Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YLL001W (DNM1)75774438390.0
CAGL0D05808g77678228570.0
KLLA0F12892g77576427750.0
Kwal_33.1520077376327520.0
AAL174C75676127070.0
Scas_690.2075575827060.0
ABL001W68573914240.0
YKR001C (VPS1)70454813371e-175
Kwal_26.792469154013321e-175
CAGL0L02299g70054213301e-174
Scas_668.2872255613301e-174
Sklu_2326.469054313221e-173
KLLA0B13277g68454712411e-161
ACR164C8682604309e-44
CAGL0L02783g8912614272e-43
YOR211C (MGM1)9022654273e-43
KLLA0D06721g8832614263e-43
Sklu_1555.28842604254e-43
Kwal_26.86138613284228e-43
Scas_605.178912614122e-41
YOR165W (SEY1)77628740.89
AGR264C79128731.4
YOR373W (NUD1)851129721.6
Sklu_2179.478228712.2
Sklu_2412.71127132703.0
Sklu_2434.1157721693.3
AFR077W792115693.4
CAGL0L02629g79573693.9
KLLA0E09229g16038655.2
Scas_707.829453666.9
Kwal_23.595694040677.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YLL001W
         (744 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related pro...  1483   0.0  
CAGL0D05808g 552040..554370 highly similar to sp|P54861 Saccharo...  1105   0.0  
KLLA0F12892g complement(1187526..1189853) similar to sp|P54861 S...  1073   0.0  
Kwal_33.15200                                                        1064   0.0  
AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988...  1047   0.0  
Scas_690.20                                                          1046   0.0  
ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH] complement(3...   553   0.0  
YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar ...   519   e-175
Kwal_26.7924                                                          517   e-175
CAGL0L02299g 264035..266137 highly similar to sp|P21576 Saccharo...   516   e-174
Scas_668.28                                                           516   e-174
Sklu_2326.4 YKR001C, Contig c2326 6273-8345                           513   e-173
KLLA0B13277g 1165743..1167797 highly similar to sp|P21576 Saccha...   482   e-161
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...   170   9e-44
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...   169   2e-43
YOR211C (MGM1) [5004] chr15 complement(738924..741632) Periphera...   169   3e-43
KLLA0D06721g complement(578072..580723) similar to sp|P32266 Sac...   168   3e-43
Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement         168   4e-43
Kwal_26.8613                                                          167   8e-43
Scas_605.17                                                           163   2e-41
YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in...    33   0.89 
AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)...    33   1.4  
YOR373W (NUD1) [5148] chr15 (1036830..1039385) Spindle pole body...    32   1.6  
Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement         32   2.2  
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          32   3.0  
Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement      31   3.3  
AFR077W [3269] [Homologous to ScYKR029C (SET3) - SH; ScYJL105W (...    31   3.4  
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    31   3.9  
KLLA0E09229g complement(827035..827517) similar to sgd|S0002268 ...    30   5.2  
Scas_707.8                                                             30   6.9  
Kwal_23.5956                                                           30   7.3  

>YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related
           protein that controls morphology and cortical
           localization of mitochondria [2274 bp, 757 aa]
          Length = 757

 Score = 1483 bits (3839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/744 (98%), Positives = 730/744 (98%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWG 120
           VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWG
Sbjct: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWG 120

Query: 121 EFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGIT 180
           EFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGIT
Sbjct: 121 EFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGIT 180

Query: 181 KVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTI 240
           KVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTI
Sbjct: 181 KVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTI 240

Query: 241 GVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRK 300
           GVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRK
Sbjct: 241 GVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRK 300

Query: 301 HPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATT 360
           HPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATT
Sbjct: 301 HPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATT 360

Query: 361 NESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTS 420
           NESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTS
Sbjct: 361 NESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTS 420

Query: 421 NLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHK 480
           NLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHK
Sbjct: 421 NLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHK 480

Query: 481 CGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM 540
           CGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM
Sbjct: 481 CGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM 540

Query: 541 DDIMKTRRKRNQELLKSKLSQQENGQXXXXXXXXXXXXXXDQDSAKNSDYDDDGIDAESK 600
           DDIMKTRRKRNQELLKSKLSQQENGQ              DQDSAKNSDYDDDGIDAESK
Sbjct: 541 DDIMKTRRKRNQELLKSKLSQQENGQTNGINGTSSISSNIDQDSAKNSDYDDDGIDAESK 600

Query: 601 QTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRNLQISDFSLGDIDDLENAEP 660
           QTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRNLQISDFSLGDIDDLENAEP
Sbjct: 601 QTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRNLQISDFSLGDIDDLENAEP 660

Query: 661 PLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKET 720
           PLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKET
Sbjct: 661 PLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKET 720

Query: 721 LFEELLVEDQTLAQDRELCVKSLG 744
           LFEELLVEDQTLAQDRELCVKSLG
Sbjct: 721 LFEELLVEDQTLAQDRELCVKSLG 744

>CAGL0D05808g 552040..554370 highly similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 776

 Score = 1105 bits (2857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/782 (72%), Positives = 644/782 (82%), Gaps = 59/782 (7%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISPNSPLIEEDDNSV----NPHDEVTKISGFE---------------- 100
           VTRRPLVLQLNNIS +SPLI+E+ + +    N     + ++GF+                
Sbjct: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQNNNESTTSLNDNNGAS 120

Query: 101 ---AGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKI 157
               G+   E R       DEWGEFLHIPG+RFYDF +I+REIE+ETARIAGK+KGISKI
Sbjct: 121 SAIGGSNATEIR------RDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKI 174

Query: 158 PINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPAN 217
           PINLK++SPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDY+ATPNC+ILAVSPAN
Sbjct: 175 PINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPAN 234

Query: 218 VDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRS 277
           VDLVNSESLKLAREVDP G RTIGVITKLDLMDSGTNALDILSGK+YPLKLGFVGVVNRS
Sbjct: 235 VDLVNSESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRS 294

Query: 278 QQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKT 337
           QQDIQ+NKTVEE+L+KEE+YF +HPVYRT+S +CGTRYLAKLLNQTL+SHI++KLPDIKT
Sbjct: 295 QQDIQMNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKT 354

Query: 338 KLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCG 397
           +LNTLISQTEQEL++YG  G  T E+RA LVLQLMNKF+T FISSIDGTSS+I+TKEL G
Sbjct: 355 RLNTLISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSG 414

Query: 398 GARIYYIYNNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIK 457
           GARIYYIYNN+FGN+LKSIDPT+NL++LD+RTAIRNSTGPRPTLFVPELAFDLLVKPQIK
Sbjct: 415 GARIYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIK 474

Query: 458 LLLEPSQRCVELVYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVES 517
           LLLEPSQ+CVELVYEEL+KICHKCG+ EL+RYPKLKS LIEV+S+LLRERL PTRSYVES
Sbjct: 475 LLLEPSQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVES 534

