Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLL002W (RTT109)43642922800.0
Scas_629.204404419911e-131
CAGL0D05786g4234339521e-126
KLLA0F12914g4304329301e-122
Kwal_33.151954284359011e-118
AAL173C4204337511e-95
Scas_714.4492133740.44
Sklu_2121.2756113730.63
KLLA0C17688g48930664.6
Scas_673.27241492649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLL002W
         (429 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved ...   882   0.0  
Scas_629.20                                                           386   e-131
CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces c...   371   e-126
KLLA0F12914g complement(1190220..1191512) similar to sgd|S000392...   362   e-122
Kwal_33.15195                                                         351   e-118
AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..3952...   293   1e-95
Scas_714.4                                                             33   0.44 
Sklu_2121.2 YLL029W, Contig c2121 3265-5535                            33   0.63 
KLLA0C17688g complement(1565906..1567375) gi|9836828|gb|AAG00316...    30   4.6  
Scas_673.27                                                            29   9.4  

>YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved in
           resistance to mutagens such as diepoxybutane and
           mitomycin C [1311 bp, 436 aa]
          Length = 436

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/429 (100%), Positives = 429/429 (100%)

Query: 1   MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK 60
           MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK
Sbjct: 1   MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK 60

Query: 61  VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL 120
           VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL
Sbjct: 61  VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL 120

Query: 121 QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT 180
           QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT
Sbjct: 121 QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT 180

Query: 181 CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA 240
           CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA
Sbjct: 181 CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA 240

Query: 241 KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE 300
           KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE
Sbjct: 241 KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE 300

Query: 301 DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA 360
           DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA
Sbjct: 301 DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA 360

Query: 361 IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASNINTLA 420
           IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASNINTLA
Sbjct: 361 IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASNINTLA 420

Query: 421 ITMLKPRKK 429
           ITMLKPRKK
Sbjct: 421 ITMLKPRKK 429

>Scas_629.20
          Length = 440

 Score =  386 bits (991), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 206/441 (46%), Positives = 286/441 (64%), Gaps = 26/441 (5%)

Query: 2   SLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPN-KDDKRVPKSTIKTQHFFSLFHQGK 60
           +L++ L+SVLP    FE L LQ  P +TH +VTP     +R    T+K QHFF+LFH  K
Sbjct: 8   TLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQERADTLTVKIQHFFTLFHNKK 67

Query: 61  VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL 120
             F+LE+YVY+TL       +LIFVSKADT+GYC+ ++ + DITK+ L++++S+DP +YL
Sbjct: 68  AVFALEIYVYLTL-SSLHNTKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDPLHYL 126

Query: 121 QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT 180
           +KVKP +R        LI   ++  R+LRILA R+  S          P   Q+    + 
Sbjct: 127 RKVKP-LRRVNDHDESLIRKGTSVERSLRILAVRVDLS----------PHPCQNTDKFYI 175

Query: 181 CPREI------LTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECF 234
              ++      +TKICLFTRPA  YLF  SSKN+KKH LNG++L+KWW  I+D L+   F
Sbjct: 176 TRNDVGGDTNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDF 235

Query: 235 Q-NDTQAKLRIPGEDPARV-RSYLRG--MKYPLWQVGDIFTSKENSLAVYNIPLFPDDPK 290
             N+  A+LR+PGED  RV R+YL G   +   WQVGDIF    N LAV+++PLFPDDPK
Sbjct: 236 DPNNVSARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPK 295

Query: 291 ARFIHQLAEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVI 350
           +RFI  L +E+R++K +L ++W+ELQERQEFKLSV  SV+G+ G++   P   P+  ++ 
Sbjct: 296 SRFIRHLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYLPNDREIF 355

Query: 351 VPKSRKQFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQP 410
           +  SR+QFR I+ Y+ GEEYD EEG +E++ N+RD+L LR +  L  L+G RE   R +P
Sbjct: 356 ICSSRRQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSGTREPEIR-KP 414

