Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKR014C (YPT52)23423111401e-160
Scas_675.282162318081e-110
CAGL0G07689g2152327491e-101
Sklu_2238.22072317153e-96
Kwal_14.23942072317127e-96
AAL176C2052317051e-94
KLLA0D02376g2072316582e-87
YOR089C (VPS21)2101904801e-60
YNL093W (YPT53)2201924723e-59
KLLA0C13728g2081964541e-56
Kwal_23.29782111904522e-56
CAGL0J08635g2081904374e-54
Scas_662.262121904306e-53
ACL084C2071894252e-52
AEL187C2081994062e-49
Sklu_2366.32181953881e-46
YER031C (YPT31)2231933533e-41
Kwal_14.24842031943452e-40
YLR262C (YPT6)2152013453e-40
KLLA0F01232g2101933402e-39
CAGL0K09394g2211933393e-39
Scas_203.22511953414e-39
Scas_574.22221943384e-39
CAGL0C02453g2181863376e-39
Scas_712.412191933342e-38
Kwal_56.225552121993323e-38
YGL210W (YPT32)2221863323e-38
CAGL0I09306g2061903296e-38
Sklu_2293.32141943306e-38
AER434C2191933307e-38
YBR264C (YPT10)1991773287e-38
CAGL0K06017g2191943299e-38
KLLA0F20471g2121943167e-36
AGR257C2201923142e-35
ACR003C2081912766e-30
KLLA0E12111g2141832705e-29
KLLA0D05313g2041832695e-29
Scas_674.52081922696e-29
Kwal_47.190551791642651e-28
Sklu_2373.32081922671e-28
Sklu_1815.22131832652e-28
YML001W (YPT7)2081282653e-28
Sklu_1136.11821642624e-28
Kwal_56.224402081292634e-28
CAGL0E02607g2081292626e-28
Kwal_23.50582131832628e-28
Scas_656.22181832628e-28
KLLA0D01265g2071932601e-27
AGL021W2121832611e-27
Scas_707.262101832601e-27
CAGL0F02123g2151832592e-27
YFL005W (SEC4)2151832558e-27
Kwal_14.11162041902512e-26
Scas_713.52111902513e-26
CAGL0K12672g2061902496e-26
ABR220W2041902479e-26
Sklu_2144.32041902479e-26
YFL038C (YPT1)2061902401e-24
CAGL0I00594g2141902103e-20
YLR293C (GSP1)2191902095e-20
YOR185C (GSP2)2201902095e-20
Scas_691.362121872078e-20
KLLA0C05126g2141902043e-19
KLLA0A04499g2141902043e-19
Sklu_2285.42141902033e-19
AGR294C2141902033e-19
YNL090W (RHO2)1921852006e-19
Sklu_2151.42071852006e-19
Scas_586.62191952017e-19
Kwal_56.233612141942008e-19
Scas_610.42111851973e-18
ABL139C2941961994e-18
YPR165W (RHO1)2091851954e-18
KLLA0B10626g2081851945e-18
Sklu_2151.32091851945e-18
ABR182W2091841945e-18
Kwal_55.219372081901945e-18
Kwal_33.144522601961976e-18
Kwal_55.219412091881911e-17
CAGL0I08459g2101851902e-17
ABR183W2071851884e-17
KLLA0C13816g1871851866e-17
KLLA0D08327g2542001896e-17
Sklu_1816.11881891857e-17
ACL087C1871881849e-17
Scas_578.71871851813e-16
YIL118W (RHO3)2312021833e-16
CAGL0J05632g1881851804e-16
CAGL0G08558g2271861824e-16
KLLA0F03443g2231921754e-15
Scas_444.4*2891871732e-14
Scas_547.32231951693e-14
ADL252W2241981693e-14
Scas_417.32912091713e-14
Scas_677.202831901704e-14
Scas_703.412251241674e-14
KLLA0B05038g2231971667e-14
AER132W2321961667e-14
Kwal_47.169832231931658e-14
Sklu_2007.22612061651e-13
Sklu_2345.52191901622e-13
YNL180C (RHO5)3312191652e-13
Scas_671.352342041623e-13
YKR055W (RHO4)2911281625e-13
CAGL0L11242g2541921615e-13
AGL093W1911881561e-12
Kwal_33.140152711961572e-12
Kwal_55.21971421731592e-12
Sklu_1653.32561281562e-12
Kwal_23.31351911881533e-12
KLLA0A04213g1911881516e-12
YGR152C (RSR1)2721901537e-12
Scas_721.961911881499e-12
YLR229C (CDC42)1911891491e-11
CAGL0F05269g1911891481e-11
Kwal_23.48752302001492e-11
CAGL0K08316g3231311485e-11
YML064C (TEM1)2451231465e-11
KLLA0A05643g2181951455e-11
Sklu_1655.12871971476e-11
Kwal_14.22442441901441e-10
AFR464W2641901441e-10
KLLA0C12001g2591901431e-10
ACR257C2591961431e-10
Scas_575.102711901432e-10
CAGL0E03113g3231901432e-10
KLLA0A11330g1901891384e-10
CAGL0J11242g3841441406e-10
YNL304W (YPT11)355791406e-10
YCR027C (RHB1)2091861332e-09
Kwal_34.161421921801313e-09
CAGL0G05764g2901991343e-09
YOR101W (RAS1)3091851301e-08
Sklu_2354.10422731264e-08
YNL098C (RAS2)3221401255e-08
Sklu_2320.21641291216e-08
ADL162W404731246e-08
CAGL0M03817g475711248e-08
YOR094W (ARF3)1831301209e-08
ADL262W2701941221e-07
Kwal_26.83872921851211e-07
Scas_697.463241851202e-07
Sklu_2365.21971831182e-07
Kwal_23.29441841301163e-07
Scas_503.2527711203e-07
CAGL0I03916g1811401145e-07
ACL078W1811301145e-07
Scas_701.42*1811401145e-07
CAGL0J09064g1811401145e-07
YDL137W (ARF2)1811401145e-07
Scas_624.4*1811401145e-07
KLLA0C12881g373721176e-07
Scas_697.54*1811301138e-07
KLLA0F05225g1811401138e-07
KLLA0C13563g1821401138e-07
CAGL0B04521g3391851141e-06
YDL192W (ARF1)1811401102e-06
ADR094W1811851066e-06
Kwal_56.244531811401059e-06
Sklu_1681.21621391041e-05
Kwal_56.244621811401013e-05
CAGL0L12826g1991851023e-05
CAGL0E05896g1891331014e-05
Kwal_47.18241230150997e-05
Kwal_27.11872197129988e-05
YPL218W (SAR1)190124971e-04
Scas_628.21208128981e-04
Scas_567.9199195943e-04
AGL261W198131926e-04
KLLA0B02046g190133916e-04
CAGL0I00858g197192916e-04
Sklu_2202.6183142908e-04
KLLA0E24805g183144890.001
YPL051W (ARL3)198190900.001
YMR138W (CIN4)191186890.001
CAGL0E06292g408157910.001
AGR221W183189880.002
AFL114W190133880.002
Scas_706.2*190153880.002
CAGL0I10835g183144870.002
Scas_700.11183144860.003
YBR164C (ARL1)183144860.003
Kwal_56.2414914978820.006
KLLA0F02662g253109820.011
KLLA0C13387g211112800.020
KLLA0F17072g190131740.12
Kwal_26.681066475750.14
AEL232C309139720.29
KLLA0E12837g19999710.29
KLLA0C02541g27074670.95
ADR402W661127680.95
Sklu_2411.4496139681.1
KLLA0A03465g65926671.4
Sklu_2213.119137632.4
Sklu_1358.121877632.6
Scas_698.27701114643.2
KLLA0D17358g184836643.2
Scas_680.21183109623.2
Scas_721.9039744633.3
KLLA0C06358g299143615.3
Scas_539.1656137625.9
KLLA0E00462g165055617.1
YMR023C (MSS1)52623609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR014C
         (231 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   443   e-160
Scas_675.28                                                           315   e-110
CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   293   e-101
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        280   3e-96
Kwal_14.2394                                                          278   7e-96
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   276   1e-94
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   258   2e-87
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   189   1e-60
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   186   3e-59
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   179   1e-56
Kwal_23.2978                                                          178   2e-56
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   172   4e-54
Scas_662.26                                                           170   6e-53
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   168   2e-52
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   160   2e-49
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               154   1e-46
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   140   3e-41
Kwal_14.2484                                                          137   2e-40
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   137   3e-40
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   135   2e-39
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   135   3e-39
Scas_203.2                                                            135   4e-39
Scas_574.2                                                            134   4e-39
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   134   6e-39
Scas_712.41                                                           133   2e-38
Kwal_56.22555                                                         132   3e-38
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   132   3e-38
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   131   6e-38
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           131   6e-38
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   131   7e-38
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   130   7e-38
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   131   9e-38
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   126   7e-36
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   125   2e-35
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   110   6e-30
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   108   5e-29
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   108   5e-29
Scas_674.5                                                            108   6e-29
Kwal_47.19055                                                         106   1e-28
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         107   1e-28
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        106   2e-28
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   106   3e-28
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                           105   4e-28
Kwal_56.22440                                                         105   4e-28
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   105   6e-28
Kwal_23.5058                                                          105   8e-28
Scas_656.2                                                            105   8e-28
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   104   1e-27
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   105   1e-27
Scas_707.26                                                           104   1e-27
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   104   2e-27
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   102   8e-27
Kwal_14.1116                                                          101   2e-26
Scas_713.5                                                            101   3e-26
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   100   6e-26
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   100   9e-26
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           100   9e-26
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...    97   1e-24
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    86   3e-20
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    85   5e-20
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    85   5e-20
Scas_691.36                                                            84   8e-20
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    83   3e-19
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    83   3e-19
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         83   3e-19
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    83   3e-19
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    82   6e-19
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                82   6e-19
Scas_586.6                                                             82   7e-19
Kwal_56.23361                                                          82   8e-19
Scas_610.4                                                             80   3e-18
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    81   4e-18
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    80   4e-18
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    79   5e-18
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         79   5e-18
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    79   5e-18
Kwal_55.21937                                                          79   5e-18
Kwal_33.14452                                                          80   6e-18
Kwal_55.21941                                                          78   1e-17
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    78   2e-17
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    77   4e-17
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    76   6e-17
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    77   6e-17
Sklu_1816.1 YNL090W, Contig c1816 115-681                              76   7e-17
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    75   9e-17
Scas_578.7                                                             74   3e-16
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    75   3e-16
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    74   4e-16
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    75   4e-16
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    72   4e-15
Scas_444.4*                                                            71   2e-14
Scas_547.3                                                             70   3e-14
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    70   3e-14
Scas_417.3                                                             70   3e-14
Scas_677.20                                                            70   4e-14
Scas_703.41                                                            69   4e-14
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    69   7e-14
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    69   7e-14
Kwal_47.16983                                                          68   8e-14
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          68   1e-13
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           67   2e-13
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    68   2e-13
Scas_671.35                                                            67   3e-13
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    67   5e-13
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    67   5e-13
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    65   1e-12
Kwal_33.14015                                                          65   2e-12
Kwal_55.21971                                                          66   2e-12
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            65   2e-12
Kwal_23.3135                                                           64   3e-12
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    63   6e-12
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    64   7e-12
Scas_721.96                                                            62   9e-12
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    62   1e-11
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    62   1e-11
Kwal_23.4875                                                           62   2e-11
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    62   5e-11
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    61   5e-11
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    60   5e-11
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          61   6e-11
Kwal_14.2244                                                           60   1e-10
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    60   1e-10
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    60   1e-10
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    60   1e-10
Scas_575.10                                                            60   2e-10
CAGL0E03113g complement(289164..290135) some similarities with s...    60   2e-10
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    58   4e-10
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    59   6e-10
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    59   6e-10
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    56   2e-09
Kwal_34.16142                                                          55   3e-09
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    56   3e-09
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    55   1e-08
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         53   4e-08
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    53   5e-08
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            51   6e-08
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    52   6e-08
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    52   8e-08
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    51   9e-08
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    52   1e-07
Kwal_26.8387                                                           51   1e-07
Scas_697.46                                                            51   2e-07
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          50   2e-07
Kwal_23.2944                                                           49   3e-07
Scas_503.2                                                             51   3e-07
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    49   5e-07
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    49   5e-07
Scas_701.42*                                                           49   5e-07
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    49   5e-07
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    49   5e-07
Scas_624.4*                                                            49   5e-07
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    50   6e-07
Scas_697.54*                                                           48   8e-07
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    48   8e-07
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    48   8e-07
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    49   1e-06
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    47   2e-06
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    45   6e-06
Kwal_56.24453                                                          45   9e-06
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            45   1e-05
Kwal_56.24462                                                          44   3e-05
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    44   3e-05
CAGL0E05896g join(complement(585178..585202),complement(584348.....    44   4e-05
Kwal_47.18241                                                          43   7e-05
Kwal_27.11872                                                          42   8e-05
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    42   1e-04
Scas_628.21                                                            42   1e-04
Scas_567.9                                                             41   3e-04
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    40   6e-04
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    40   6e-04
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    40   6e-04
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            39   8e-04
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    39   0.001
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    39   0.001
YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein...    39   0.001
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    40   0.001
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    39   0.002
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    39   0.002
Scas_706.2*                                                            39   0.002
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    38   0.002
Scas_700.11                                                            38   0.003
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    38   0.003
Kwal_56.24149                                                          36   0.006
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    36   0.011
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    35   0.020
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    33   0.12 
Kwal_26.6810                                                           33   0.14 
AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 3...    32   0.29 
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    32   0.29 
KLLA0C02541g complement(226721..227533) weakly similar to sp|P52...    30   0.95 
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    31   0.95 
Sklu_2411.4 YMR023C, Contig c2411 8898-10388                           31   1.1  
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    30   1.4  
Sklu_2213.1 YGR016W, Contig c2213 1040-1615                            29   2.4  
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             29   2.6  
Scas_698.27                                                            29   3.2  
KLLA0D17358g complement(1477523..1483069) similar to sp|P11075 S...    29   3.2  
Scas_680.21                                                            28   3.2  
Scas_721.90                                                            29   3.3  
KLLA0C06358g complement(563583..564482) highly similar to sp|Q00...    28   5.3  
Scas_539.1                                                             28   5.9  
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    28   7.1  
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    28   9.8  

