR009w, start by similarity
          Length = 197

 Score =  294 bits (753), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/197 (75%), Positives = 158/197 (80%), Gaps = 2/197 (1%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIYQCHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAM+RIEEIRQKRERAFYKNRM+GN E+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120

Query: 121 LRDKKLVESNPELLRIREVEIARKLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           LRDKKLVE+NPELLR+REVEIA +LAK                                 
Sbjct: 121 LRDKKLVETNPELLRLREVEIANRLAK--EQAAAEEVSEEESEEEEDMEVDSEEEEEEKL 178

Query: 181 XKQKILLKNRRRNTKKI 197
            KQKILLKN++RN KK+
Sbjct: 179 QKQKILLKNKKRNAKKL 195

>KLLA0E09416g complement(836948..837544) similar to sgd|S0003999
           Saccharomyces cerevisiae YLR009w, start by similarity
          Length = 198

 Score =  294 bits (752), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 159/197 (80%), Gaps = 1/197 (0%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y CHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAM+RIEEIRQ+RERAFYKNRM+GN E+DF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMKGNNERDF 120

Query: 121 LRDKKLVESNPELLRIREVEIARKLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           LRDK LVESNPELLR+REVE+AR+ AK                                 
Sbjct: 121 LRDKALVESNPELLRLREVELARQAAK-EEAIEQASDEEMDIESEAESEVESESEAEEQL 179

Query: 181 XKQKILLKNRRRNTKKI 197
            KQKILLKN+R+N+K+I
Sbjct: 180 QKQKILLKNKRKNSKRI 196

>Sklu_1938.5 YLR009W, Contig c1938 7059-7649
          Length = 196

 Score =  293 bits (749), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 147/197 (74%), Positives = 157/197 (79%), Gaps = 3/197 (1%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSP YP HGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPSHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTLTFAQRRNVPVRYNRELVATTLKAM+RIEEIRQ+RERAFYKNRMRGNKE++F
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKKLVESNPELLRIREVEIARKLAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           LRDK LVESNPELL++REVEIA KLA                                  
Sbjct: 121 LRDKSLVESNPELLKVREVEIANKLA---SKEAEEQDEEMDVDSEEEIDVESEEESEEEQ 177

Query: 181 XKQKILLKNRRRNTKKI 197
            KQK+LLKN+R+N+KKI
Sbjct: 178 EKQKVLLKNKRKNSKKI 194

>ADR346W [2087] [Homologous to ScYLR009W (RLP24) - SH]
           complement(1316666..1317259) [594 bp, 197 aa]
          Length = 197

 Score =  282 bits (721), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 138/144 (95%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MRIY CHFCSSP YPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG
Sbjct: 1   MRIYSCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTLTFAQRRNVPVRYNRELV TTLKAM RIEEIRQKRERAFYKNRM+GN EKDF
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVETTLKAMTRIEEIRQKRERAFYKNRMKGNTEKDF 120

Query: 121 LRDKKLVESNPELLRIREVEIARK 144
           LRDKKLVESNPELL++REVE+ R+
Sbjct: 121 LRDKKLVESNPELLKMREVELQRQ 144

>Kwal_33.15299
          Length = 196

 Score =  273 bits (697), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 125/141 (88%), Positives = 137/141 (97%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           MR+Y CHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHK FKQRRNPRKL+WTKAFRKAAG
Sbjct: 1   MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG 60

Query: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120
           KELAVDSTL FAQRRNVPVRYNRELVATTL+AMAR+EEIRQ+RERAFYKNRMRGNKE++F
Sbjct: 61  KELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQRRERAFYKNRMRGNKEREF 120

Query: 121 LRDKKLVESNPELLRIREVEI 141
           LRDK+LVE NPELL++R+VE+
Sbjct: 121 LRDKQLVERNPELLKVRDVEL 141

>YGR148C (RPL24B) [2103] chr7 complement(787315..787782) Ribosomal
          protein L24B (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Ap [468 bp, 155 aa]
          Length = 155

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK 57
          M++    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>YGL031C (RPL24A) [1943] chr7 complement(437470..437937) Ribosomal
          protein L24A (yeast L30; rp29; YL21; rat L24), nearly
          identical to Rpl24Bp [468 bp, 155 aa]
          Length = 155

 Score = 65.1 bits (157), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK 57
          M++    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  FRK
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRK 57

>Sklu_1642.2 YGR148C, Contig c1642 2421-2870 reverse complement
          Length = 149

 Score = 64.7 bits (156), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 11/105 (10%)

Query: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
           M++    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPRK+ WT  +R+   
Sbjct: 1   MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRKIAWTVLYRRHHK 60

Query: 61  KELAVDSTLTFAQRRN-VPVRYNRELVATTLKAMARIEEIRQKRE 104
           K +    T   A++R+   V+  R +V  +L      E I+Q+R 
Sbjct: 61  KGI----TEEVAKKRSRKTVKAQRAIVGASL------EFIKQRRS 95

>Kwal_14.2299
          Length = 155

 Score = 63.9 bits (154), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSSSLFKQRKNPRRIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKSQRAIVGASL 87