Query: 518 LIDIHRAYINTNHPNFLSATEAMDDIMKTRRKRNQE-------LLKSKLSQ-QENGQXXX 569
           LIDIHRAYINTNHPNFL+AT+AM DI+++ RKRNQE       L K K ++ QENG    
Sbjct: 535 LIDIHRAYINTNHPNFLTATDAMSDIIQS-RKRNQENQRAQKMLEKEKQNEIQENG---- 589

Query: 570 XXXXXXXXXXXDQDSAKNSDYDDDGIDAESK----QTKDKFLNYFFGKDKKGQPVFDASD 625
                       Q+S  + +   DG + +S     ++KD FLNYFFGKDKK Q      D
Sbjct: 590 ---------TASQNSKSDIEPSIDGTELDSSKDATKSKDTFLNYFFGKDKKSQLSLSNRD 640

Query: 626 KKRS-IAG--DGNIEDFRNLQISDFSLGDIDDLENA-EPPLTEREELECELIKRLIVSYF 681
            + S + G  D     F+ L  +     D D  ENA  P LTERE+LECELI+RLIVSYF
Sbjct: 641 GRFSELNGYKDDFSSQFQQLNFNSNLNSDDDAFENANHPKLTEREDLECELIRRLIVSYF 700

Query: 682 DIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVK 741
           DI+REMIEDQ+PKA+MCLLVN+CKDSVQNRLVT+LY+E++FEELLVEDQTL QDRE  +K
Sbjct: 701 DIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALK 760

Query: 742 SL 743
           SL
Sbjct: 761 SL 762

>KLLA0F12892g complement(1187526..1189853) similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 775

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/764 (70%), Positives = 614/764 (80%), Gaps = 24/764 (3%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHAD--- 117
           VTRRPLVLQLNNI PNSPL+   DNS +   E           K +      R +++   
Sbjct: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120

Query: 118 ----EWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTL 173
               EWGEFLHIPG+RFYDF +I+REIENETARIAGK+KGIS+IPINLK++SPHVLNLTL
Sbjct: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180

Query: 174 VDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVD 233
           VDLPGITKVPIGEQPPDIE+QI+NLIL+Y+A PNC+ILA+SPANVDLVNSESLKLARE+D
Sbjct: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240

Query: 234 PQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDK 293
           P GKRTIGVITKLDLMD GTNALDILSGK+YPLKLGFVGVVNRSQQDIQ NK+VEE+L+ 
Sbjct: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300

Query: 294 EEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARY 353
           EE +F KHPVYRTIST+CGTRYLAKLLNQ L++HIRDKLPDIK +LNTLI QTEQELA Y
Sbjct: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360

Query: 354 GGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSL 413
           G     T E+RA LVLQLMNKF+T FISSIDGTSS+I+TKELCGGARIYYIYN +FG SL
Sbjct: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420

Query: 414 KSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEE 473
             I+PTSNLS+ D+RTAIRNSTGPRP+LFVPELAFDLLVKPQI+LLL+PSQRCVELVYEE
Sbjct: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480

Query: 474 LMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNF 533
           LMKICH CGS ELARYPKL+S L+EV+SELLRERL PTRSYVESLIDIH+AYINTNHPNF
Sbjct: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540

Query: 534 LSATEAMDDIMKTRRKRNQ--------ELLKSKLSQQENGQXXXXXXXXXXXXXX----D 581
            SATEAM +I++ R+ + Q        E  K  L +Q+  +                  D
Sbjct: 541 PSATEAMAEIVEARKNKKQTERLQKQREYEKQLLLEQQQAEREMKKSDSVDETEQDLKLD 600

Query: 582 QDSAKNSDYDDDGIDAESKQTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRN 641
            DS   S++D +  + + KQ+KD FLNYFFGK++K      +S  +    G  N  D  N
Sbjct: 601 SDSTATSEHDSEE-ENDMKQSKDSFLNYFFGKEQKSSNTKLSS--RIDYNGSDNSYDIEN 657

Query: 642 LQISDF--SLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCL 699
           LQI DF     D      A    TEREELECELI+RLIVSYF I+REMIEDQVPKAVMCL
Sbjct: 658 LQIQDFKDKSADAHTKSEAATEFTEREELECELIRRLIVSYFSIVREMIEDQVPKAVMCL 717

Query: 700 LVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSL 743
           LVNY K+SVQNRLVTKLYKE+LF+ELL+EDQTLAQDRE CV  L
Sbjct: 718 LVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLL 761

>Kwal_33.15200
          Length = 773

 Score = 1064 bits (2752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/763 (70%), Positives = 622/763 (81%), Gaps = 24/763 (3%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GIDTLDLP+LAV+GSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVN-PHDEVTKISGFEAGTKPLEYRGKERNHADEW 119
           VTRRPLVLQLNNI+P+SPLI + D   + P D  +            + +G E    DEW
Sbjct: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDHESVPEELTLEDHLRKNQGLEPQGKDEW 120

Query: 120 GEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGI 179
           GEFLH+PG+RFY+F DI++EIENETARIAGK+KGIS+IPINLKVFSP VLNLTLVDLPGI
Sbjct: 121 GEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTLVDLPGI 180

Query: 180 TKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRT 239
           TKVPIGEQP DIEKQIKNLIL+Y+A PNC+ILAVSPANVDLVNSESLKLAR+VDP GKRT
Sbjct: 181 TKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 240

Query: 240 IGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFR 299
           IGVITK+DLMDSGTNALDILSGK+YPL+LGFVG+VNRSQQDIQ N+TVEE+L+ EE +F 
Sbjct: 241 IGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNNEEAFFS 300

Query: 300 KHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGAT 359
           +HPVYRTIST+CGTRYLAKLLNQ L++HIRDKLPDIK +LNTL+ QTEQEL  YGG+G  
Sbjct: 301 RHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTYGGLGII 360

Query: 360 TNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPT 419
           T E+RA LVLQLMNKF+  FISSI+GTSSDI+TKELCGGARIYYIYN++FG+SL+SI+PT
Sbjct: 361 TKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSLESINPT 420

Query: 420 SNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICH 479
           +NLS  D+RTAIRNSTGPRP+LFVPELAFDLLVKPQI LLLEPSQRCVELVYEELMKICH
Sbjct: 421 ANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEELMKICH 480

Query: 480 KCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEA 539
            CGS ELARYPKL++ LIEV+SELLRERL PTRSYVESLIDIHRAYINTNHPNFLSATEA
Sbjct: 481 NCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNFLSATEA 540

Query: 540 MDDIMKTRR-------KRNQELLKSKLSQQEN--GQXXXXXXXXXXXXXXDQDSAKNSD- 589
           M DI + +R       K+N +L + KLS   +   +                ++A N+D 
Sbjct: 541 MSDIAEAKRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKADSGNTAFNNDS 600