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  443 bits (1140), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 219/231 (94%), Positives = 219/231 (94%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
           YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 181 GVKEIFQDIGEKLYDLKKDEILSKXXXXXXXXXXXXVDINLQRPSTNDPTS 231
           GVKEIFQDIGEKLYDLKKDEILSK            VDINLQRPSTNDPTS
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTS 231

>Scas_675.28
          Length = 216

 Score =  315 bits (808), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/231 (70%), Positives = 183/231 (79%), Gaps = 18/231 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDELRESTIGAAFLSQ+I I   +  E  DVVI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEE--DVVI 58

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ+DSL KAR+WV+ELKNKVGD+DLVI
Sbjct: 59  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVI 118

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
           +L+GNK+DLC             EG   E+ +RA+ T EAK YA+EQ LLF EVSAKTG+
Sbjct: 119 FLVGNKLDLC-------------EG---EEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQ 162

Query: 181 GVKEIFQDIGEKLYDLKKDEILSKXXXXXXXXXXXXVDINLQRPSTNDPTS 231
           GVKE+F+ IGEKLY  KKDEIL+K            VDIN QRPSTND T+
Sbjct: 163 GVKEVFRSIGEKLYASKKDEILAKKNRELGNRVNNSVDINAQRPSTNDTTT 213

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  293 bits (749), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 175/232 (75%), Gaps = 21/232 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQ++ I   DGNE  DVVI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIK--DGNE--DVVI 56

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ DSL KA++WV EL+NKVGD++LVI
Sbjct: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVI 116

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
           YL+GNKVD+ +                 ++  R I TEE  +YAQ Q LLF+EVSAKTG 
Sbjct: 117 YLVGNKVDIVE----------------ADESARKIETEEGAEYAQAQKLLFKEVSAKTGA 160

Query: 181 GVKEIFQDIGEKLYDLKKDEILSK-XXXXXXXXXXXXVDINLQRPSTNDPTS 231
           GVK+IFQ+IGE+LY  KK  + +K             VDI  QRPSTND +S
Sbjct: 161 GVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  280 bits (715), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 145/231 (62%), Positives = 170/231 (73%), Gaps = 27/231 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQ+I +      +  D V+
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKL-----KDYNDTVV 55

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNAN ALVVYD+TQ DSL KA+NWVDELK+KVGD+DLVI
Sbjct: 56  KFEIWDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVI 115

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
            L+GNK+DLC+                EE + R +  ++A+ YA ++GLLF EVSAKTG+
Sbjct: 116 CLVGNKLDLCE----------------EEGQERGVDKDDAQSYASDKGLLFHEVSAKTGK 159

Query: 181 GVKEIFQDIGEKLYDLKKDEILSKXXXXXXXXXXXXVDINLQRPSTNDPTS 231
           GV  IFQ+IGEKLY  KKD +               V++ LQRP+TND TS
Sbjct: 160 GVSNIFQEIGEKLYLQKKDSL------EAASQTRHVVNVELQRPTTNDATS 204

>Kwal_14.2394
          Length = 207

 Score =  278 bits (712), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 147/231 (63%), Positives = 166/231 (71%), Gaps = 27/231 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQ+I +  ++     DV I
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEKHE-----DVTI 55

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ  SL KA++WV+ELKNKVGD DLVI
Sbjct: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVI 115

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
            L+GNK+DLC E           EGG      R +  E+A+ YAQEQGLLF EVSAKTG 
Sbjct: 116 CLVGNKLDLCTE----------EEGG------RGVEKEDAQMYAQEQGLLFHEVSAKTGS 159

Query: 181 GVKEIFQDIGEKLYDLKKDEILSKXXXXXXXXXXXXVDINLQRPSTNDPTS 231
           GV  IFQ+IGE +Y  K     +              ++ LQRPSTND TS
Sbjct: 160 GVAAIFQEIGENVYQKKGAATAASPQARKTP------NVKLQRPSTNDSTS 204

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  276 bits (705), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 172/231 (74%), Gaps = 29/231 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLS++I +  +D     D +I
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLADHD-----DAMI 55

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQEDSL KA++WV+ELK+KVGD+DLVI
Sbjct: 56  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVI 115

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
           +L+GNK+DL                 DE+ K R I +EEA+ YA+  GL+F EVSAKTG 
Sbjct: 116 FLVGNKLDLV----------------DEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGT 159

Query: 181 GVKEIFQDIGEKLYDLKKDEILSKXXXXXXXXXXXXVDINLQRPSTNDPTS 231
           G+ ++FQ IG KLY+ +++ + ++              I LQRP+TND TS
Sbjct: 160 GILDVFQGIGGKLYEQRRESLAAQPQHSSS--------IQLQRPTTNDATS 202

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  258 bits (658), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 162/231 (70%), Gaps = 27/231 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQ+I +      E  + V+
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKL----SEEYDEQVL 56

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+T+ DSL KA+ WVDELK KV DD L+I
Sbjct: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLII 116

