Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLL018C-A (COX19)98985262e-71
CAGL0D06578g86813534e-45
Scas_347.289853519e-45
Sklu_2189.295823519e-45
KLLA0D03971g99903501e-44
ADL041C99823284e-41
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLL018C-A
         (98 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protei...   207   2e-71
CAGL0D06578g 625655..625915 no similarity, hypothetical start         140   4e-45
Scas_347.2                                                            139   9e-45
Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement      139   9e-45
KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyce...   139   1e-44
ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH] (617549....   130   4e-41

>YLL018C-A (COX19) [3400] chr12 complement(108675..108971) Protein
          that may function in metal transport required for
          cytochrome oxidase assembly, localizes to the
          mitochondrial intermembrane space and to the cytoplasm
          [297 bp, 98 aa]
          Length = 98

 Score =  207 bits (526), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60
          MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL
Sbjct: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60

Query: 61 RCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK 98
          RCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK
Sbjct: 61 RCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK 98

>CAGL0D06578g 625655..625915 no similarity, hypothetical start
          Length = 86

 Score =  140 bits (353), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (87%)

Query: 2  SGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYLR 61
          SGNPG +L AL PTPPERGSFPLDHDGEC +YMQ+YL+CM+L  NENA NCRLLAKDYL+
Sbjct: 3  SGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRLAANENAHNCRLLAKDYLK 62

Query: 62 CRMDHQLMDYDEWSHLGLPED 82
          CRMDHQLMD DEW +LGLP D
Sbjct: 63 CRMDHQLMDKDEWKNLGLPPD 83

>Scas_347.2
          Length = 89

 Score =  139 bits (351), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (85%)

Query: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60
          MSGNPGSSL AL PTPPERGSFPLDHD EC + M  YL+CM+LV+ +NA NCRLLAK+YL
Sbjct: 1  MSGNPGSSLRALSPTPPERGSFPLDHDNECFQQMSAYLECMKLVKGQNAPNCRLLAKEYL 60

Query: 61 RCRMDHQLMDYDEWSHLGLPEDAPG 85
          +CRMDHQLMD D+WSHLGLP D+P 
Sbjct: 61 QCRMDHQLMDVDDWSHLGLPGDSPA 85

>Sklu_2189.2 YLL018C-A, Contig c2189 4754-5041 reverse complement
          Length = 95

 Score =  139 bits (351), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 63/82 (76%), Positives = 75/82 (91%)

Query: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60
          MSGNPG+SL AL PTPPERGSFPLDHDGEC+K MQ+YL+C++LV+ ENA NCRLLAK+YL
Sbjct: 1  MSGNPGNSLRALSPTPPERGSFPLDHDGECSKQMQDYLQCIKLVRGENAPNCRLLAKNYL 60

Query: 61 RCRMDHQLMDYDEWSHLGLPED 82
          +CRMD+QLMD DEW +LGLP+D
Sbjct: 61 KCRMDNQLMDRDEWKNLGLPDD 82

>KLLA0D03971g 334691..334990 similar to sgd|S0007245 Saccharomyces
          cerevisiae YLL018ca COX19, start by similarity
          Length = 99

 Score =  139 bits (350), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%)

Query: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60
          MS NPG+SL AL PTPPERGSFPLDHDG+CTK MQEYL C++LV+ ENA NCRLLAK+YL
Sbjct: 1  MSANPGNSLKALSPTPPERGSFPLDHDGDCTKQMQEYLSCIKLVKGENAPNCRLLAKEYL 60

Query: 61 RCRMDHQLMDYDEWSHLGLPEDAPGNNGKT 90
          +CRMD++LMD D+W HLGLP D    N  T
Sbjct: 61 KCRMDNKLMDRDDWKHLGLPSDKKEANDVT 90

>ADL041C [1700] [Homologous to ScYLL018C-A (COX19) - SH]
          (617549..617848) [300 bp, 99 aa]
          Length = 99

 Score =  130 bits (328), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 59/82 (71%), Positives = 70/82 (85%)

Query: 1  MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL 60
          MSGNP S+L AL PTP ERG FPLDH+GECT +M EYL CM+LV+ ENA NCRLL ++YL
Sbjct: 1  MSGNPVSALHALSPTPSERGLFPLDHEGECTAHMMEYLNCMKLVRGENAPNCRLLVRNYL 60

Query: 61 RCRMDHQLMDYDEWSHLGLPED 82
          +CRMDH+LMD DEW+HLGLP+D
Sbjct: 61 KCRMDHRLMDRDEWAHLGLPDD 82

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,934,309
Number of extensions: 148475
Number of successful extensions: 277
Number of sequences better than 10.0: 9
Number of HSP's gapped: 277
Number of HSP's successfully gapped: 9
Length of query: 98
Length of database: 16,596,109
Length adjustment: 69
Effective length of query: 29
Effective length of database: 14,207,467
Effective search space: 412016543
Effective search space used: 412016543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)