Query: 590 YDDDGIDAESKQTKDKFLNYFFGKDK------KG---QPVFDASDKKRSIAGDGNIEDFR 640
             +D   A  KQ+KD FLNYFFGKD+      KG      F   ++        ++ +F 
Sbjct: 601 SSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQTEHQKHLANFE 660

Query: 641 NLQISDFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLL 700
           NL+ISD     + +  N  P LTERE+LECELI+RLIVSYF I+REMI+DQ+PKAVMCLL
Sbjct: 661 NLKISD----PVVEERNDTPQLTEREQLECELIRRLIVSYFGIVREMIQDQIPKAVMCLL 716

Query: 701 VNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSL 743
           VN+ K+ +QNRLVTKLYKE+LFE+LL+EDQ LAQDR+ CVK L
Sbjct: 717 VNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLL 759

>AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988)
           [2271 bp, 756 aa]
          Length = 756

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/761 (69%), Positives = 614/761 (80%), Gaps = 37/761 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHA-DEW 119
           VTRRPLVLQLNNI  +SPLI             T  +  EA    LE R + ++ A D W
Sbjct: 61  VTRRPLVLQLNNIKADSPLI-------------TAYTAEEA-EPTLENRLRGQSGARDTW 106

Query: 120 GEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGI 179
           GEFLH+PG+RFYDF +I+ EIENETARIAGK+KGIS+IPINLK++SPHVLNLTL+DLPGI
Sbjct: 107 GEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDLPGI 166

Query: 180 TKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRT 239
           TKVPIGEQPPDIE+QI+NLIL+Y+A PNC+ILAVSPANVDLVNSESLKLAR+VDP GKRT
Sbjct: 167 TKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPHGKRT 226

Query: 240 IGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFR 299
           IGV+TKLDLMDSGTNA DIL+GK+YPL+LGFVGVVNRSQQDIQ NK+VE++L +EE++F 
Sbjct: 227 IGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAREEEFFS 286

Query: 300 KHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGAT 359
           KHP YRTIS+KCGTR+LAK LNQ LL+HIR+KLPDIK +LNTLI QTEQELA YGG    
Sbjct: 287 KHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASYGGSNII 346

Query: 360 TNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPT 419
           + ESRA LVLQ+MNKF+TNF+SSI+GTSSDI+TKELCGGARIYYIYNN+FGNSLKSI+PT
Sbjct: 347 SPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSLKSINPT 406

Query: 420 SNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICH 479
           +NLS+ D+RTAIRNSTGPRP+LFVPELAFDLLVKPQIKLLL+PSQRCVELVYEELMKICH
Sbjct: 407 ANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEELMKICH 466

Query: 480 KCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEA 539
            CGS  LARYP+L++ LIEV+S+LLRERL PTRSYVESLIDIHRA+INTNHPNFLSATEA
Sbjct: 467 NCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNFLSATEA 526

Query: 540 MDDIMKTRR------KRNQELLKSKLSQQENGQXXXXXXXXXXXXXXDQDSAKNSDYDDD 593
           M DI + RR      KR+ +L K +  + E                 D DS   S   + 
Sbjct: 527 MADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVDSDSTITSSDSEG 586

Query: 594 GIDAESKQTKDKFLNYFFGKDKKGQ------PVFDASDKKRS-----IAGDGNIEDFRNL 642
             + + KQ KD FLNYFFGKD++ +      P F  SDK+          + +      L
Sbjct: 587 EDERDPKQNKDSFLNYFFGKDQQRKDGDDIAPSF--SDKQERTMDSFFQQEADFMAMETL 644

Query: 643 QISDFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVN 702
           +I D     +   E   P LTEREELECELI+RLI+SYF I+REM+EDQ+PKAVMC LVN
Sbjct: 645 KIQDTVAAPV---EAEHPELTEREELECELIRRLIISYFGIVREMVEDQIPKAVMCFLVN 701

Query: 703 YCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSL 743
           +CK+ VQNRLV+KLYKE+LFEELL+ED+TLAQDR  C+K L
Sbjct: 702 FCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLL 742

>Scas_690.20
          Length = 755

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/758 (69%), Positives = 615/758 (81%), Gaps = 32/758 (4%)

Query: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60
           MASLEDLIPTVNKLQDVMY SGIDTLDLPILAVVGSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNISPNSPLIEEDDNS-VNP---HDEVTKISGFEAGTKPLE--YRGKERN 114
           VTRRPLVLQLNN+  +S    E+  S  NP       TK +  E     +E    G+  N
Sbjct: 61  VTRRPLVLQLNNLPKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTNN 120

Query: 115 ---HADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNL 171
              H  EWGEFLHIPG+RFYDF++I+REIENETAR+AGK+KGISK+PINLK+FSPHVLNL
Sbjct: 121 NQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLNL 180

Query: 172 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLARE 231
           TLVDLPGITKVPIGEQPPDIEKQIKNLILDY+ATPNCLILAVSPANVDLVNSESLKLARE
Sbjct: 181 TLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLARE 240

Query: 232 VDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESL 291
           VDP GKRTIGVITKLDLMDSGTNALDILSGK+YPLK GFVG+VNRSQQDIQLNK+V+E+L
Sbjct: 241 VDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEAL 300

Query: 292 DKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELA 351
           + EE+YF++HP+YRTIS KCGTRYLAKLLN+ L++HI+DKLPDIKTKLNTL++QTEQEL 
Sbjct: 301 NNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQELY 360

Query: 352 RYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGN 411
            YGG   +T E+RA+L+LQLMNKF+T+FISSI+G SSDINTKELCGGARIYYIYNNVFG 
Sbjct: 361 SYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFGK 420

Query: 412 SLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVY 471
           SLKSIDPT+NL+ +D+RTAIRNSTGPRPTLFVPE AFDLLV+PQ+ LLLEPSQRCVELVY
Sbjct: 421 SLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELVY 480

Query: 472 EELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHP 531
           EELMKICH CGS EL RYP+LKSMLIEV+ +LL+ERL PTR YVESLIDIH+AYINTNHP
Sbjct: 481 EELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNHP 540

Query: 532 NFLSATEAMDDIMKTRRKRNQELLKSK--LSQQENGQXXXXXXXXXXXXXXDQDSAKNSD 589
           +FL ATEA  DIMK+ ++R  +  K+   ++++ENG                  S++ + 
Sbjct: 541 SFLKATEAYSDIMKSNQERKDKENKNTEVITEKENGSDR-------------SSSSEETG 587

Query: 590 YDD--DGIDAESKQTKDKFLNYFFGKDKKGQP--VFDASDKKRSIAGDGNIEDFRNLQIS 645
           Y D  + I  E+ ++K  F + FF  +K+     + + S     I  D N     NL I+
Sbjct: 588 YIDGKNNISKEADESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGSLLGNLHIT 647

Query: 646 DFSLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCK 705
           + S    D     EP L+ERE+LECELI+RLI+SYF IIREMIEDQ+PKA+M  LVNYCK
Sbjct: 648 ENSQTTYD----LEPHLSEREQLECELIRRLIISYFGIIREMIEDQIPKAIMFFLVNYCK 703