Query: 411 VPASNINTLAI--TMLKPRKK 429
           V AS     AI  T+L+PRKK
Sbjct: 415 VVASTTKRSAIPVTLLQPRKK 435

>CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces
           cerevisiae YLL002w REM50 drug resistance, start by
           similarity
          Length = 423

 Score =  371 bits (952), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 199/433 (45%), Positives = 275/433 (63%), Gaps = 17/433 (3%)

Query: 3   LNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGKVF 62
           L   L  VLP    FE L LQS P E+  +V  N   K+   +TIKT+H F L ++G++F
Sbjct: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLV--NNTSKQNRATTIKTEHLFCLAYKGRIF 59

Query: 63  FSLEVYVYVTLWDEAD---AERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYY 119
           + LE+YVY+T   + +    ERL+FVSKADTNGYC+ RV+++ +T  ++ ++LSI+P+YY
Sbjct: 60  YGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINPDYY 119

Query: 120 LQKVKPAIRSYKKIS-PELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLS 178
           L +V P  R YKK     LI+ A+   + L+ILA RL+         +  P      Y  
Sbjct: 120 LHRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHN------LIEPEIFNAFYTK 173

Query: 179 FTCPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQ-ND 237
           F   +E++TKI LFTRPA QYLFP+SSKN  KH L+G+ L+KWW  +LD LL+  F  N 
Sbjct: 174 FHSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNK 233

Query: 238 TQAKLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQL 297
           T+AK+RIPGED  R R Y   +K  +W  GDIF+  ++   +  IP+FPDDPK+RF+ QL
Sbjct: 234 TKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQL 293

Query: 298 AEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISG-YSLATPSLFPSSADVIVPKSRK 356
            EE+R+   SL +FW ELQERQEFKLSV  SVMGISG Y + T   +  S DV   +S++
Sbjct: 294 FEENRIQTTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTN--YKPSTDVYRCRSKR 351

Query: 357 QFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPASNI 416
           QF  IK YITGEEYDTEEGA+E++ N+ D+ L R  T+L ++TG  ++ +  Q    ++ 
Sbjct: 352 QFHCIKNYITGEEYDTEEGALESYQNVNDY-LSREGTSLLTVTGNADYSKFKQNRTTTST 410

Query: 417 NTLAITMLKPRKK 429
             +  T+   RKK
Sbjct: 411 PVVVNTLQVRRKK 423

>KLLA0F12914g complement(1190220..1191512) similar to sgd|S0003925
           Saccharomyces cerevisiae YLL002w REM50 drug resistance,
           start by similarity
          Length = 430

 Score =  362 bits (930), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 275/432 (63%), Gaps = 19/432 (4%)

Query: 1   MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKST---IKTQHFFSLFH 57
           MSL  ++   LP   +FE ++LQSIP ET  +  P ++ + V   T   IKTQHF +L  
Sbjct: 1   MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF 60

Query: 58  QGKVFFSLEVYVYVTL--WDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSID 115
           + KV F+LE+ VY +L   +    ERL+FVSKADTNGYC+ R+ +  ITK I+ +IL+I 
Sbjct: 61  EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS 120

Query: 116 PNYYLQKVKPAIRSYKKIS-PELISAASTPARTLRILARR-LKQSGSTVLKEIESPRFQQ 173
           P +YL+ VKP IR  K +S  ++I  +++  R L IL+ R L   G T   +I      Q
Sbjct: 121 PGHYLRAVKPLIR--KALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIP----DQ 174

Query: 174 DLYLSFTCPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIEC 233
           DLY+SF  P EI+TK+ LFTR   QYLF +SSKN +KH+L+G++L+KWW  I+D++++E 
Sbjct: 175 DLYVSFPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVED 234

Query: 234 FQNDTQAKLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARF 293
           F N T+A L+IPGE+   + +YLR   Y  W VGDIF+     +A+Y IPLFPDDPK RF
Sbjct: 235 FDNKTKATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRF 294

Query: 294 IHQLAEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPK 353
           +  L  + R+ KV++ +FW ELQ RQEF+L  T SV+G+SG  +   +  P   D+I+P 
Sbjct: 295 LDHLISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNE-PERTDIIIPT 353