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
            L+GNK+DL  E  ST                  +   +A+++AQE  LLF +VSAKTGE
Sbjct: 117 CLVGNKLDLVSERESTSL----------------VDEADAREFAQENNLLFHQVSAKTGE 160

Query: 181 GVKEIFQDIGEKLYDLKKDEILSKXXXXXXXXXXXXVDINLQRPSTNDPTS 231
            V ++FQDIGE+LY   KD+I                +I+LQRPSTND  S
Sbjct: 161 NVIKVFQDIGERLYLQNKDKIQESKKPNNN-------NISLQRPSTNDSQS 204

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  189 bits (480), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 100/190 (52%), Positives = 130/190 (68%), Gaps = 26/190 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q +TI+ +         +KFE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEH--------TVKFE 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER+ SLAPMYYRNA AALVVYD+T+  S  KAR+WV EL  +    D++I L+
Sbjct: 60  IWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKDIIIALV 118

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK+D+ Q            EGG+     R ++ EE ++ A+E+GLLF E SAKTGE V 
Sbjct: 119 GNKIDMLQ------------EGGE-----RKVAREEGEKLAEEKGLLFFETSAKTGENVN 161

Query: 184 EIFQDIGEKL 193
           ++F  IGEK+
Sbjct: 162 DVFLGIGEKI 171

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  186 bits (472), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 127/192 (66%), Gaps = 23/192 (11%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ IT    DG      VIK
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRIT---RDGK-----VIK 62

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
           FEIWDTAGQER+  LAPMYYRNA AALVV+D+T E S  KA+NWV+EL  KVG  D+VI 
Sbjct: 63  FEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVG-HDIVIA 121

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           L+GNK+DL                 D+E + RA+     +   + + LL+ E SAKTGE 
Sbjct: 122 LVGNKMDLLN--------------NDDENENRAMKAPAVQNLCERENLLYFEASAKTGEN 167

Query: 182 VKEIFQDIGEKL 193
           + +IFQ +GEK+
Sbjct: 168 IYQIFQTLGEKV 179

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  179 bits (454), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 127/196 (64%), Gaps = 26/196 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +         D  IKFE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNM--------ADHTIKFE 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER+ SLAPMYYRNA AALVVYD+T+  S  KAR+WV EL  +     +VI L+
Sbjct: 60  IWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKGIVIALV 118

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK+DL                  E ++ R ++ EEA++ +QE+ LLF E SAKTG+ V 
Sbjct: 119 GNKMDLL-----------------ESEEDRKVAKEEAEKLSQEENLLFFETSAKTGDNVN 161

Query: 184 EIFQDIGEKLYDLKKD 199
           E+F  IGEK+   K D
Sbjct: 162 EVFLAIGEKIPLKKSD 177

>Kwal_23.2978
          Length = 211

 Score =  178 bits (452), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 127/190 (66%), Gaps = 26/190 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q +    N G+ T    IKFE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRV----NMGDHT----IKFE 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER+ SLAPMYYRNA AALVVYD+T+  S  KAR+WV EL+ +    D+VI L+
Sbjct: 60  IWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQ-ASKDIVIALV 118

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK+D+ +             GG+     R ++ EEA+  A ++ LLF E SAKTG  V 
Sbjct: 119 GNKLDIVE------------SGGE-----RKVAREEAENLAAQEQLLFFETSAKTGSNVN 161

Query: 184 EIFQDIGEKL 193
           E+F  IG+K+
Sbjct: 162 EVFLGIGQKI 171

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  172 bits (437), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 130/190 (68%), Gaps = 26/190 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q +TI+ +         +KFE
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTINEH--------TVKFE 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER+ SLAPMYYRNA AALVVYD+T+  S  KAR+WV EL+ +    D++I L+
Sbjct: 60  IWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQ-ASKDIIIALV 118

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK+D+              E G E    R++S EEA++ A+E+ LLF E SAK+GE + 
Sbjct: 119 GNKIDVL-------------ENGTE----RSVSREEAEKLAEEENLLFFETSAKSGENIT 161

Query: 184 EIFQDIGEKL 193
           ++F  IGEK+
Sbjct: 162 DVFLAIGEKV 171

>Scas_662.26
          Length = 212

 Score =  170 bits (430), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 98/190 (51%), Positives = 128/190 (67%), Gaps = 25/190 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + I+ N         +KFE
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDN--------TVKFE 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER+ SLAPMYYRNA AAL+VYD+T+  S  KAR+W+ EL  +  + D++I L+
Sbjct: 60  IWDTAGQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQ-ANKDMIIALV 118

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+              E  ++E+KV   + EE ++ A+E+GLLF E SAKTG  V 
Sbjct: 119 GNKVDVL-------------ENNEDERKV---AREEGEKLAEEEGLLFFETSAKTGLNVT 162

Query: 184 EIFQDIGEKL 193
           E F  IGEK+
Sbjct: 163 ETFVAIGEKI 172

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  168 bits (425), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 124/189 (65%), Gaps = 26/189 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q + +            IKFEI
Sbjct: 9   KLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNMDSK--------TIKFEI 60

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
           WDTAGQER+ SLAPMYYRNA AALVVYDIT+  S  KAR+WV EL  +     +VI L+G
Sbjct: 61  WDTAGQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQ-ASKGIVIALVG 119

Query: 125 NKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKE 184
           NK+DL                  E  + R +S EEA++ A+E+GLLF E SAKTG+ + E
Sbjct: 120 NKLDLL-----------------ENGEARKVSREEAEKLAEEEGLLFFETSAKTGDKINE 162

Query: 185 IFQDIGEKL 193
           +F  IGEK+
Sbjct: 163 VFLAIGEKI 171

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  160 bits (406), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 125/199 (62%), Gaps = 36/199 (18%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIH--PNDGNETKDV 58
             Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF ++S+       DG++ K+V
Sbjct: 6   CCQVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEV 64

Query: 59  -VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGD-- 115
             + FEIWDTAGQERY+SLAPMYYRN + ALVVYD+T++ S Q AR+W+DEL   +G+  
Sbjct: 65  RSVTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQ 124

Query: 116 -DDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREV 174
            +D+V+ ++GNK+DL             + GG  EQ + + +                 V
Sbjct: 125 RNDVVVRIVGNKIDL-------------HAGGQLEQPLPSATF----------------V 155

Query: 175 SAKTGEGVKEIFQDIGEKL 193
           SAKTGEG++E+F DI + +
Sbjct: 156 SAKTGEGIEELFMDIAKHV 174

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  154 bits (388), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 120/195 (61%), Gaps = 32/195 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSIT---IHPNDGNETKDVV 59
           + KLVLLG+SSVGKSSIV RF    F     +TIGAAF +++++   I P  G ET D  
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETG-ETIDKK 65

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDD-- 117
           IK EIWDTAGQERY+SLAPMYYRN + AL+V+D+T +DS+ +A++W+DEL   + + +  
Sbjct: 66  IKLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHE 125

Query: 118 ---LVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREV 174
              ++I ++GNK+DL  E   T+  P                      Y Q+QG  +  V
Sbjct: 126 ERGILIKIVGNKIDLNPEARETQNLP----------------------YIQDQGYNWFPV 163

Query: 175 SAKTGEGVKEIFQDI 189
           SAKTG+G+ E+F  I
Sbjct: 164 SAKTGDGIDELFDTI 178

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  140 bits (353), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 77/193 (39%), Positives = 113/193 (58%), Gaps = 29/193 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F ++++ I   DG       IK
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI---DGKR-----IK 63

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
            +IWDTAGQERY+++   YYR A  AL+VYDI++  S +   +W+ EL+    DD++ + 
Sbjct: 64  AQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVG 122

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           L+GNK DL                      +RA+ TEE+K +AQE  LLF E SA   E 
Sbjct: 123 LIGNKSDLAH--------------------LRAVPTEESKTFAQENQLLFTETSALNSEN 162

Query: 182 VKEIFQDIGEKLY 194
           V + F+++   +Y
Sbjct: 163 VDKAFEELINTIY 175

>Kwal_14.2484
          Length = 203

 Score =  137 bits (345), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/194 (40%), Positives = 114/194 (58%), Gaps = 39/194 (20%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + KLVLLG+SSVGKS++V RF   +F +   +TIGAAF ++ I+       ET    +KF
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWE----TETARKEVKF 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKV-GDD--DLV 119
           EIWDTAGQERY++L PMYYRN + A VV+D+T+E +  KA +WV ELK+ + G++  ++V
Sbjct: 64  EIWDTAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIV 123

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           I L+GNK+DL  E P  +                                 +  VSAKTG
Sbjct: 124 IKLIGNKIDLLDEVPPRKVG-------------------------------WTPVSAKTG 152

Query: 180 EGVKEIFQDIGEKL 193
           EGV ++F+ +  ++
Sbjct: 153 EGVADLFESVAREV 166

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  137 bits (345), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 120/201 (59%), Gaps = 29/201 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD--------DKTI 59

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           + ++WDTAGQER++SL P Y R++  A++VYDIT+  S +    W++++KN+ GD+++++
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVIL 119

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKTG 179
            ++GNK DL  E                    R ISTEE ++ A+  G  +F E S K G
Sbjct: 120 CIVGNKSDLSDE--------------------RQISTEEGEKKAKLLGAKIFMETSTKAG 159

Query: 180 EGVKEIFQDIGEKLYDLKKDE 200
             VK +F+ I + L + +  E
Sbjct: 160 YNVKALFKKIAKSLPEFQNSE 180

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  135 bits (340), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 115/193 (59%), Gaps = 38/193 (19%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSIT-IHPNDGNETKDVVIKFE 63
           KLVLLG+SSVGKS+IV RF    F  +   TIGAAF ++++  +   DG + +   + FE
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRR---VNFE 66