Query: 706 DSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSL 743
           +SVQNRLVTKLYKE++ EELLVEDQT+AQDR  C + L
Sbjct: 704 ESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLL 741

>ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH]
           complement(395835..397892) [2058 bp, 685 aa]
          Length = 685

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/739 (41%), Positives = 439/739 (59%), Gaps = 77/739 (10%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRG+GIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGSGIV 62

Query: 62  TRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGE 121
           TRRPLVLQL N         +  +  N H ++      E      +  G+  ++A+EWGE
Sbjct: 63  TRRPLVLQLINRR------GKKGDKRNAHGDL-----LELDVAADQKTGQSEDNAEEWGE 111

Query: 122 FLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITK 181
           FLH PGK+FY+FD I++EI NET ++ GK+ GIS IPINL+++SPHVL LTLVDLPG+TK
Sbjct: 112 FLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLTLTLVDLPGLTK 171

Query: 182 VPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIG 241
           VP+G+QP DIE QIKN+I+ YI+ PN +ILAV+ AN DL NS+ LKLAREVDP+G RTIG
Sbjct: 172 VPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKLAREVDPEGTRTIG 231

Query: 242 VITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKH 301
           V+TK+DLMD GT+ +DILSG++ PL+ G+V V+NR Q+DI+  KT+ E+L+ E+ +F  H
Sbjct: 232 VLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKTIREALNDEKRFFENH 291

Query: 302 PVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTN 361
           P Y + +  CGT YLAK LN  LL HIR  LP+IK K+   + + + EL     +G  T 
Sbjct: 292 PSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLKKYQAELL---ALGPETL 348

Query: 362 ESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSN 421
           +S  S+VL ++  FS  +   +DG + +++++EL GGARI ++++ +F   + ++DP   
Sbjct: 349 DSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIFKGGVYALDPFDQ 408

Query: 422 LSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKC 481
           +   D+RT + NS+G  P+LFV   AF++LVK QI+   +PS R V L+++EL++I  + 
Sbjct: 409 IKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSLRLVALIFDELVRILREI 468

Query: 482 GS-AELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM 540
            S  + ARYP L+  +     + L+ER+ P   +V  +I   + YINT HP+ L  ++AM
Sbjct: 469 ISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQTYINTAHPDLLKGSQAM 528

Query: 541 DDIMKTRRKRNQELLKSKLSQQENGQXXXXXXXXXXXXXXDQDSAKNSDYDDDGIDAESK 600
             +        +E L  K    + G+                 + +++D    GI     
Sbjct: 529 AMV--------EERLHPKQVDPKTGKSL-------------PPTVQHTDKGSSGI----- 562

Query: 601 QTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRNLQISDFSLGDIDDLENAEP 660
                F  +F  K+KK     +A        G                            
Sbjct: 563 -----FGGFFASKNKKKLTALEAPPSVLKATGQ--------------------------- 590

Query: 661 PLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKET 720
            +TERE LE E+IK LI SYF I++  + D +PKAVM  L+   K+ +Q  L+ KLY   
Sbjct: 591 -MTERETLETEVIKLLIESYFSIVKRTVADLIPKAVMLKLIVKSKNDIQKILLEKLYGNQ 649

Query: 721 LFEELLVEDQTLAQDRELC 739
             EEL  E+    Q R+ C
Sbjct: 650 DIEELTKENDITIQRRKEC 668

>YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar
           sorting protein, member of the dynamin family of GTPases
           [2115 bp, 704 aa]
          Length = 704

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 260/548 (47%), Positives = 371/548 (67%), Gaps = 21/548 (3%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISP--------NSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKER 113
           TRRPLVLQL N  P        N    E  D ++N  D+    SG        +  G+  
Sbjct: 63  TRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKH------QNEGQSE 116

Query: 114 NHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTL 173
           ++ +EWGEFLH+PGK+FY+FD+I++EI  ET ++ G + GIS +PINL+++SPHVL LTL
Sbjct: 117 DNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTL 176

Query: 174 VDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVD 233
           VDLPG+TKVP+G+QPPDIE+QIK+++L YI+ PN +IL+V+ AN DL NS+ LKLAREVD
Sbjct: 177 VDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVD 236

Query: 234 PQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDK 293
           P+G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+  KT+ E+L+ 
Sbjct: 237 PEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALEN 296

Query: 294 EEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARY 353
           E  +F  HP Y + +  CGT YLAK LN  LL HIR  LP+IK K+   + + + EL   
Sbjct: 297 ERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELI-- 354

Query: 354 GGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSL 413
             +G  T +S +S+VL ++  FS  +   +DG + +++++EL GGARI Y+++  F N +
Sbjct: 355 -NLGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGV 413

Query: 414 KSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEE 473
            S+DP   +   D+RT + NS+G  P+LFV   AF++LVK QI+   EPS R V LV++E
Sbjct: 414 DSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDE 473

Query: 474 LMKICHKCGS-AELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPN 532
           L+++  +  S  + +RYP L+  +     + L++   PT  +V  +I   + YINT HP+
Sbjct: 474 LVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPD 533

Query: 533 FLSATEAM 540
            L  ++AM
Sbjct: 534 LLKGSQAM 541

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 48/80 (60%)

Query: 662 LTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETL 721
           +TERE +E E+IK LI SYF I++  I D +PKA+M  L+   K  +Q  L+ KLY +  
Sbjct: 610 MTERETMETEVIKLLISSYFSIVKRTIADIIPKALMLKLIVKSKTDIQKVLLEKLYGKQD 669

Query: 722 FEELLVEDQTLAQDRELCVK 741
            EEL  E+    Q R+ C K
Sbjct: 670 IEELTKENDITIQRRKECKK 689

>Kwal_26.7924
          Length = 691

 Score =  517 bits (1332), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 258/540 (47%), Positives = 368/540 (68%), Gaps = 18/540 (3%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVG+QSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALISTINKLQDALAPLGGGSQSPIDLPQITVVGTQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGE 121
           TRRPLVLQL N            +S     + +K    E G +  +  G+  ++ DEWGE
Sbjct: 63  TRRPLVLQLVN----------KRSSKGNTSQSSKNDLLELGNQE-QKGGQSEDNVDEWGE 111

Query: 122 FLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITK 181
           FLH+PGK+F++FD+I++EI NET +  GK+ GIS +PINLK+ SPHVL LTLVDLPG+TK
Sbjct: 112 FLHLPGKKFFNFDEIRQEIVNETEKTTGKNAGISPVPINLKICSPHVLTLTLVDLPGLTK 171

Query: 182 VPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIG 241
           VP+G+QP DIEKQIK+++L YI+ PN +IL+V+ AN DL NS+ LKLAREVDP+G RTIG
Sbjct: 172 VPVGDQPADIEKQIKDMLLRYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIG 231

