Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLR008C (PAM18)1681667771e-107
Scas_590.71581664933e-64
Kwal_33.152981711674683e-60
Sklu_1938.41641564664e-60
KLLA0E09438g1631624612e-59
ADR345C1581604587e-59
CAGL0J00935g1531224412e-56
YNL328C (MDJ2)146661491e-12
AGR393W142651472e-12
Scas_716.46144661446e-12
Sklu_2034.5142681437e-12
CAGL0D02552g1431341403e-11
KLLA0E02024g146631369e-11
Kwal_55.22136145631315e-10
Scas_626.3*43861690.32
Sklu_1675.178868632.1
CAGL0K01749g1249104605.0
KLLA0D15081g101039597.1
Kwal_33.1462971958589.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLR008C
         (166 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein ...   303   e-107
Scas_590.7                                                            194   3e-64
Kwal_33.15298                                                         184   3e-60
Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement        184   4e-60
KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyce...   182   2e-59
ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)...   181   7e-59
CAGL0J00935g complement(95878..96339) highly similar to tr|Q0791...   174   2e-56
YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein inv...    62   1e-12
AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH] complement(...    61   2e-12
Scas_716.46                                                            60   6e-12
Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement         60   7e-12
CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces c...    59   3e-11
KLLA0E02024g complement(191062..191502) similar to sp|P42834 Sac...    57   9e-11
Kwal_55.22136                                                          55   5e-10
Scas_626.3*                                                            31   0.32 
Sklu_1675.1 YDR239C, Contig c1675 465-2831 reverse complement          29   2.1  
CAGL0K01749g complement(154556..158305) similar to sp|Q12451 Sac...    28   5.0  
KLLA0D15081g 1271696..1274728 some similarities with sgd|S000631...    27   7.1  
Kwal_33.14629                                                          27   9.0  

>YLR008C (PAM18) [3426] chr12 complement(165576..166082) Protein
           containing a DnaJ domain, which are part of chaperone
           (protein folding) system that mediates interaction with
           heat shock proteins, has high similarity to C. albicans
           Orf6.3647p [507 bp, 168 aa]
          Length = 168

 Score =  303 bits (777), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 151/166 (90%), Positives = 151/166 (90%)

Query: 1   MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY 60
           MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY
Sbjct: 1   MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY 60

Query: 61  MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQIXXXX 120
           MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQI    
Sbjct: 61  MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLT 120

Query: 121 XXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166
                      VHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI
Sbjct: 121 ENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166

>Scas_590.7
          Length = 158

 Score =  194 bits (493), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 96/166 (57%), Positives = 112/166 (67%), Gaps = 10/166 (6%)

Query: 1   MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY 60
           M+  +N  N++E PQL IPG+ +GS  +T+          +     K GMDLYFD+A+ Y
Sbjct: 1   MNDSNNNTNTLEVPQLAIPGEASGSPTMTI----------SQPTSTKNGMDLYFDEAMQY 50

Query: 61  MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQIXXXX 120
           MG HPV+TG  AFLTLY  AG YKSIS  LNGGK+T  FLKGGFD KMN KEALQI    
Sbjct: 51  MGRHPVMTGVAAFLTLYAAAGTYKSISTKLNGGKATATFLKGGFDAKMNQKEALQILNLT 110

Query: 121 XXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166
                      VHRKIMLANHPDKGGSP+LATKINEAKDFLEK+ +
Sbjct: 111 ENKLNMKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKSV 156

>Kwal_33.15298
          Length = 171

 Score =  184 bits (468), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 115/167 (68%), Gaps = 12/167 (7%)

Query: 11  IEAPQLPIPGQ----TNGSANVTV-------DGAGVNVGIQNGSQGQKTGMDLYFDQALN 59
           IEAPQLPIPGQ    TN S+   V       +GA +   I N S  +K GMD  FD AL 
Sbjct: 4   IEAPQLPIPGQAGVDTNTSSQEPVWSGAGGAEGAEMVGKIANASN-EKGGMDQAFDDALA 62

Query: 60  YMGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQIXXX 119
           +MG+HPV++GFG FL LYF AGA+KS+S+ L GG +TT + KGGFDPKMN KEA+QI   
Sbjct: 63  FMGQHPVLSGFGGFLGLYFAAGAFKSVSRALGGGAATTQYAKGGFDPKMNVKEAMQILNL 122