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGD---DDLVI 120
           IWDTAGQERY+SLAPMYYRN + AL+V+D+TQ  S +KA++W+DEL N + D   D + +
Sbjct: 67  IWDTAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQL 126

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
            ++GNK+DL  E    ET  + N+                             VSAKTGE
Sbjct: 127 RVVGNKIDLVDE----ETLQNWNDA--------------------------ELVSAKTGE 156

Query: 181 GVKEIFQDIGEKL 193
           G+ E+F  IG+ +
Sbjct: 157 GIDELFLKIGKDI 169

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  135 bits (339), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 112/193 (58%), Gaps = 29/193 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F +++I +        +D  IK +
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKV--------EDKKIKAQ 66

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQERY+++   YYR A  AL+VYDI++  + +   +W+ ELK    DD++ I L+
Sbjct: 67  IWDTAGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLI 125

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                    + +RA+ TEEA+ +A E  L F E SA   E V 
Sbjct: 126 GNKSDL--------------------EHLRAVPTEEARGFASENQLFFTETSALNSENVD 165

Query: 184 EIFQDIGEKLYDL 196
             F+++ E++Y +
Sbjct: 166 LAFRELIEQIYKM 178

>Scas_203.2
          Length = 251

 Score =  135 bits (341), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 113/195 (57%), Gaps = 33/195 (16%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
            + K VLLG+SSVG++SIV RF      + R   IGAAFL+++I     D     D+   
Sbjct: 46  CRLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDL--- 102

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDD---DL 118
            EIWDTAGQERY+SLAP+YYRN + AL+V+D+T  ++ QKAR+WVDEL++ + ++   ++
Sbjct: 103 -EIWDTAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEI 161

Query: 119 VIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKT 178
            +YL+GNK DL  E+ +     D                             F+EVSAK 
Sbjct: 162 QLYLIGNKCDLEHESIAKTAILDM--------------------------CTFKEVSAKR 195

Query: 179 GEGVKEIFQDIGEKL 193
            EG++E+F++I   +
Sbjct: 196 DEGIQELFEEIARGI 210

>Scas_574.2
          Length = 222

 Score =  134 bits (338), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 116/194 (59%), Gaps = 29/194 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD--------DKTI 59

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           + ++WDTAGQER++SL P Y R++  A+VVYDIT++ S +    W++++KN+ GDD++++
Sbjct: 60  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVIL 119

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKTG 179
            ++GNK DL  E                    R ++ EE +  A+  G  +F E S K G
Sbjct: 120 CIVGNKSDLSDE--------------------RQVTIEEGENKAKILGADIFMETSTKAG 159

Query: 180 EGVKEIFQDIGEKL 193
             VK +F+ I + L
Sbjct: 160 YNVKNLFKKIAKSL 173

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  134 bits (337), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 109/186 (58%), Gaps = 29/186 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F +++I +   DG +     IK +
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDV---DGKK-----IKAQ 65

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQERY+++   YYR A  AL+VYDI++  S +   +W+ EL+    DD++ + L+
Sbjct: 66  IWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELREN-ADDNVAVGLI 124

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                      +RA+ TEEAKQ+A E  LLF E SA   + V 
Sbjct: 125 GNKSDLAH--------------------LRAVPTEEAKQFASENQLLFTETSALNSDNVD 164

Query: 184 EIFQDI 189
             F+++
Sbjct: 165 LAFKEL 170

>Scas_712.41
          Length = 219

 Score =  133 bits (334), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 110/193 (56%), Gaps = 29/193 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F +++I        E +   IK +
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTI--------EVEGKKIKAQ 65

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQERY+++   YYR A  AL+VYDI++  + +   +W+ EL++   DD++ + L+
Sbjct: 66  IWDTAGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNA-DDNVAVGLI 124

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                      +RA+ T EAK +A E  LLF E SA   E V 
Sbjct: 125 GNKSDLAH--------------------LRAVPTAEAKNFASENELLFTETSALNSENVD 164

Query: 184 EIFQDIGEKLYDL 196
           + F+++   +Y +
Sbjct: 165 QAFRELITAIYQM 177

>Kwal_56.22555
          Length = 212

 Score =  132 bits (332), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 120/199 (60%), Gaps = 29/199 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD--------DKTI 61

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           + ++WDTAGQER++SL P Y R+++ A+VVYD+T + S +    WV+++K++ G++++V+
Sbjct: 62  RLQLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVL 121

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKTG 179
            ++GNK DL  E                    R +STEE ++ AQ     +F E S K G
Sbjct: 122 CIVGNKNDLSDE--------------------RQVSTEEGERKAQVLNAKIFIETSTKAG 161

Query: 180 EGVKEIFQDIGEKLYDLKK 198
             VK +F+ I + L + +K
Sbjct: 162 FNVKNLFRKIAKTLPEFQK 180

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  132 bits (332), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 108/186 (58%), Gaps = 29/186 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F +++I        E ++  IK +
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTI--------EVENKKIKAQ 65

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQERY+++   YYR A  AL+VYDI++  S +   +W+ EL+    DD++ + L+
Sbjct: 66  IWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADDNVAVGLI 124

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                      +RA+ T+EAK +A E  +LF E SA   + V 
Sbjct: 125 GNKSDLAH--------------------LRAVPTDEAKNFAMENQMLFTETSALNSDNVD 164

Query: 184 EIFQDI 189
           + F+++
Sbjct: 165 KAFREL 170

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  131 bits (329), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 114/190 (60%), Gaps = 35/190 (18%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRE-STIGAAFLSQSITIHPNDGNETKDVVIKF 62
            K+VLLG+S+VGKS+IV RF   T   LR  +TIGAA++++ +  +  DG+  +   ++ 
Sbjct: 11  LKVVLLGESAVGKSAIVTRF--STGKYLRNNATIGAAYVTKDLE-YIRDGDVYQ---VRL 64

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKV---GDDDLV 119
           EIWDTAGQERY+SL PMYYRN + A+VV+D++   SL  A  W+DEL   V   G + + 
Sbjct: 65  EIWDTAGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERIN 124

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           I L+GNK+DLC                DEE+           Q  +EQ   F+ VSAK+G
Sbjct: 125 IVLVGNKMDLC---------------SDEERST-------LPQRVEEQ---FQAVSAKSG 159

Query: 180 EGVKEIFQDI 189
           EG++E+F  I
Sbjct: 160 EGIEELFDHI 169

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  131 bits (330), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 117/194 (60%), Gaps = 29/194 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLD--------DKTI 61

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           + ++WDTAGQER++SL P Y R+++ A+VVYD+T + S +    W++++K++ G++++++
Sbjct: 62  RLQLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVIL 121

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKTG 179
            ++GNK DL  E                    R +STEE ++ AQ     +F E S K G
Sbjct: 122 CIVGNKNDLVDE--------------------RQVSTEEGERKAQVLNAKIFMETSTKAG 161

Query: 180 EGVKEIFQDIGEKL 193
             VK +F+ I + L
Sbjct: 162 FNVKNLFKKIAKSL 175

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  131 bits (330), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 109/193 (56%), Gaps = 29/193 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F +++I        E +   +K +
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTI--------EVEGKKVKAQ 66

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQERY+++   YYR A  AL+VYDI++  S +   +W+ EL+    D+++ + L+
Sbjct: 67  IWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELREN-ADENVAVGLI 125

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                      +RA+ T+EAK +AQ   +LF E SA   E V 
Sbjct: 126 GNKSDLAH--------------------LRAVPTDEAKNFAQGNQMLFTETSALNAENVD 165

Query: 184 EIFQDIGEKLYDL 196
             F+++   +Y +
Sbjct: 166 LAFRELITAIYQM 178

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  130 bits (328), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 102/177 (57%), Gaps = 28/177 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+VLLGDSSVGK+SIV R     F     +TIGAAF++++I +  ND +  K   I  E
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKR--IHME 62

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQERYKSL PMYYR+AN AL+V+++    SLQ A+ W  +L+++     ++I  +
Sbjct: 63  IWDTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--V 120

Query: 124 GNKVDL-CQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           GNK DL C+E     T P                       A+ QGL +  VSAKTG
Sbjct: 121 GNKYDLVCEEHSGEVTIP-----------------------AELQGLPYVAVSAKTG 154

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  131 bits (329), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 116/194 (59%), Gaps = 29/194 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLD--------DKTI 60

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           + ++WDTAGQER++SL P Y R++  A+VVYDIT+  S +    W++++KN+ G +++++
Sbjct: 61  RLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVIL 120

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKTG 179
            ++GNK DL  E                    R ++ EE ++ AQ+ G  +F + S K G
Sbjct: 121 CVVGNKSDLADE--------------------RQVTAEEGEKKAQDLGAKIFMQTSTKVG 160

Query: 180 EGVKEIFQDIGEKL 193
             VK +F+ I + L
Sbjct: 161 YNVKNLFKKIAKSL 174

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  126 bits (316), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 67/194 (34%), Positives = 115/194 (59%), Gaps = 29/194 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYLD--------DKTI 60

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
           + ++WDTAGQER++SL P Y R+++ A+VVYD+T   S +    W++++K + G++++++
Sbjct: 61  RLQLWDTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVIL 120

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKTG 179
            ++GNK DL +E                    R +STEE ++ +      LF E S K G
Sbjct: 121 VIVGNKSDLVEE--------------------RQVSTEEGERKSTVLNAKLFIETSTKAG 160