Query: 242 VITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKH 301
           V+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI++ KT+  +L+ E  YF  H
Sbjct: 232 VLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKTIRAALEDERRYFENH 291

Query: 302 PVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTN 361
           P Y + +  CGT YLAK LN  LL HIR  LPDIK K+   + + + EL     +G  T 
Sbjct: 292 PSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELTLKKYQAELM---SLGPETM 348

Query: 362 ESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSN 421
           +S  S++L ++  FS  +   +DG + +++++EL GGARI ++++ ++ N ++++DP   
Sbjct: 349 DSPNSIILSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIYKNGVRALDPFDQ 408

Query: 422 LSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKC 481
           +   D+RT + NS+G  P+LFV   AF++LVK QI    EPS R V LV++EL++I  + 
Sbjct: 409 IKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQINRFEEPSLRLVSLVFDELVRILKQI 468

Query: 482 GS-AELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM 540
            S  +  RYP L+  +     + L+E + PT S+V  +I   + YINT HP+ L  ++AM
Sbjct: 469 ISQPKYGRYPGLREAMSNYFIQFLKEAIIPTNSFVTDIIQAEQTYINTAHPDLLKGSQAM 528

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 48/80 (60%)

Query: 662 LTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETL 721
           +TERE +E E+IK LI SYF+I++  + D +PKAVM  L+   K+ +Q  L+ KLY    
Sbjct: 597 MTERETMETEVIKLLIESYFNIVKRTVADVIPKAVMLKLIVKSKNDIQKILLEKLYGNQD 656

Query: 722 FEELLVEDQTLAQDRELCVK 741
             EL  E+    Q R+ C K
Sbjct: 657 IAELTKENDITIQRRKECHK 676

>CAGL0L02299g 264035..266137 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1, start by
           similarity
          Length = 700

 Score =  516 bits (1330), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/542 (47%), Positives = 371/542 (68%), Gaps = 13/542 (2%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTK--PLEYRGKERNHADEW 119
           TRRPLVLQL N        + D       D++  ++  +   K  P   +G+  ++A+EW
Sbjct: 63  TRRPLVLQLINRRSK----KSDKEVQKASDQLLDLNMDDHSKKEDPAGKKGQSEDNAEEW 118

Query: 120 GEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGI 179
           GEFLH+P K+FY+FD+I+ EI  ET ++ G + GIS IPINL+++SPHVL LTLVDLPG+
Sbjct: 119 GEFLHLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINLRIYSPHVLTLTLVDLPGL 178

Query: 180 TKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRT 239
           TKVP+G+QPPDIEKQIK+++L YI+ PN +IL+V+ AN DL NS+ LKLAREVDP+G RT
Sbjct: 179 TKVPVGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRT 238

Query: 240 IGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFR 299
           IGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+  KT+  +L  E+ +F 
Sbjct: 239 IGVLTKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIRAALQDEKKFFE 298

Query: 300 KHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGAT 359
           +HP Y + +  CGT YLAK LN  LL HIR  LPDIK K+ + + +   EL     +G  
Sbjct: 299 EHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIESTLKKYVNELE---SLGPE 355

Query: 360 TNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPT 419
           T +S +S+VL ++  FS  +   +DG + ++ ++EL GGARI ++++ +F N + S+DP 
Sbjct: 356 TMDSASSIVLSMITDFSNEYTGILDGEAKELTSQELSGGARISFVFHEIFKNGVDSLDPF 415

Query: 420 SNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICH 479
             +   D+RT + NS+G  P+LFV   AF++LVK QI+   EPS R V LV++EL+++  
Sbjct: 416 DQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLK 475

Query: 480 KCGS-AELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATE 538
           +  S  + ARYP L+  +     + L+E + PT  +V+ +I   + YINT HP+ L  ++
Sbjct: 476 QIISQPKYARYPALREAISTQFIDYLKEAIVPTNEFVQDIIKSEQTYINTAHPDLLKGSQ 535

Query: 539 AM 540
           AM
Sbjct: 536 AM 537

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 48/78 (61%)

Query: 662 LTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETL 721
           +TERE +E E+IK LI SYF+I++  I D VPKA+M  L+   K+ +Q  L+ KLY    
Sbjct: 606 MTERETMETEVIKLLINSYFNIVKRTIADLVPKALMLKLIVKSKNDMQKVLLQKLYGNQD 665

Query: 722 FEELLVEDQTLAQDRELC 739
            +EL  E+    Q R+ C
Sbjct: 666 IDELTKENDITIQRRKEC 683

>Scas_668.28
          Length = 722

 Score =  516 bits (1330), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 265/556 (47%), Positives = 374/556 (67%), Gaps = 25/556 (4%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGF----------EAGTKPLEYRGK 111
           TRRPLVLQL  I+  S   +E     N  ++V+K              EA       +G+
Sbjct: 63  TRRPLVLQL--INRRSKKEKEAAPQANTKNDVSKQLLDLDLQDDADKKEAPASDKTKKGE 120

Query: 112 E------RNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFS 165
           +       ++A+EWGEFLH+PGK+F++FD+I++EI  ET ++ G + GIS IPINL+++S
Sbjct: 121 KGATSQSEDNAEEWGEFLHLPGKKFFNFDEIRQEIVRETEKVTGTNVGISSIPINLRIYS 180

Query: 166 PHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSES 225
           P+VL LTLVDLPG+TKVP+G+QPPDIEKQIKN++L YI+ PN +IL+V+ AN DL NS+ 
Sbjct: 181 PYVLTLTLVDLPGLTKVPVGDQPPDIEKQIKNMLLKYISKPNAIILSVNAANTDLANSDG 240

Query: 226 LKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNK 285
           LKLAREVDP+G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+  K
Sbjct: 241 LKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEGKK 300

Query: 286 TVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQ 345
           T+  +L+ E+ +F +HP Y + +  CGT YLAK LN  LL HIR  LPDIK K+   + +
Sbjct: 301 TIRSALEDEKRFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIENTLKK 360

Query: 346 TEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIY 405
            + EL     +G  T +S  S+VL ++  FS  +   +DG + ++ ++EL GGARI +++
Sbjct: 361 YQNELI---SLGPETMDSSNSIVLSMITDFSNEYSGILDGEAKELTSQELSGGARISFVF 417

Query: 406 NNVFGNSLKSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQR 465
           + VF N + S+DP   +   D+RT + NS+G  P+LFV   AF++LVK QIK   EPS R
Sbjct: 418 HEVFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIKRFEEPSLR 477

Query: 466 CVELVYEELMKICHK-CGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRA 524
            V LV++EL++I  +     + ARYP L+  +     + L+E + PT  +V  +ID  + 
Sbjct: 478 LVNLVFDELVRILKQIITQPKYARYPALREAISNEFIDFLKESMIPTNKFVTDIIDAEQT 537