Query: 120 XXXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166
                       VHR+IMLANHPDKGGSP+LATKINEAKDFLEKRG+
Sbjct: 123 NENSLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGV 169

>Sklu_1938.4 YLR008C, Contig c1938 6198-6692 reverse complement
          Length = 164

 Score =  184 bits (466), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 103/156 (66%)

Query: 11  IEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEHPVITGF 70
            + PQLPIPG  N      V  +       N +  Q +GMDLYFDQAL+ MG+HPV+TG 
Sbjct: 7   FDVPQLPIPGADNSRLQEPVALSNATPITTNPAPSQPSGMDLYFDQALDVMGQHPVLTGI 66

Query: 71  GAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQIXXXXXXXXXXXXXX 130
           G F TLYF AGAY+S+S  L G      FLKGGFDPKMN+ EALQI              
Sbjct: 67  GGFFTLYFLAGAYRSVSTKLGGNTGAAKFLKGGFDPKMNAGEALQILNLNESTLTKKKLK 126

Query: 131 XVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166
            VHR+IMLANHPDKGGSP+LATKINEAKDFLEKRGI
Sbjct: 127 EVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGI 162

>KLLA0E09438g 838259..838750 similar to sgd|S0003998 Saccharomyces
           cerevisiae YLR008c, start by similarity
          Length = 163

 Score =  182 bits (461), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 95/162 (58%), Positives = 110/162 (67%), Gaps = 10/162 (6%)

Query: 10  SIEAPQLPIPGQTNGS---ANVTV--DGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEH 64
           +IE PQLPIPG+ N +     V +    AGV    Q     QK+GMDLYFDQAL+YMG+H
Sbjct: 5   NIEVPQLPIPGEDNSNRVPEQVVIGHPAAGVPPIPQ-----QKSGMDLYFDQALDYMGDH 59

Query: 65  PVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQIXXXXXXXX 124
           PV+TG G F  LYF AGAYKS+SK L G      +LKGGFDPKMN+KEAL I        
Sbjct: 60  PVLTGVGGFFALYFAAGAYKSVSKRLGGSSQGVKYLKGGFDPKMNAKEALAILNLNETNL 119

Query: 125 XXXXXXXVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166
                  VHR+IMLANHPDKGGSP+LATKINEAKDFLEK+ +
Sbjct: 120 SKKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKKVV 161

>ADR345C [2086] [Homologous to ScYLR008C - SH] (1315746..1316222)
           [477 bp, 158 aa]
          Length = 158

 Score =  181 bits (458), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 89/160 (55%), Positives = 109/160 (68%), Gaps = 11/160 (6%)

Query: 10  SIEAPQLPIPGQTNGS---ANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNYMGEHPV 66
           +IE PQLPIPG+ N +     + ++ A V          QK GMDLYFD+ ++++GEHPV
Sbjct: 5   TIEIPQLPIPGEDNSAHPAQQIRLEQAAV--------PQQKRGMDLYFDKVVDFVGEHPV 56

Query: 67  ITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQIXXXXXXXXXX 126
           + G G F+ LY  AG ++++S  +NGGK  T FLKGGFDPKMN+KEAL I          
Sbjct: 57  VGGIGGFVALYAAAGLWRAVSIRMNGGKEATKFLKGGFDPKMNTKEALAILNLTESTLTK 116

Query: 127 XXXXXVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGI 166
                VHRKIMLANHPDKGGSP+LATKINEAKDFLEKRGI
Sbjct: 117 KRVKDVHRKIMLANHPDKGGSPYLATKINEAKDFLEKRGI 156

>CAGL0J00935g complement(95878..96339) highly similar to tr|Q07914
           Saccharomyces cerevisiae YLR008c, start by similarity
          Length = 153

 Score =  174 bits (441), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 90/122 (73%)

Query: 45  GQKTGMDLYFDQALNYMGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGF 104
           G K GMDLYFD AL YMGEHPV+ G G FL LY  AG YK +   LNGGK+ T FLKGGF
Sbjct: 29  GSKQGMDLYFDNALQYMGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGF 88