Query: 180 EGVKEIFQDIGEKL 193
             VK +F+ I + L
Sbjct: 161 FNVKTLFKKIAKLL 174

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  125 bits (314), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 113/192 (58%), Gaps = 29/192 (15%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+++ +         D  I+ 
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYLD--------DRTIRL 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYL 122
           ++WDTAGQER++SL P Y R+++ A+VVYDIT + S +    WV++++N+ G+++L++ +
Sbjct: 64  QLWDTAGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCI 123

Query: 123 LGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQ-EQGLLFREVSAKTGEG 181
           +GNK DL  E                    R ++ EE +  A+     +F E S K G  
Sbjct: 124 VGNKSDLVDE--------------------RKVTVEEGENKAKLLNAKIFVETSTKAGFN 163

Query: 182 VKEIFQDIGEKL 193
           V  +F+ I + L
Sbjct: 164 VGALFKRIAKLL 175

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  110 bits (276), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 106/191 (55%), Gaps = 30/191 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T+   DG    D V   +
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV---DG----DKVATMQ 61

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPF 121

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTG 179
            +LGNK+D+                  EE K + ++T  +++ A+  G + F   SAK  
Sbjct: 122 VILGNKIDV------------------EESK-KVVTTRTSQELAKSLGNIPFFLTSAKNA 162

Query: 180 EGVKEIFQDIG 190
             V + F++I 
Sbjct: 163 INVDDAFEEIA 173

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  108 bits (270), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 97/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F  +++ I+           +K +
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDINGKR--------VKLQ 72

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   +++YD+T E + +  R W   + N+   +D+V+ L+
Sbjct: 73  LWDTAGQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTV-NQHASEDVVMLLV 131

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                       R +S E+ +  A+E G+ F E SAK    V 
Sbjct: 132 GNKKDM---------------------DTRTVSYEQGEALAKELGIPFIEASAKDDTNVS 170

Query: 184 EIF 186
           EIF
Sbjct: 171 EIF 173

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  108 bits (269), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 99/183 (54%), Gaps = 29/183 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR A+  ++VYD+T ++S    + W+ E+ ++ G   ++  L+
Sbjct: 61  IWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL  +                    + + TE AK++A   G+ F E SA     V+
Sbjct: 120 GNKNDLTDK--------------------KVVDTEVAKEFADSIGIPFIETSALDSSNVE 159

Query: 184 EIF 186
           E F
Sbjct: 160 EAF 162

>Scas_674.5
          Length = 208

 Score =  108 bits (269), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 103/192 (53%), Gaps = 32/192 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +TI         D V   +
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTID-------DDKVATMQ 61

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPF 121

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG--LLFREVSAKT 178
            +LGNKVD+                 DE +KV  +S   A++ A+  G   LF   SAK 
Sbjct: 122 VILGNKVDI-----------------DETKKV--VSANAAQELAKSLGNTPLFM-TSAKD 161

Query: 179 GEGVKEIFQDIG 190
              +   F++I 
Sbjct: 162 SINIDNAFEEIA 173

>Kwal_47.19055
          Length = 179

 Score =  106 bits (265), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 90/164 (54%), Gaps = 29/164 (17%)

Query: 33  ESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYD 92
           +STIG  F +++I        E +   IK +IWDTAGQERY+++   YYR A  AL+VYD
Sbjct: 4   KSTIGVEFATRTI--------EVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYD 55

Query: 93  ITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKV 152
           I++  S +   +W+ EL+    D+++ + L+GNK DL                      +
Sbjct: 56  ISKSSSYENCNHWLTELREN-ADENVAVGLIGNKSDLAH--------------------L 94

Query: 153 RAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKLYDL 196
           RA+ T+EAK +AQE  LLF E SA   E V + F+++   +Y +
Sbjct: 95  RAVPTDEAKNFAQENQLLFTETSALNSENVDQAFRELISAIYQM 138

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  107 bits (267), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 105/192 (54%), Gaps = 32/192 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T+        +D V   +
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVD-------EDKVATMQ 61

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPF 121

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG--LLFREVSAKT 178
            +LGNK+D+                  EE K + ++T  A++ A+  G   LF   SAK 
Sbjct: 122 VILGNKIDV------------------EESK-KVVNTRSAQELAKSLGNVPLFL-TSAKG 161

Query: 179 GEGVKEIFQDIG 190
              V+  F++I 
Sbjct: 162 SINVETAFEEIA 173

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  106 bits (265), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 98/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +++ I+           IK +
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKK--------IKLQ 72

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E +    + W+  + N+  +D+  + L+
Sbjct: 73  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTV-NQHANDEAQLLLV 131

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                       RA++ E+ +  ++E GL F E SAK  + V 
Sbjct: 132 GNKSDM---------------------DTRAVTYEQGEALSKELGLPFVEASAKNDDNVN 170

Query: 184 EIF 186
           EIF
Sbjct: 171 EIF 173

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  106 bits (265), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 81/128 (63%), Gaps = 10/128 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ +T+   DG    D V   +
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV---DG----DKVATMQ 61

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPF 121

Query: 121 YLLGNKVD 128
            +LGNK+D
Sbjct: 122 VILGNKID 129

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score =  105 bits (262), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 90/164 (54%), Gaps = 29/164 (17%)

Query: 33  ESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYD 92
           +STIG  F +++I        E +   IK +IWDTAGQERY+++   YYR A  AL+VYD
Sbjct: 4   KSTIGVEFATRTI--------EVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYD 55

Query: 93  ITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKV 152
           I++ +S +   +W+ EL+    D+++ + L+GNK DL                      +
Sbjct: 56  ISKSNSYENCNHWLTELREN-ADENVAVGLIGNKSDLAH--------------------L 94

Query: 153 RAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKLYDL 196
           RA+ T+EAK +AQE  LLF E SA   E V   F+++   +Y +
Sbjct: 95  RAVPTDEAKNFAQENQLLFTETSALNSENVDLAFRELITAIYQM 138

>Kwal_56.22440
          Length = 208

 Score =  105 bits (263), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 82/129 (63%), Gaps = 10/129 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ +++   DG    D V   +
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSM---DG----DKVATMQ 61

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPF 121

Query: 121 YLLGNKVDL 129
            +LGNK+D+
Sbjct: 122 VILGNKLDV 130

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  105 bits (262), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 80/129 (62%), Gaps = 10/129 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +         D V+  +
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD-------DKVVTMQ 61

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S +  ++W DE     N    +    
Sbjct: 62  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPF 121

Query: 121 YLLGNKVDL 129
            +LGNKVD+
Sbjct: 122 VILGNKVDI 130

>Kwal_23.5058
          Length = 213

 Score =  105 bits (262), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 97/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +++ I+           +K +
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDINGKK--------VKLQ 72

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E +    + W   + N+  +D+  + L+
Sbjct: 73  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTV-NQHANDEAQLLLV 131

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                       RA+ST++ +  A+E G+ F E SAK    V 
Sbjct: 132 GNKSDM---------------------DTRAVSTDQGESLAKELGIPFVEASAKDDTNVN 170

Query: 184 EIF 186
           +IF
Sbjct: 171 DIF 173

>Scas_656.2
          Length = 218

 Score =  105 bits (262), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 98/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F  +++ I            IK +
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQGRK--------IKLQ 78

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E + Q  R W   + N+  ++ + + L+
Sbjct: 79  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTV-NEHANEQVQLLLV 137

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                       R ++ E+ ++ A+E GL F E SAK  + V 
Sbjct: 138 GNKSDLGN---------------------RQVTKEQGEELARELGLPFMEASAKNDDNVN 176

Query: 184 EIF 186
           ++F
Sbjct: 177 DLF 179

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  104 bits (260), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 104/193 (53%), Gaps = 34/193 (17%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ + +  ND     D V   +
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV--ND-----DKVATMQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLVI 120
           +WDTAGQER++SL   +YR A+  ++VYD+T   S    ++W DE     N    +    
Sbjct: 61  VWDTAGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPF 120

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG---LLFREVSAK 177
            +L NKVD+                  EE K + +S+  A++ A+  G   L F   SAK
Sbjct: 121 VILANKVDV------------------EESK-KVVSSRSAQEQAKSLGNVPLFF--TSAK 159

Query: 178 TGEGVKEIFQDIG 190
               V++ F++I 
Sbjct: 160 DSINVQDAFEEIA 172

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  105 bits (261), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 98/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +++ I+           IK +
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDINGKK--------IKLQ 71

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E + +  R W   + N+  +++  + L+
Sbjct: 72  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTV-NQHANEEAQLLLV 130

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                       RA++ E+ +  A+E G+ F E SAK  E V 
Sbjct: 131 GNKKDM---------------------DTRAVTYEQGESLAKELGVPFIEASAKDDENVS 169

Query: 184 EIF 186
           +IF
Sbjct: 170 DIF 172

>Scas_707.26
          Length = 210

 Score =  104 bits (260), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 97/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +++ I+           +K +
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK--------VKLQ 68

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E +    + W   + N+  +D+  + L+
Sbjct: 69  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTV-NEHANDEAQLLLV 127

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                       R ++ E+ +  A+E GL F E SAK  + V 
Sbjct: 128 GNKSDM---------------------DTRVVTYEQGESLAKELGLPFIESSAKNDDNVN 166

Query: 184 EIF 186
           EIF
Sbjct: 167 EIF 169

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  104 bits (259), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 97/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +++ I+           +K +
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK--------VKLQ 72

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E +    + W   + N+  +D+  + L+
Sbjct: 73  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTV-NEHANDEAQLLLV 131

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                       R ++ E+ +  A+E GL F E SAK  + V 
Sbjct: 132 GNKSDM---------------------DTRVVTYEQGEALAKELGLPFIESSAKNDDNVN 170

Query: 184 EIF 186
           EIF
Sbjct: 171 EIF 173

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  102 bits (255), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 98/183 (53%), Gaps = 30/183 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +++ I+           +K +
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK--------VKLQ 72