Query: 525 YINTNHPNFLSATEAM 540
           YINT HP+ L  + AM
Sbjct: 538 YINTAHPDLLKGSRAM 553

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%)

Query: 672 LIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETLFEELLVEDQT 731
           +IK LI SYF I++  + D +PKA+M  L+   +  +Q  L+ KLY     ++L  E++ 
Sbjct: 638 VIKLLIESYFGIVKRTVADIIPKALMLKLIVKSRTDIQKVLLEKLYSSGQLKDLTKENEL 697

Query: 732 LAQDRELC 739
             Q R+ C
Sbjct: 698 TIQRRKEC 705

>Sklu_2326.4 YKR001C, Contig c2326 6273-8345
          Length = 690

 Score =  513 bits (1322), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 258/543 (47%), Positives = 373/543 (68%), Gaps = 17/543 (3%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGE 121
           TRRPLVLQL N        ++D    +  +E+  ++  +      + +G+  ++A+EWGE
Sbjct: 63  TRRPLVLQLINKR-----TKKDSTLQSAKNELLDLNVADD-----QKKGQSEDNAEEWGE 112

Query: 122 FLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITK 181
           FLHIPGK+FY+FD I++EI  ET +  GK+ GIS IPINL+++SPHVL LTLVDLPG+TK
Sbjct: 113 FLHIPGKKFYNFDQIRQEIVIETEKTTGKNAGISPIPINLRIYSPHVLTLTLVDLPGLTK 172

Query: 182 VPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIG 241
           VP+G+QP DIEKQIK+++L YI+ PN +IL+V+ AN DL NS+ LKLAREVDP+G RTIG
Sbjct: 173 VPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIG 232

Query: 242 VITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKH 301
           V+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+ +KT+  +L+ E+ +F  H
Sbjct: 233 VLTKVDLMDHGTDVIDILAGRVIPLRYGYIPVINRGQKDIEAHKTIRAALEDEKKFFENH 292

Query: 302 PVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTN 361
           P Y + +  CGT YLAK LN  LL HIR  LP+IK K+   + + + EL     +G  T 
Sbjct: 293 PSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKNKIEVTLKKYQAELL---SLGPETM 349

Query: 362 ESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSIDPTSN 421
           +S  S+VL ++  FS  +   +DG + +++++EL GGARI ++++ +F N + ++DP   
Sbjct: 350 DSPNSIVLSMITDFSKEYTGILDGEARELSSQELSGGARISFVFHEIFKNGVNALDPFDQ 409

Query: 422 LSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKC 481
           +   D+RT + NS+G  P+LFV   AF++LVK QI+   EPS R V LV++EL++I  + 
Sbjct: 410 IKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIRRFEEPSLRLVSLVFDELVRILKQI 469

Query: 482 GS-AELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNFLSATEAM 540
            S  + +RYP L+  L     + L+E + PT  +V  +I   + YINT HP+ L  ++AM
Sbjct: 470 ISHPKYSRYPGLREALSNYFVQFLKEAIIPTNEFVLDVIRSEQTYINTAHPDLLKGSQAM 529

Query: 541 DDI 543
             +
Sbjct: 530 ATV 532

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (58%)

Query: 662 LTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETL 721
           +TERE +E E+IK LI SYF I++  + D +PKA+M  L+   K+ +Q  L+ KLY    
Sbjct: 596 MTERETMETEVIKLLIDSYFGIVKRTVADIIPKAIMLKLIVKSKNDIQKILLEKLYGNQD 655

Query: 722 FEELLVEDQTLAQDRELCVK 741
             EL  E+    Q R+ C K
Sbjct: 656 IAELTKENDITIQRRKECHK 675

>KLLA0B13277g 1165743..1167797 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1 member of the
           dynamin family of GTPases, start by similarity
          Length = 684

 Score =  482 bits (1241), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 251/547 (45%), Positives = 359/547 (65%), Gaps = 34/547 (6%)

Query: 5   EDLIPTVNKLQDVMYDSGIDT---LDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  +   +DLP + VVGSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   ERLIATINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN-------ISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERN 114
           TRRPL+LQL N             L++ D+++ N                     G+  +
Sbjct: 63  TRRPLILQLINRRVKKETKHATEELLDLDNSAAN--------------------GGQNED 102

Query: 115 HADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLV 174
           +A+EWGEF H+PGK+ ++F++I++EI  ET +  GK+ GIS +PI L+V+SPHVL LTLV
Sbjct: 103 NAEEWGEFGHLPGKKLFNFNEIRKEIVLETDKSTGKNAGISAVPITLRVYSPHVLTLTLV 162

Query: 175 DLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDP 234
           DLPG+TKVP+G+QP DIE+QIK++IL YI  PN +ILAV+PAN DL NS+ LKLAREVDP
Sbjct: 163 DLPGLTKVPVGDQPADIERQIKDMILTYIKKPNAIILAVNPANADLANSDGLKLAREVDP 222

Query: 235 QGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKE 294
            G RTIGV+TK+DLMD GT+ +DIL+G++ PLK G++ V+NR Q+DI+ NKT+  +L+ E
Sbjct: 223 DGSRTIGVLTKVDLMDEGTDVIDILAGRVIPLKFGYIPVINRGQKDIEKNKTIRSALEDE 282

Query: 295 EDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYG 354
           + +F  HP Y   +  CGT YL K LN  LL HIR  LPDIK K+   + + + EL    
Sbjct: 283 KRFFENHPSYSARALYCGTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLKKYQTELLS-- 340

Query: 355 GVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLK 414
            +G  +  S +S+VL ++  FS  +   +DG + ++ +KEL GGAR+ ++++ +F N + 
Sbjct: 341 -LGPESLSSSSSIVLSMITDFSKEYTGILDGEARELTSKELSGGARVSFVFHEIFKNGVY 399

Query: 415 SIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEEL 474
           ++DP   +   D+RT + N +G  P+LFV   AF++LVK QI    +PS R V LV++EL
Sbjct: 400 ALDPFDQIKDSDIRTIMYNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSLRLVNLVFDEL 459

Query: 475 MKICHK-CGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNF 533
           ++I  +     + +RYP L+  +     + L+E + PT  +V  +I   + YINT HP+ 
Sbjct: 460 VRILKQIINQPKYSRYPSLRDAISNNFVQFLKEAVIPTNDFVVDIIKSEQTYINTAHPDL 519

Query: 534 LSATEAM 540
           L  ++AM
Sbjct: 520 LKGSQAM 526

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 48/80 (60%)

Query: 662 LTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCLLVNYCKDSVQNRLVTKLYKETL 721
           +TERE+LE E+IK LI SYF I++  + D +PKAVM  L+   K+ +Q  L+ KLY    
Sbjct: 590 MTEREKLETEVIKLLIDSYFSIVKRSVADFIPKAVMLKLIVKSKNDIQKILLEKLYSSEN 649