Query: 105 DPKMNSKEALQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEAKDFLEKR 164
           DPKMN+KEALQI               VHRKIMLANHPDKGGSP+LATKINEAKDFLEK+
Sbjct: 89  DPKMNAKEALQILNLKENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKK 148

Query: 165 GI 166
           GI
Sbjct: 149 GI 150

>YNL328C (MDJ2) [4287] chr14 complement(22834..23274) Protein
           involved in import and folding of mitochondrial
           proteins, has similarity to E. coli DnaJ and other
           DnaJ-like proteins, function partially overlaps that of
           Mdj1p [441 bp, 146 aa]
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 101 KGGFDPKMNSKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPFLATKINEA 157
           +GGF P+M   EAL I               +   HRK M+ NHPD+GGSP++A KINEA
Sbjct: 74  QGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDRGGSPYMAAKINEA 133

Query: 158 KDFLEK 163
           K+ LE+
Sbjct: 134 KEVLER 139

>AGR393W [4704] [Homologous to ScYNL328C (MDJ2) - SH]
           complement(1451330..1451758) [429 bp, 142 aa]
          Length = 142

 Score = 61.2 bits (147), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 102 GGFDPKMNSKEA---LQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEAK 158
           GGF  +MN  EA   LQI                HR+ ML NHPDKGGSP++A KINEA+
Sbjct: 73  GGFYKRMNEVEAMLILQITGDEIKLLDRNMLKKKHRRAMLLNHPDKGGSPYVAMKINEAR 132

Query: 159 DFLEK 163
           D +E+
Sbjct: 133 DVMEQ 137

>Scas_716.46
          Length = 144

 Score = 60.1 bits (144), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 101 KGGFDPKMNSKEA---LQIXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEA 157
           +GGF P M   EA   L I                HR  M+ NHPDKGGSP+LATKINEA
Sbjct: 72  QGGFYPTMTESEAILILDISSKDIKKLDEKLLKRKHRGAMILNHPDKGGSPYLATKINEA 131

Query: 158 KDFLEK 163
           ++ LE+
Sbjct: 132 REVLER 137

>Sklu_2034.5 YNL328C, Contig c2034 7065-7493 reverse complement
          Length = 142

 Score = 59.7 bits (143), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 102 GGFDPKMNSKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPFLATKINEAK 158
           GGF  +M   EAL I               +   HR+ ML NHPDKGGSP+LA KINEA+
Sbjct: 70  GGFYSRMTETEALLILGISSEEIEHLNATMLKRKHRRAMLQNHPDKGGSPYLAMKINEAR 129

Query: 159 DFLEKRGI 166
           + LE RGI
Sbjct: 130 ETLE-RGI 136

>CAGL0D02552g 261991..262422 similar to sp|P42834 Saccharomyces
           cerevisiae YNL328c MDJ2 heat shock protein - chaperone,
           start by similarity
          Length = 143

 Score = 58.5 bits (140), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 59/134 (44%), Gaps = 35/134 (26%)

Query: 65  PVITGFGAFLTLYFTAGA------YKSISKGL----NGGKST-------TAF-------- 99
           P+I G G  L  + T  A      Y++++ G+    NG K T       + F        
Sbjct: 4   PIIIGVGVTLVAWTTQSALRAWQIYRTLTPGMIAAMNGIKLTNFRSKYASKFHSDRLNPG 63

Query: 100 -------LKGGFDPKMNSKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPF 149
                   +GGF   M+  EAL I               +   HR  ML NHPDKGGSP+
Sbjct: 64  LKMQLNKWEGGFYHPMSESEALMILNITQKEIMSLNAPLLKKKHRLAMLKNHPDKGGSPY 123

Query: 150 LATKINEAKDFLEK 163
           L+ KINEAK+ LEK
Sbjct: 124 LSAKINEAKELLEK 137

>KLLA0E02024g complement(191062..191502) similar to sp|P42834
           Saccharomyces cerevisiae YNL328c MDJ2 heat shock protein
           - chaperone singleton, start by similarity
          Length = 146