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQER++++   YYR A   ++VYD+T E +    + W   + N+  +D+  + L+
Sbjct: 73  LWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTV-NEHANDEAQLLLV 131

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK D+                     + R ++ ++ +  A+E G+ F E SAK  + V 
Sbjct: 132 GNKSDM---------------------ETRVVTADQGEALAKELGIPFIESSAKNDDNVN 170

Query: 184 EIF 186
           EIF
Sbjct: 171 EIF 173

>Kwal_14.1116
          Length = 204

 Score =  101 bits (251), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 99/190 (52%), Gaps = 29/190 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR A+  ++VYD+T  DS    + W+ E+ ++     ++  ++
Sbjct: 61  IWDTAGQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                    Q  R +  + AK++A    + F E SA     V+
Sbjct: 120 GNKSDL--------------------QDKRMVEYDVAKEFADSLQIPFLETSALDSSNVE 159

Query: 184 EIFQDIGEKL 193
           E F  + +++
Sbjct: 160 EAFLTMAKQI 169

>Scas_713.5
          Length = 211

 Score =  101 bits (251), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 99/190 (52%), Gaps = 29/190 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+G+S VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR ++  ++VYD+T +DS    + W+ E+ ++     ++  L+
Sbjct: 61  IWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL  +                    R +  + AK++A    + F E SA     V+
Sbjct: 120 GNKCDLTDK--------------------RVVEYDVAKEFADANKMPFLETSALNSTNVE 159

Query: 184 EIFQDIGEKL 193
           E F  +  ++
Sbjct: 160 EAFLTMARQI 169

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  100 bits (249), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 100/190 (52%), Gaps = 29/190 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+G+S VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR ++  ++VYD+T ++S    + W+ E+ ++     ++  L+
Sbjct: 61  IWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL  +                    R +  + AK++A+   + F E SA     V+
Sbjct: 120 GNKCDLADK--------------------RVVEYDVAKEFAEANKMPFLETSALDSTNVE 159

Query: 184 EIFQDIGEKL 193
           E F  +  ++
Sbjct: 160 EAFLTMARQI 169

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score = 99.8 bits (247), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 102/190 (53%), Gaps = 29/190 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR A+  ++VYD+T ++S    + W+ E+ ++ G   +V  L+
Sbjct: 61  IWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                  +++KV  +  E A+++A    +   E SA     V+
Sbjct: 120 GNKNDL------------------KDKKV--VDFEVAREFADSLNIPVLETSALDSSNVE 159

Query: 184 EIFQDIGEKL 193
           E F  +  ++
Sbjct: 160 EAFLTMARQI 169

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score = 99.8 bits (247), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 99/190 (52%), Gaps = 29/190 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR A+  ++VYD+T ++S    + W+ E+ ++ G   ++  L+
Sbjct: 61  IWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL  +                    + +  E AK++A    +   E SA     V+
Sbjct: 120 GNKNDLTDK--------------------KVVEYEVAKEFADSLQIPVLETSALDSSNVE 159

Query: 184 EIFQDIGEKL 193
           E F  +  ++
Sbjct: 160 EAFLTMARQI 169

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score = 97.1 bits (240), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 99/190 (52%), Gaps = 29/190 (15%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKL+L+G+S VGKS ++ RF  DT+     STIG  F  +++ +   DG       +K +
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL---DGK-----TVKLQ 60

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           IWDTAGQER++++   YYR ++  ++VYD+T ++S    + W+ E+ ++     ++  L+
Sbjct: 61  IWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLV 119

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK DL                    +  R +  + AK++A    + F E SA     V+
Sbjct: 120 GNKCDL--------------------KDKRVVEYDVAKEFADANKMPFLETSALDSTNVE 159

Query: 184 EIFQDIGEKL 193
           + F  +  ++
Sbjct: 160 DAFLTMARQI 169

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 95/190 (50%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +  H N G       IKF+
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLAFHTNFGE------IKFD 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++ I L 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 118 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 155

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 156 KPFLWLARKL 165

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 85.1 bits (209), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 97/190 (51%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       ++ + N G       IKF+
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLSFYTNFGE------IKFD 64

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA  A++++D+T   + +   NW  +L      +++ I L 
Sbjct: 65  VWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 122

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 123 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 160

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 161 KPFLWLARKL 170

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 85.1 bits (209), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 97/190 (51%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       ++ + N G       IKF+
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV--HPLSFYTNFGE------IKFD 65

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA  A++++D+T   + +   NW  +L      +++ I L 
Sbjct: 66  VWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 123

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 124 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 161

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 162 KPFLWLARKL 171

>Scas_691.36
          Length = 212

 Score = 84.3 bits (207), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 96/187 (51%), Gaps = 25/187 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++        DG       ++  +
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEV----DGRR-----VELAL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + I   DSL+  +  W+ E+ +      + I L+
Sbjct: 63  WDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILV 120

Query: 124 GNKVDLCQETPSTETSPDSNEG--GDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGE 180
           G KVDL          P + E    DE+Q V   ST E +  A++ G   + E SAKTG 
Sbjct: 121 GCKVDL-------RNDPQAIEALRADEQQPV---STAEGQSVAEQIGATGYYECSAKTGL 170

Query: 181 GVKEIFQ 187
           GV+E+F+
Sbjct: 171 GVREVFE 177

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 83.2 bits (204), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 95/190 (50%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +  + N G       IKF+
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVE--VHPLAFYTNFGE------IKFD 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++ I L 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 118 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 155

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 156 KPFLWLARKL 165

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 83.2 bits (204), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 95/190 (50%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +  + N G       IKF+
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVE--VHPLAFYTNFGE------IKFD 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++ I L 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 118 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 155

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 156 KPFLWLARKL 165

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 95/190 (50%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +  + N G       IKF+
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVE--VHPLAFYTNFGE------IKFD 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++ I L 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 118 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 155

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 156 KPFLWLARKL 165

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 95/190 (50%), Gaps = 32/190 (16%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
           FKLVL+GD   GK++ V R +   F++   +TIG       +  + N G       IKF+
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVE--VHPLAFYTNFGE------IKFD 59

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           +WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++ I L 
Sbjct: 60  VWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLC 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNKVD+                  +E+KV+A +      + +++ L + ++SAK+    +
Sbjct: 118 GNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSNYNFE 155

Query: 184 EIFQDIGEKL 193
           + F  +  KL
Sbjct: 156 KPFLWLARKL 165

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 89/185 (48%), Gaps = 24/185 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+S+++ F    F E    T+        +T    DG     + +   +
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTV----FENYVTDCRVDG-----IKVSLTL 59

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y+ L P  Y  A+  L+ + +   +SL  AR  W DE      D  +V  L+
Sbjct: 60  WDTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LV 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKTGEGV 182
           G K DL QE    E + D             +  E+AKQ A+  G   + E SA TGEGV
Sbjct: 118 GLKKDLRQEAHFKENATDE-----------MVPIEDAKQVARAIGAKKYMECSALTGEGV 166

Query: 183 KEIFQ 187
            ++F+
Sbjct: 167 DDVFE 171

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 92/185 (49%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+        +T    DG       ++  +
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTV----FENYVTDVEVDGRH-----VELTL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P  Y ++N  L+ + I   DSL   +  W++E+        + I L+
Sbjct: 63  WDTAGQEDYDRLRPFSYPDSNVVLICFSIDLPDSLDNVQEKWINEVLYFC--KGVPIILV 120

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G KVDL  +T + ET     +        R +ST + +  A   G + + E SAK+G GV
Sbjct: 121 GCKVDLRDDTQTIETLKAIGQ--------RPVSTTDGQTVADRIGAVGYYECSAKSGLGV 172

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 173 REVFE 177

>Scas_586.6
          Length = 219

 Score = 82.0 bits (201), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 96/195 (49%), Gaps = 42/195 (21%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHP-----NDGNETKDV 58
           FKLVL+GD   GK++ V R +   F++   +TIG       + +HP     N G      
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIG-------VEVHPLSFFTNYGE----- 60

Query: 59  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDL 118
            IKF+ WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++
Sbjct: 61  -IKFDCWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENI 117

Query: 119 VIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKT 178
            I L GNKVD+                  +E+KV+A +      + +++ L + ++SAK+
Sbjct: 118 PIVLCGNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKS 155

Query: 179 GEGVKEIFQDIGEKL 193
               ++ F  +  KL
Sbjct: 156 NYNFEKPFLWLARKL 170

>Kwal_56.23361
          Length = 214

 Score = 81.6 bits (200), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 97/194 (50%), Gaps = 40/194 (20%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHP----NDGNETKDVV 59
           FKLVL+GD   GK++ V R +   F++   +TIG       + +HP     D  E     
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIG-------VEVHPLAFYTDFGE----- 55

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           +KF++WDTAGQE++  L   YY NA   ++++D+T   + +   NW  +L      +++ 
Sbjct: 56  LKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIP 113

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           I L GNKVD+                  +E+KV+A +      + +++ L + ++SAK+ 
Sbjct: 114 IVLCGNKVDV------------------KERKVKAKTI----TFHRKKNLQYYDISAKSN 151

Query: 180 EGVKEIFQDIGEKL 193
              ++ F  +  KL
Sbjct: 152 YNFEKPFLWLARKL 165

>Scas_610.4
          Length = 211

 Score = 80.5 bits (197), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/185 (30%), Positives = 95/185 (51%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++        DG       ++  +
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEV----DGRR-----VELAL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + I   DSL+  +  W+ E+ +      + I L+
Sbjct: 63  WDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILV 120