Query: 722 FEELLVEDQTLAQDRELCVK 741
            +EL  E     Q R+ C K
Sbjct: 650 LDELTKESDLTTQRRKECQK 669

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score =  170 bits (430), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 108/260 (41%), Positives = 149/260 (57%), Gaps = 48/260 (18%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           D+    + LP + VVGSQSSGKSS+LE++VGRDFLP+G+ +VTRRP+ L L N    S  
Sbjct: 200 DTNTPGVTLPSIVVVGSQSSGKSSVLESIVGRDFLPKGSNMVTRRPIELTLVNTPSGS-- 257

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
                       E T                     AD        P  R Y   DF ++
Sbjct: 258 ------------ETT---------------------AD-------FPTHRIYNLKDFREV 277

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR I  E        + IS+ PI L + SP V +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 278 KR-ILMELNLTVPTHEAISEDPIQLTIKSPRVPDLSLVDLPGYIQVEAADQPMELKSKIR 336

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
           N+   Y+A PN +ILA+S A+VDL NS +L+ ++  DPQG RTIGVITKLDL++  + A 
Sbjct: 337 NVCQKYLAEPN-IILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLVEP-SAAR 394

Query: 257 DILSGKMYPLKLGFVGVVNR 276
           D+L  K YPLK+G+VGV+ +
Sbjct: 395 DLLMNKKYPLKMGYVGVITK 414

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score =  169 bits (427), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 149/261 (57%), Gaps = 48/261 (18%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L     N+P 
Sbjct: 213 DSASANLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTL----VNTPN 268

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
           ++E                                 AD        P  R Y   DF ++
Sbjct: 269 VQE-------------------------------TTAD-------FPSLRVYNMKDFREV 290

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR +      +   +  +S+ PI L + S HV +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 291 KRMLTELNLAVPASE-AVSEEPIQLTIKSAHVPDLSLVDLPGYIQVEAADQPMELKSKIR 349

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
            L   Y+A PN +ILA+S A+VDL NS +L+ ++  DPQG RTIGVITKLDL+ S   A 
Sbjct: 350 MLCDKYLAEPN-IILAISAADVDLANSSALRASKVADPQGLRTIGVITKLDLV-SAEEAR 407

Query: 257 DILSGKMYPLKLGFVGVVNRS 277
            IL+ + YPL +G+VGV+ +S
Sbjct: 408 KILTNRKYPLTMGYVGVITKS 428

>YOR211C (MGM1) [5004] chr15 complement(738924..741632) Peripheral
           membrane protein that mediates mitochondrial
           inheritance, member of dynamin family of GTPases [2709
           bp, 902 aa]
          Length = 902

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 148/265 (55%), Gaps = 48/265 (18%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L N +PNS  
Sbjct: 223 DSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVN-TPNSNN 281

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
           +  D                                          P  R Y   DF ++
Sbjct: 282 VTAD-----------------------------------------FPSMRLYNIKDFKEV 300

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR +  E        + +S+ PI L + S  V +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 301 KRMLM-ELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIR 359

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
           +L   Y+  PN +ILA+S A+VDL NS +LK ++  DP+G RTIGVITKLDL+D    A 
Sbjct: 360 DLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKAR 417

Query: 257 DILSGKMYPLKLGFVGVVNRSQQDI 281
            IL+ K YPL +G+VGV+ ++   I
Sbjct: 418 SILNNKKYPLSMGYVGVITKTPSSI 442

>KLLA0D06721g complement(578072..580723) similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 883

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 147/261 (56%), Gaps = 48/261 (18%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VG+DFLP+GT +VTRRP+ L L N +P S  
Sbjct: 213 DSTSANLALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTLVN-TPTSQE 271

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
           +  D                                          P  R Y   DF ++
Sbjct: 272 VTAD-----------------------------------------FPTMRIYNLKDFKEV 290

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR I  E        + +S  PI L + S  V +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 291 KR-ILTEMNMAVPSTEAVSDDPIQLTIKSSRVPDLSLVDLPGYIQVEAVDQPIELKSKIR 349

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
            L   Y+  PN +ILA+S A+VDL NS +L+ ++  DPQG RTIGV+TKLDL+D+ T A 
Sbjct: 350 QLCDKYLEEPN-IILAISAADVDLANSAALRASKVADPQGLRTIGVVTKLDLVDAKT-AR 407

Query: 257 DILSGKMYPLKLGFVGVVNRS 277
            IL+ + YPLK+G+VGV+ +S
Sbjct: 408 AILNNRKYPLKMGYVGVITKS 428

>Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement
          Length = 884

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 149/260 (57%), Gaps = 48/260 (18%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N +PNS  
Sbjct: 215 DSSSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVN-TPNSNE 273

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
           I  D                                          P  R Y   DF ++
Sbjct: 274 ITAD-----------------------------------------FPALRVYNLQDFKEV 292

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR I  E        + +S+ PI L + +  V +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 293 KR-ILMELNMAVPTSEAVSEEPIQLTIKASRVPDLSLVDLPGYIQVEAADQPLELKSKIR 351

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
            L   Y+A PN +ILA+S A+VDL NS +L+ ++ VDP G+RTIGVITKLDL++    A 
Sbjct: 352 LLCEKYLAEPN-IILAISAADVDLANSAALRASKVVDPLGERTIGVITKLDLVEPA-KAR 409

Query: 257 DILSGKMYPLKLGFVGVVNR 276
           +IL+ K YPLK+G+VGV+ +
Sbjct: 410 EILNNKKYPLKMGYVGVITK 429

>Kwal_26.8613
          Length = 861

 Score =  167 bits (422), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 113/328 (34%), Positives = 172/328 (52%), Gaps = 68/328 (20%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           DS   +L LP + V+GSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N S     
Sbjct: 201 DSSSASLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTS----- 255

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
                                         G     AD        P  R Y   DF+++
Sbjct: 256 ------------------------------GSNETTAD-------FPSLRAYNIKDFNEV 278

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR I  E        + +S  PI L + S  V +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 279 KR-ILMELNMAVPSSEAVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELKSKIR 337

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
            +   Y+A PN +ILA+S A+VDL NS +L+ ++  DP+G RTIGVITKLDL++    A 
Sbjct: 338 QVCETYLAEPN-IILAISAADVDLANSSALRASKVADPKGLRTIGVITKLDLVEPA-RAK 395

Query: 257 DILSGKMYPLKLGFVGVVNRS-----------------QQDIQLNKTVEESLDKEEDYFR 299
           +IL+ K YPLK+G+VGV+ ++                 ++ +     +E++   E DYF+
Sbjct: 396 EILNSKKYPLKMGYVGVITKNPNSSSRLFDTGTKSGLFKRKVSQESEMEQTRKFERDYFK 455

Query: 300 KHPVYRT---ISTKCGTRYLAKLLNQTL 324
            +    +   +STK     L K+L  ++
Sbjct: 456 NNKATFSNCQVSTKRLREKLIKILEVSM 483