 Score = 57.0 bits (136), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 102 GGFDPKMNSKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPFLATKINEAK 158
           GGF  KM+  EAL I               +   HR+ M+ NHPDKGGSPF+A+KIN+A+
Sbjct: 73  GGFYDKMSETEALLILGISAREIEALDERLLRQKHRRAMIMNHPDKGGSPFIASKINQAR 132

Query: 159 DFL 161
           D L
Sbjct: 133 DLL 135

>Kwal_55.22136
          Length = 145

 Score = 55.1 bits (131), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 102 GGFDPKMNSKEALQIXXXXXXXXXXXXXXXV---HRKIMLANHPDKGGSPFLATKINEAK 158
           GGF  KM   EAL I               +   HR+ ++ NHPD+GGSP+LA KINEA+
Sbjct: 75  GGFSSKMTDSEALLILGISGSEVAALDENLLKRKHRQAIVHNHPDRGGSPYLALKINEAR 134

Query: 159 DFL 161
           D L
Sbjct: 135 DIL 137

>Scas_626.3*
          Length = 438

 Score = 31.2 bits (69), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 58  LNYMGEHPVITGFGAFLTLY--FTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQ 115
           L+YMG+   ITG  AFLT Y  FTAG+    S  L+   S    L   +  ++++K A+ 
Sbjct: 190 LSYMGDVLTITGKKAFLTYYPLFTAGSLSDYSMNLSQFSSLVTDLP-DYTARLSTKLAVL 248

Query: 116 I 116
           +
Sbjct: 249 V 249

>Sklu_1675.1 YDR239C, Contig c1675 465-2831 reverse complement
          Length = 788

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 3/68 (4%)

Query: 48  TGMDLYFDQALNYMGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPK 107
           TG  L   + +   G+ P   G    +T YFT  A +  S  L+G    T+ L+   D K
Sbjct: 671 TGRKLNESETIRSSGKRP---GRSDTVTSYFTRNASRLRSGTLDGDYDYTSQLRTALDSK 727

Query: 108 MNSKEALQ 115
             S E L+
Sbjct: 728 EPSNEGLK 735

>CAGL0K01749g complement(154556..158305) similar to sp|Q12451
            Saccharomyces cerevisiae YDL019c, start by similarity
          Length = 1249

 Score = 27.7 bits (60), Expect = 5.0,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 39/104 (37%), Gaps = 8/104 (7%)

Query: 64   HPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAF-LKGGFDPKMNSKEAL-------Q 115
            +P +  +G  +    T G Y  +     G +S++A+ +KG    K N K  +        
Sbjct: 1036 NPQVDNYGEVVITNHTTGDYCKLYFKARGWRSSSAYEVKGEVFDKDNKKHWVLGGHWHDS 1095

Query: 116  IXXXXXXXXXXXXXXXVHRKIMLANHPDKGGSPFLATKINEAKD 159
            I                H+K   A  P + GS FL  K+N   D
Sbjct: 1096 IYAKHVNGKDKDEIALDHKKTHTATEPTRDGSKFLVWKVNPRPD 1139

>KLLA0D15081g 1271696..1274728 some similarities with sgd|S0006319
           Saccharomyces cerevisiae YPR115w, hypothetical start
          Length = 1010

 Score = 27.3 bits (59), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 33  AGVNVGIQNGS-----QGQKTGMDLYFDQALNYMGEHPV 66
           AG NVG+ +G+      G+  G+DLY D   +++ E+P 
Sbjct: 86  AGANVGVGSGAGASANAGKAEGLDLYDDGTASFVREYPT 124

>Kwal_33.14629
          Length = 719

 Score = 26.9 bits (58), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 25/58 (43%)

Query: 38  GIQNGSQGQKTGMDLYFDQALNYMGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKS 95
           GI+N   G+      + D +L Y   H + +   +  T  F     + ISK ++  KS
Sbjct: 165 GIKNYCNGKSHFGGEHLDPSLEYESHHSIFSSLSSKNTYQFNKADQECISKKISNNKS 222

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,931,090
Number of extensions: 182029
Number of successful extensions: 380
Number of sequences better than 10.0: 23
Number of HSP's gapped: 374
Number of HSP's successfully gapped: 23
Length of query: 166
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 72
Effective length of database: 13,342,017
Effective search space: 960625224
Effective search space used: 960625224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 57 (26.6 bits)