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G KVDL          P + E   EE + + +S+ + +  A + G   + E SAKTG GV
Sbjct: 121 GCKVDL-------RNDPQTIEALREEGQ-QPVSSADGQSVADQIGATGYYECSAKTGFGV 172

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 173 REVFE 177

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 81.3 bits (199), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 99/196 (50%), Gaps = 16/196 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNET--KDV 58
           M   K V++GD +VGK+S++  +  ++F +     I   F + S TI   D   +  +  
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQ---DYIPTVFDNYSTTIAVQDPASSTGEQQ 73

Query: 59  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDD 117
           + K  +WDTAGQE Y  L P+ Y   +  L+ + I +  S Q  R+ W  E+K+    ++
Sbjct: 74  LFKLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYEN 133

Query: 118 LVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTE-----EAKQYAQEQGLL-F 171
           + ++L   K  +        T  D  +   EE ++R ++T+     E ++  Q+ G + +
Sbjct: 134 MELFLECGKYPILL----VGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGY 189

Query: 172 REVSAKTGEGVKEIFQ 187
            E SA T EGV+E+F+
Sbjct: 190 VECSAATQEGVREVFE 205

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 79.7 bits (195), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 96/185 (51%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++        DG       ++  +
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEV----DGRR-----VELAL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + I   DSL+  +  W+ E+ +      + I L+
Sbjct: 63  WDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILV 120

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G KVDL          P + E   +E + + ++++E +  A + G   + E SAKTG GV
Sbjct: 121 GCKVDL-------RNDPQTIEQLRQEGQ-QPVTSQEGQSVADQIGATGYYECSAKTGYGV 172

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 173 REVFE 177

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 93/185 (50%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++        DG       ++  +
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEV----DGRR-----VELAL 64

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ Y I   DSL+     W+ E+ +      + I L+
Sbjct: 65  WDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFC--QGVPIILV 122

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G K DL  +    E            Q ++ +S  +A++ A + G + + E SAKTG GV
Sbjct: 123 GCKADLRNDPQVVEEL--------RAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGV 174

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 175 REVFE 179

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 95/185 (51%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++        DG       ++  +
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEV----DGRR-----VELAL 64

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + I   DSL+     W+ E+ +      + I L+
Sbjct: 65  WDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILV 122

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G KVDL +  P    S  +N  G E      +S   A++ A + G + + E SAKTG GV
Sbjct: 123 GCKVDL-RNDPQVVESLRTN--GQE-----PVSQASAQEVADQIGAVEYIECSAKTGFGV 174

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 175 REVFE 179

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 93/184 (50%), Gaps = 21/184 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  + I   DG       ++  +
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVA-DVDI---DGRR-----VELAL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + +   DSL   +  WV E+ +      + I L+
Sbjct: 63  WDTAGQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFC--QGVPILLV 120

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTGEGV 182
           G KVDL          P   +    E + R ++  E    A + G + + E SA+TG+GV
Sbjct: 121 GCKVDL-------RNDPQVLQQLQAEGQ-RPVTAAEGSAVAGKIGAVAYLECSARTGQGV 172

Query: 183 KEIF 186
           KE+F
Sbjct: 173 KEVF 176

>Kwal_55.21937
          Length = 208

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 96/190 (50%), Gaps = 31/190 (16%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++        DG +     ++  +
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVQV----DGRQ-----VELAL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + I   DSL   +  W+ E+ +      + I L+
Sbjct: 63  WDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFC--QGVPIILV 120

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTE-----EAKQYAQEQGL-LFREVSAK 177
           G KVDL ++ P T             + +RAI  +     EA+  A + G   + E SAK
Sbjct: 121 GCKVDL-RDNPQT------------VEALRAIGQQPVTGPEAQSVADKIGASAYYECSAK 167

Query: 178 TGEGVKEIFQ 187
           TG GV+E+F+
Sbjct: 168 TGYGVREVFE 177

>Kwal_33.14452
          Length = 260

 Score = 80.5 bits (197), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 97/196 (49%), Gaps = 18/196 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V++GD +VGK+S++  +  +TF +     I   F + + TI  NDG+  +  V 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQ---DYIPTVFDNYTTTIALNDGDSAEPQVF 57

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLV 119
           +  +WDTAGQE Y  L P+ Y   +  L+ + I + +S +  ++ W  E+++    ++L 
Sbjct: 58  RLNLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLE 117

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRA-------ISTEEAKQYAQEQGLL-F 171
           ++       +C + P       ++   DE ++ R        +S  +  Q   + GL+ +
Sbjct: 118 LF------RVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGY 171

Query: 172 REVSAKTGEGVKEIFQ 187
            E SA T  GV ++F+
Sbjct: 172 VECSAATQVGVADVFE 187

>Kwal_55.21941
          Length = 209

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 97/188 (51%), Gaps = 21/188 (11%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ KLV++GD + GK+ ++  F K  F ++   T+   +++        DG       ++
Sbjct: 11  IRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEV----DGRR-----VE 61

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDDDLVI 120
             +WDTAGQE Y  L P+ Y ++N  L+ + I   DSL+     W+ E+ +      + I
Sbjct: 62  LALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPI 119

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTG 179
            L+G KVDL  ++   E   +    G E      +S   A++ A++ G + + E SAKTG
Sbjct: 120 ILVGCKVDLRNDSQVIE---NLRANGHE-----PVSQGAAQEVAEQIGAVEYIECSAKTG 171

Query: 180 EGVKEIFQ 187
            GV+E+F+
Sbjct: 172 YGVREVFE 179

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 77.8 bits (190), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 94/185 (50%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++        DG       ++  +
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEV----DGRR-----VELAL 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ + I   DSL+  +  W+ E+ +      + I L+
Sbjct: 63  WDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILV 120

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G KVDL  +  + E            + ++ ++T + +  A + G   + E SAKTG GV
Sbjct: 121 GCKVDLRNDPQTLEQL--------RAEGLQPVATADGQNVADQIGATGYYECSAKTGYGV 172

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 173 REVFE 177

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 77.0 bits (188), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 92/185 (49%), Gaps = 21/185 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++        DG       ++  +
Sbjct: 13  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVADVEV----DGRR-----VELAL 63

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y  L P+ Y ++N  L+ Y I   DSL+     W+ E+        + I L+
Sbjct: 64  WDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFC--QGVPIILV 121

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
           G K DL  +    E           +Q  + +S  +A++ A + G + + E SAKTG GV
Sbjct: 122 GCKADLRNDPQVIEQL--------RQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGV 173

Query: 183 KEIFQ 187
           +E+F+
Sbjct: 174 REVFE 178

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 76.3 bits (186), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 94/185 (50%), Gaps = 29/185 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+S+++ F    F E    T+   +++        DG     + ++  +
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDCRV----DG-----IKVQLTL 59

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y+ L P  Y  A+  L+ + I   +SL  ARN W +E+     +  +V  L+
Sbjct: 60  WDTAGQEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LV 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKTGEGV 182
           G K DL         SPD     +E Q V   + E+A+Q A+  G   + E SA TGE V
Sbjct: 118 GLKKDL--------RSPD-----NEHQMV---TREQAEQVARAIGAKKYMECSALTGENV 161

Query: 183 KEIFQ 187
            ++F+
Sbjct: 162 DDVFE 166

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 77.4 bits (189), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 99/200 (49%), Gaps = 24/200 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIH-PNDGN-ETKDV 58
           M   K V++GD +VGK+S++  +  +TF +     I   F + S TI  P+  N +++  
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQ---DYIPTVFDNYSTTIALPDPYNPDSEPQ 57

Query: 59  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDD 117
           + K  +WDTAGQE Y  L P+ Y   +  L+ + + + +S +   + W  E+K+    ++
Sbjct: 58  IFKLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFEN 117

Query: 118 LVIY---------LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG 168
           L +Y         L+G K DL  +        D      +E     +S ++ ++   + G
Sbjct: 118 LDLYHQSGKLPILLVGTKADLRDD--------DHERDRLQESNSDFVSQQQIQELVNKLG 169

Query: 169 LL-FREVSAKTGEGVKEIFQ 187
           L+ + E SA T  GV+E+F+
Sbjct: 170 LMGYVECSAATQVGVREVFE 189

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 91/189 (48%), Gaps = 28/189 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           +++ KLV++GD + GK+S+++ F    F E    T+        +T    DG     + +
Sbjct: 5   VVRRKLVIIGDGACGKTSLLYVFTLGKFPEEYHPTV----FENYVTDCRVDG-----IKV 55

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLV 119
           +  +WDTAGQE Y+ L P  Y  AN  L+ + I   +SL  AR  W +E         +V
Sbjct: 56  QLALWDTAGQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV 115

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKT 178
             L+G K DL             + G  EE     ++ E A+Q A+  G   + E SA T
Sbjct: 116 --LVGLKKDL-----------RKSVGNGEE----VVTREAAEQVARAIGAKRYMECSALT 158

Query: 179 GEGVKEIFQ 187
           GEGV +IF+
Sbjct: 159 GEGVDDIFE 167

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 75.5 bits (184), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 91/188 (48%), Gaps = 27/188 (14%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           +++ KLV++GD + GK+S++H F    F E    T+   +++               + +
Sbjct: 5   VVRRKLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTDC---------RVDGIKV 55

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLV 119
           +  +WDTAGQE Y+ L PM Y  A+  L+ + I    SL  AR  W  E      +  ++
Sbjct: 56  QLALWDTAGQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYCPNAPII 115

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
             L+G K DL    P T+ +  +      ++ VRAI    AK+Y         E SA TG
Sbjct: 116 --LVGLKKDL--RRPGTQCAMVAPS--QAQEVVRAIG---AKKYM--------ECSALTG 158