>Scas_605.17
          Length = 891

 Score =  163 bits (412), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 147/261 (56%), Gaps = 48/261 (18%)

Query: 20  DSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPL 79
           DS    L LP + V+GSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L     N+P 
Sbjct: 214 DSTSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTL----VNTP- 268

Query: 80  IEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFY---DFDDI 136
                                         G     AD        P  R Y   DF ++
Sbjct: 269 ------------------------------GVNETTAD-------FPSLRTYNLKDFKEV 291

Query: 137 KREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIK 196
           KR I  E        + +S+ PI L + S  + +L+LVDLPG  +V   +QP +++ +I+
Sbjct: 292 KR-ILMELNMAVPTTEAVSEEPIQLTIKSSSIPDLSLVDLPGYIQVEAADQPTELKTKIR 350

Query: 197 NLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL 256
            L   Y+  PN +ILA+S A+VDL NS +L+ A+  DPQG RTIGVITKLDL+ S   A 
Sbjct: 351 QLCDKYLNEPN-IILAISAADVDLANSSALRAAKMADPQGLRTIGVITKLDLI-SPEAAR 408

Query: 257 DILSGKMYPLKLGFVGVVNRS 277
           +IL+ + YPLK+G+VGV+ +S
Sbjct: 409 NILNNRKYPLKMGYVGVITKS 429

>YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in
          vesicle formation and protein secretion [2331 bp, 776
          aa]
          Length = 776

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 26 LDLPILAVVGSQSSGKSSILETLVGRDF 53
          LD  +++V GSQSSGKS++L  L   +F
Sbjct: 35 LDYHVISVFGSQSSGKSTLLNVLFNTNF 62

>AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)
          [2376 bp, 791 aa]
          Length = 791

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 26 LDLPILAVVGSQSSGKSSILETLVGRDF 53
          LD  +++V GSQSSGKS++L  L    F
Sbjct: 41 LDYHVISVFGSQSSGKSTLLNALFNTKF 68

>YOR373W (NUD1) [5148] chr15 (1036830..1039385) Spindle pole body
           protein required for nuclear division [2556 bp, 851 aa]
          Length = 851

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 55/129 (42%), Gaps = 6/129 (4%)

Query: 250 DSGTN--ALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTI 307
           D+ TN  A  IL  K Y L     G V   Q+ IQ     EE+L   +D     P +  +
Sbjct: 343 DNHTNGKAPSILDKKAYELTSTKPGDVGYRQKKIQ----EEENLANSDDTPLDTPKFNDL 398

Query: 308 STKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESRASL 367
            TK GTR   K   +T  S     L +   KL T  ++  +++     V  + NE+   L
Sbjct: 399 FTKNGTRAKVKGQMRTSRSISNSNLLEAHKKLKTFPAERVEDITSISEVNTSFNETEKQL 458

Query: 368 VLQLMNKFS 376
           +  L +K S
Sbjct: 459 ISILTSKLS 467

>Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement
          Length = 782

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 26 LDLPILAVVGSQSSGKSSILETLVGRDF 53
          +D  +++V GSQSSGKS++L  L    F
Sbjct: 37 VDYHVISVFGSQSSGKSTLLNALFNTQF 64

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 52/132 (39%), Gaps = 11/132 (8%)

Query: 134 DDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEK 193
           D + + I+     ++   K     PI +   S  V   TL+  PG  K    E  P +EK
Sbjct: 88  DSVLKAIDYYFEHLSATPKTSQSTPIQISGSSNTVSPNTLLSSPGAVKRRKKEYGPRLEK 147

Query: 194 QIKNLIL--DYIATPNCLILAVSPANVDLVNSESLKL---------AREVDPQGKRTIGV 242
           Q++  +L   +I +     LA  P    L     LK+         AR  +  GK+   +
Sbjct: 148 QLRPSVLWHKFIGSIQVNALATRPTAKPLKYGSELKIVKNSTGISPARIYNTNGKKKTSL 207

Query: 243 ITKLDLMDSGTN 254
              + L+D+  N
Sbjct: 208 ANYIRLIDAAQN 219

>Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement
          Length = 577

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 33  VVGSQSSGKSSILETLVGRDF 53
           VVG  +SGKSS+LE+ +GR F
Sbjct: 364 VVGKPNSGKSSLLESFLGRSF 384

>AFR077W [3269] [Homologous to ScYKR029C (SET3) - SH; ScYJL105W
           (SET4) - SH] complement(567510..569888) [2379 bp, 792
           aa]
          Length = 792

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 16/115 (13%)

Query: 283 LNKTVEESLDKEEDYFRKHPVYRTIS---TKCGTR----YLAKL--LNQTLLSHIRDKLP 333
           +N    ES+ + E Y   H V   +S     CG+     +L K+   +QTL   ++ K+ 
Sbjct: 498 INGAAVESIAEPEKYLLIHSVDTVLSICDCACGSNNRDCHLLKVKKFSQTLYRSVKSKM- 556

Query: 334 DIKTKLNTLISQTEQELARYGGV------GATTNESRASLVLQLMNKFSTNFISS 382
           + + KLN ++ + + +  R   +       A TN +RA  VL  +N    NF+SS
Sbjct: 557 NNRYKLNEILQKGKVQNRRQTPILSSLAHEAITNSARAHEVLVKLNATKLNFLSS 611

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 43  SILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTK-----IS 97
           SIL+     DF+P+ T +      V+       N  +   DD  +  +D +TK     +S
Sbjct: 347 SILQNWYNPDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELS 406

Query: 98  GFEAGTKPLEYRG 110
           G + G   L+Y G
Sbjct: 407 GHDGGVWALKYAG 419

>KLLA0E09229g complement(827035..827517) similar to sgd|S0002268
           Saccharomyces cerevisiae YDL110c hypothetical protein,
           start by similarity
          Length = 160

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 221 VNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDI 258
           + S S KL R +  QG+RT+GV +      +G+N++++
Sbjct: 123 IQSASTKLKRSLQSQGRRTVGVDSDNTADATGSNSINL 160

>Scas_707.8
          Length = 294

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 9/53 (16%)

Query: 33 VVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDN 85
          VVG+  +GKS++L+ L G+     G  +V         N + P SPL    DN
Sbjct: 38 VVGANGAGKSTLLKLLAGKHLCLNGKILV---------NGLDPFSPLSMYQDN 81

>Kwal_23.5956
          Length = 940

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 470 VYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQ 509
           V+E +++ C KC    LA    L+S  ++VI E+L+ R++
Sbjct: 133 VFERMLEKCVKCEEYRLALGIALESYRLDVIEEILKTRVK 172

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,376,495
Number of extensions: 1129318
Number of successful extensions: 4337
Number of sequences better than 10.0: 51
Number of HSP's gapped: 4414
Number of HSP's successfully gapped: 65
Length of query: 744
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 635
Effective length of database: 12,822,747
Effective search space: 8142444345
Effective search space used: 8142444345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)