Query: 354 SRKQFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPA 413
           S+K F+ +K YITGEEYDTEEGA EA+ NIRD   +  +T +  + G   H+      P 
Sbjct: 354 SKKNFKNLKNYITGEEYDTEEGAEEAYMNIRDIFDMHYSTKMIKVIGN-HHKIATTKRPE 412

Query: 414 SN----INTLAI 421
            N    INTL++
Sbjct: 413 INTINVINTLSV 424

>Kwal_33.15195
          Length = 428

 Score =  351 bits (901), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 270/435 (62%), Gaps = 19/435 (4%)

Query: 2   SLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGKV 61
           SL   L  VLP   + E   LQS P ET+ VV P+       +  +K QHFF L    K+
Sbjct: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQANG-KQQVVKIQHFFGLCTDNKL 63

Query: 62  FFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYLQ 121
           F+ LEV+VYV +      ++++F+SKADTNGYC  R+S+++ITK ++E++ S+DP YYL 
Sbjct: 64  FYGLEVFVYVVVQHSKVVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDPLYYLV 123

Query: 122 KVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSF-T 180
           KV P  R+ +  +   I+ ++T  R L+I+  R   +G T   +I       +LY  F  
Sbjct: 124 KVIPMNRTRQNYA-NAITKSTTTKRALQIIRNR-HTAGKTSTPDIS------NLYTQFEK 175

Query: 181 CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA 240
           C      KICLFTR    YLF +SSKN +KHIL+GE+L+ WW  ++D +L + F +DT+A
Sbjct: 176 CDPGWTCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDTKA 235

Query: 241 KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE 300
           +L+IPGE+      YL G K+P W+VGDIF S+ N LA++ IP+FPDDPK RF+ QL +E
Sbjct: 236 RLQIPGEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLVDE 295

Query: 301 DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA 360
           +R  KV ++ FW ELQ +QEF++  T +V+GI G  +A P + P   ++I+PKS K F  
Sbjct: 296 NRAKKVQVTGFWTELQIQQEFRMGATVAVIGIDG-RVANPCIMPRECEIILPKSIKAFNM 354

Query: 361 IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTG-----KREHRER--NQPVPA 413
           IK YITGEEYDT +GA EA  NIRDF+ LR+  +L  + G       EH     +  +P 
Sbjct: 355 IKTYITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQGTLKTSTSEHGGHVDHSRLPV 414

Query: 414 SNINTLAITMLKPRK 428
           +++NT ++   KPR+
Sbjct: 415 NHLNT-SLIRKKPRR 428

>AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..39527)
           [1263 bp, 420 aa]
          Length = 420

 Score =  293 bits (751), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 171/433 (39%), Positives = 234/433 (54%), Gaps = 20/433 (4%)

Query: 1   MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKSTIKTQHFFSLFHQGK 60
           M L + L+  LP    F+ L LQS   E      P  +      +TI  QHFF+L +  K
Sbjct: 1   MGLKELLAEALPAGHDFDVLHLQSPATER----PPLTEASGCSPTTIAAQHFFTLSNNSK 56

Query: 61  VFFSLEVYVYVTLWDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSIDPNYYL 120
           VF++L+V VY+ + +    +R++FVSKADTNGYC+ RV VR  T+ +L+F+LSIDP++YL
Sbjct: 57  VFYALQVVVYICI-EGTSGDRMLFVSKADTNGYCDVRVDVRRATRALLQFLLSIDPSHYL 115

Query: 121 QKVKPAIRSYKKISPELISAASTPARTLRILARRLKQSGSTVLKEIESPRFQQDLYLSFT 180
           Q+V+  +R        LI+ A+     LRILA+R +     V    +  R     Y SF 
Sbjct: 116 QRVR-RMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRAR-----YTSFP 169

Query: 181 CPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIECFQNDTQA 240
           CP +  T++ LFTR    YLF +S++N  KH+L G+ L++WW   +D LL+  F   T A
Sbjct: 170 CPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFDPATDA 229