>CAGL0A01562g 152953..153420 highly similar to sp|P24000
          Saccharomyces cerevisiae YGR148c RPL30B or sp|P04449
          Saccharomyces cerevisiae YGL031c RPL30A, start by
          similarity
          Length = 155

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  +  YPG G +FVR D+K FRF  SK    FKQR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAIVGASL 87

>AFR477C [3669] [Homologous to ScYGL031C (RPL24A) - SH; ScYGR148C
          (RPL24B) - SH] (1296295..1296762) [468 bp, 155 aa]
          Length = 155

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  +  YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRN-VPVRYNRELVATTL 90
          K +    T   A++R+   V+  R +V  +L
Sbjct: 61 KGI----TEEVAKKRSRKTVKAQRAVVGASL 87

>KLLA0E10857g 957487..957954 gi|730554|sp|P38665|RL24_KLULA
          Kluyveromyces lactis 60S RIBOSOMAL PROTEIN L24 (L30),
          start by similarity
          Length = 155

 Score = 61.2 bits (147), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK 57
          M++    F  +  YPG G +FVR D+K FRF  SK    F QR+NPR++ WT  +R+
Sbjct: 1  MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRR 57

>Scas_648.9
          Length = 155

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60
          M++    F  +  YPG G +F+R D+K FRF  SK    F QR+NPR++ WT  +R+   
Sbjct: 1  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWTVLYRRHHK 60

Query: 61 KELAVDSTLTFAQRRNVPVRYNRELVATTL 90
          K +  + +    +R    V+  R +V  +L
Sbjct: 61 KGITEEVS---KKRTRKAVKAQRPIVGASL 87

>Scas_4.1
          Length = 66

 Score = 55.5 bits (132), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 1  MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWT 52
          M++    F  +  YPG G +F+R D+K FRF  SK    F QR+NPR++ WT
Sbjct: 3  MKVEIDSFSGNKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRKNPRRVAWT 54

>Sklu_1742.4 YGL145W, Contig c1742 3577-5634
          Length = 685

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 96  IEEIRQKRERAFYKNRMRGNKEKDFLR-----DKKLVESNPELLRIREVEIARKL 145
           I ++  +RER   + R + N+E+DFL      D  LV  + E+ +++ VE  +KL
Sbjct: 29  IGQVNNQRERLALQLRTKKNEEEDFLEHFVLMDVTLVTISEEISKVKSVEDIKKL 83

>KLLA0C11055g complement(950647..952293) similar to sp|P38775
           Saccharomyces cerevisiae YHR045w hypothetical protein
           singleton, start by similarity
          Length = 548

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 49  LKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFY 108
           + W    +      + V ST+ F    +V +   R+L   +L A + +E +R++ E A Y
Sbjct: 2   VDWITFSKYLVAILVIVASTVWFIN--SVIIDSKRDLHTISLNAQSNVESVRKEHETAIY 59

Query: 109 KNRM 112
           +N +
Sbjct: 60  RNLL 63

>CAGL0L12584g complement(1351867..1352751) similar to tr|Q03080
           Saccharomyces cerevisiae YPL039w, hypothetical start
          Length = 294

 Score = 28.1 bits (61), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 11/89 (12%)

Query: 20  MFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRK--AAGKELA---------VDST 68
           + +R   ++++  R K  K  ++ R+PR ++ T    +  A   +LA         + ST
Sbjct: 153 ILIRRSREQYKAIRYKQMKDARRERDPRIIQLTNDMNEDTATMSDLALHNFLEPFDITST 212

Query: 69  LTFAQRRNVPVRYNRELVATTLKAMARIE 97
            TF +R N+       L A+ +  M+R +
Sbjct: 213 FTFTKRNNIGTSAPASLGASMMLNMSRTD 241

>CAGL0H04785g complement(456705..458723) similar to sp|Q04228
           Saccharomyces cerevisiae YML013w, hypothetical start
          Length = 672

 Score = 28.1 bits (61), Expect = 5.0,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 75  RNVPVRYNRELVA--TTLKAMARIEEIRQKRERAFYKNRMRG-NKEKDFLRDKK 125
           +N   RY  EL+   T ++ +    EI+QK+E A+  + M+  NKE+  L+++K
Sbjct: 407 KNTIERYRPELLVSRTDVQELRLAREIKQKQEEAYQNSLMQDRNKEEKRLQEEK 460

>CAGL0D03300g complement(339318..340058) highly similar to sp|Q07953
           Saccharomyces cerevisiae YLR022c, start by similarity
          Length = 246

 Score = 27.3 bits (59), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 30  RFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATT 89
           R+  +  HKA ++      LK+T    K A K  A+D+       + +P+   +  V  T
Sbjct: 128 RYPPTMIHKALQE------LKFTPVINKPA-KTQALDAIRLLVSSQIIPITRAKMKVKLT 180

Query: 90  LKAMARIEEIRQKRERAF 107
           +   +  E+I QK E+ F
Sbjct: 181 INDKSTHEDIIQKMEKLF 198

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,886,340
Number of extensions: 167077
Number of successful extensions: 729
Number of sequences better than 10.0: 33
Number of HSP's gapped: 726
Number of HSP's successfully gapped: 37
Length of query: 197
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 101
Effective length of database: 13,272,781
Effective search space: 1340550881
Effective search space used: 1340550881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)