Query: 241 KLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARFIHQLAEE 300
            L IPGED A    YLR +++P W+VG +F       A+  IP FPDDPK RF+  LA E
Sbjct: 230 ALLIPGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLDDLAHE 289

Query: 301 DRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPKSRKQFRA 360
            R    SL +FW EL  RQEF+L V   V+G +G     P   P+  D++ P S   +  
Sbjct: 290 GR--NPSLRAFWTELVARQEFRLGVVVGVVGAAGLYTG-PCARPAPEDLLCPASPADYVH 346

Query: 361 IKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPV------PAS 414
           +K Y+T EEY T  GA EA  N+ D LLLR    +  + G      R  P       PA 
Sbjct: 347 VKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATKRPAV 406

Query: 415 NINTLAITMLKPR 427
           N  T      KPR
Sbjct: 407 NDLTARCVRKKPR 419

>Scas_714.4
          Length = 492

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 6/133 (4%)

Query: 274 ENSLAVYNIPLFPDDPKARFIHQLAEEDR-LLKVSLSSFWIELQERQEFKLSVTSSVMGI 332
           ++ LA+    L  D      I +L +  + LLK+   +  ++ +  Q+F+ +  S ++ +
Sbjct: 131 DSDLAIAGRVLVSDKKTGNIISRLVDLKKPLLKIPTLAIHLDREVNQKFEFNKESQLLPV 190

Query: 333 SGYSLATPSLFPSSADVIVPKSRKQFRAIKKYITGE-----EYDTEEGAIEAFTNIRDFL 387
           +G S    +      D     S +QF +IK  I        E   EE +I++  +I DF 
Sbjct: 191 AGLSKEETNTKDKGCDHNEKMSEEQFSSIKSIIERHHERLLELVAEELSIDSVDSIEDFE 250

Query: 388 LLRMATNLQSLTG 400
           L+    N   L G
Sbjct: 251 LILYDNNPSCLGG 263

>Sklu_2121.2 YLL029W, Contig c2121 3265-5535
          Length = 756

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 45/113 (39%), Gaps = 22/113 (19%)

Query: 284 LFPDDPKARFIHQLAEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLF 343
           LF DDP    I Q  EE+++   S SS W  L                      +T +  
Sbjct: 381 LFTDDPYNDKIKQYFEENKITVKSYSSIWEALS---------------------STATTL 419

Query: 344 PSSADVIVPKSRKQFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQ 396
             S D I+  +   +  I+K + G  Y   +  +E F  +++ L +R A + Q
Sbjct: 420 SKSNDTILVPNNSSWEVIRK-LEGARYKQVQSPVEIFKAVKNELEIRNARSAQ 471

>KLLA0C17688g complement(1565906..1567375)
           gi|9836828|gb|AAG00316.1|AF207744_1 Kluyveromyces lactis
           tRNA nucleotidyltransferase, start by similarity
          Length = 489

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 8/30 (26%)

Query: 210 KHILNGEELMK--------WWGFILDRLLI 231
           KHI+NG+EL K        W G  LDR+LI
Sbjct: 436 KHIINGKELAKLLDRKPGIWMGETLDRILI 465

>Scas_673.27
          Length = 2414

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 334  GYSLATPSLFPSSADVIVPKS--RKQFRAIKKYITGEEYDT--EEGAIEAFTNIRDFLLL 389
            G+   T  +   + D+++P +   + FR     IT EE     EE   E  T  R  L+L
Sbjct: 2311 GFDFPTEKILKET-DIVLPSTPPNELFR--NGIITSEEASKLEEERQAELRTG-RGLLVL 2366

Query: 390  RMATNLQSLTGKREHRERNQPVPASNINTLAI 421
            R  T  + LTG   HRER+  VP + +N L I
Sbjct: 2367 RRIT--EKLTGCDVHRERDLDVP-TQVNKLII 2395

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,890,304
Number of extensions: 594711
Number of successful extensions: 1630
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1642
Number of HSP's successfully gapped: 17
Length of query: 429
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 325
Effective length of database: 12,995,837
Effective search space: 4223647025
Effective search space used: 4223647025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)