Query: 180 EGVKEIFQ 187
           EGV ++F+
Sbjct: 159 EGVDDVFE 166

>Scas_578.7
          Length = 187

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/185 (31%), Positives = 89/185 (48%), Gaps = 29/185 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+S+++ F    F +    T+        +T    DG     + +   +
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTV----FENYVTDCRVDG-----IKVSLTL 59

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y+ L P  Y  A+  L+ + I   +SL  ARN W +E      +  ++  L+
Sbjct: 60  WDTAGQEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYCPEAPII--LV 117

Query: 124 GNKVDLCQETPSTE-TSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGV 182
           G K DL Q+    E   P+     D +Q  R I    AK+Y         E SA TGEGV
Sbjct: 118 GLKKDLRQKQDGVEMVKPE-----DAQQVARIIG---AKKYV--------ECSALTGEGV 161

Query: 183 KEIFQ 187
            ++F+
Sbjct: 162 DDVFE 166

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 75.1 bits (183), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 96/202 (47%), Gaps = 26/202 (12%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+V+LGD + GK+S+++ F +  F E+ E T+   ++            ++K   I 
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-------DSKH--IT 65

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVI 120
             +WDTAGQE +  L  + Y +    ++ + I   DSL+  +N WV E+ +      LV+
Sbjct: 66  LSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVL 125

Query: 121 YLLGNKVDL-CQETPSTETSPD--------SNEGGDEEQKV----RAISTEEAKQYAQEQ 167
             L  K DL   E  S   +P+        SN+ G+           IS EE    A++ 
Sbjct: 126 VAL--KCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKI 183

Query: 168 GLL-FREVSAKTGEGVKEIFQD 188
           G L + E SAK  +GV E F +
Sbjct: 184 GALRYLECSAKLNKGVNEAFTE 205

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 73.9 bits (180), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 90/185 (48%), Gaps = 28/185 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KLV++GD + GK+S+++ F    F E    T+        +T    DG     + +   +
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTV----FENYVTDCRVDG-----IKVSLAL 59

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIYLL 123
           WDTAGQE Y+ L P  Y  A+  L+ + +   +SL  AR  W +E      D  ++  L+
Sbjct: 60  WDTAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LV 117

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL-LFREVSAKTGEGV 182
           G K DL +                +++ +  ++ E+A+Q A+  G   + E SA TGEGV
Sbjct: 118 GLKEDLRK---------------SKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGV 162

Query: 183 KEIFQ 187
            ++F+
Sbjct: 163 DDVFE 167

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 74.7 bits (182), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 89/186 (47%), Gaps = 13/186 (6%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           K+V+LGD + GK+S+++ F +  F E+ E T+   ++      + +         I   +
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDNRH---------ITLSL 72

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIYLL 123
           WDTAGQE +  L  + Y + +  ++ + I   DSL+  +N WV E+ +     +LV+  L
Sbjct: 73  WDTAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLVLVAL 132

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGV 182
             K DL     +  T  +     +       I+ EE    A++ G L + E SAK  +GV
Sbjct: 133 --KCDLRNNENNVITPNNIQNNRNNNNNNNLITYEEGLAMAKQIGALRYLECSAKLNKGV 190

Query: 183 KEIFQD 188
            E F +
Sbjct: 191 NEAFTE 196

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 72.0 bits (175), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 92/192 (47%), Gaps = 14/192 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E TI   ++      + +         I 
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTIFENYIHDIFVDNQH---------IS 63

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVI 120
             +WDTAGQE +  L  + Y + +  ++ + +   DSL+  +N WV E+ +      LV+
Sbjct: 64  LSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHCEGVKLVL 123

Query: 121 YLLGNKVDLCQE--TPSTETSPDSNEGGDEEQKVRA-ISTEEAKQYAQEQGLL-FREVSA 176
             L   +   +E    S   +P S +  +   K    IS EE    A++ G L + E SA
Sbjct: 124 VALKCDLRNLEEFGNESAAITPGSIQNRNSNAKDNGLISYEEGLDMAKKIGALRYLECSA 183

Query: 177 KTGEGVKEIFQD 188
           K   GV E F +
Sbjct: 184 KMNRGVNEAFTE 195

>Scas_444.4*
          Length = 289

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 89/187 (47%), Gaps = 27/187 (14%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
              K+V++GD  VGK+ ++  +V+  F       I   F +        DG      V++
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQREFPT---GDIPTVFENYVTDFEGPDGE-----VVE 113

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQK-ARNWVDELKNKVGDDDLVI 120
             +WDTA QE Y  L P+ Y + +  LV Y +    SL+   R+W+ E+K+      ++ 
Sbjct: 114 LALWDTAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI- 172

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFR-EVSAKTG 179
            L+G K DL           DSNE  D       +  +EA+Q A++ G L   + SAKT 
Sbjct: 173 -LVGLKSDLY----------DSNENTDT-----LVDPKEAEQLAEKLGALAHLQCSAKTR 216

Query: 180 EGVKEIF 186
           + V+++F
Sbjct: 217 QNVEDVF 223

>Scas_547.3
          Length = 223

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 101/195 (51%), Gaps = 25/195 (12%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L + + I  ++        I 
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSN--------IV 74

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
           F + D  GQ+ + ++ P+   N++  + ++D+T+ +SL+  +NW  +      + D V  
Sbjct: 75  FSLMDLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWYMQAHGL--NHDAVCI 132

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           L+G K DL  + P+           + ++++   S + A+  A +  L+F   S+     
Sbjct: 133 LVGTKYDLFIDLPT-----------EYQEQISRTSMKYAQ--AMDSPLIFS--SSIASIN 177

Query: 182 VKEIFQDIGEKLYDL 196
           +++IF+    K++DL
Sbjct: 178 IQKIFKIALAKVFDL 192

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 91/198 (45%), Gaps = 26/198 (13%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E T+   ++      + +         I 
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIFVDNQH---------IT 64

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVI 120
             +WDTAGQE +  L  + Y + +  ++ + +   DSL+  +N WV E+ +      LV+
Sbjct: 65  LSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHCEGVKLVL 124

Query: 121 YLLGNKVDLCQE---------TPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL- 170
             L  K DL            TP +  +   N GG        I  +E    A++ G L 
Sbjct: 125 VAL--KCDLRSSDEYGNESAITPGSIQNQKYNGGGGNG----LIPYDEGLAMAKQIGALR 178

Query: 171 FREVSAKTGEGVKEIFQD 188
           + E SAK   GV E F +
Sbjct: 179 YLECSAKMNRGVNEAFTE 196

>Scas_417.3
          Length = 291

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 97/209 (46%), Gaps = 33/209 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPND--------G 52
           M Q K V++GD +VGK+S++  +  +TF +     I   F + S TI   D         
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQ---DYIPTVFDNYSTTISLRDPFLSRESLA 57

Query: 53  NETKD---VVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDE 108
           NE ++    + K  +WDTAGQE Y  L P+ Y   +  L+ + + +  S +   + W+ E
Sbjct: 58  NENENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPE 117

Query: 109 LKNKVGDDD---------LVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEE 159
           +K     +          L I L+G K DL  +        ++ +   +E   + I+ ++
Sbjct: 118 IKQNANVESSELFLQFGKLPIMLIGTKADLRDD--------EAVQKKLQETNSQFITRDQ 169

Query: 160 AKQYAQEQGLL-FREVSAKTGEGVKEIFQ 187
             Q   + G L + E SA T  GV+E+F+
Sbjct: 170 IDQVVDKYGFLGYVECSAATQMGVREVFE 198

>Scas_677.20
          Length = 283

 Score = 70.1 bits (170), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 91/190 (47%), Gaps = 9/190 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K  ++GD  VGK+ ++  +  +TF      T+   + S +IT+ P    + +    
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLV 119
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + +    SL   ++ WV E+KN   +D+L 
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSKWVPEIKNSFNEDELK 119

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKT 178
           ++   N+       P       ++   D+E   +  + E  +    + G + + E SA +
Sbjct: 120 VFQSRNRF------PMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYVECSALS 173

Query: 179 GEGVKEIFQD 188
             G+K++F++
Sbjct: 174 QMGIKDVFEE 183

>Scas_703.41
          Length = 225

 Score = 68.9 bits (167), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 71/124 (57%), Gaps = 12/124 (9%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDT 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + + +H  D        I F + D 
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLHSTD--------IVFSLMDL 76

Query: 68  AGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI-YLLGNK 126
            GQ+ + ++ P+    ++  + ++D+T+ ++L   ++W  ++K   G +D+ I  L+G K
Sbjct: 77  GGQKEFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVK---GLNDIAIPILVGTK 133

Query: 127 VDLC 130
            DL 
Sbjct: 134 YDLL 137

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 68.6 bits (166), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 97/197 (49%), Gaps = 29/197 (14%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + + +   D        + 
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVLGSTD--------VI 66

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
           F I D  GQ  + ++ P+    A A + ++D+T+ ++L   + W  + +    +D  +  
Sbjct: 67  FSIMDLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYRQARG--FNDTAISI 124

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQ--EQGLLFREVSAKTG 179
           L+G K DL       +  P+  E            +  A +YAQ  +  L+F   S ++ 
Sbjct: 125 LVGTKYDLF-----VDMDPEYQEN----------VSRTAMKYAQVMKSPLIF--CSTQSS 167

Query: 180 EGVKEIFQDIGEKLYDL 196
             V++IF+ +  K ++L
Sbjct: 168 INVQKIFKVVIAKAFNL 184

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 68.6 bits (166), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 95/196 (48%), Gaps = 27/196 (13%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I +   D        + 
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKINLGSTD--------VI 65

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
           F I D  GQ  + ++ P+    A A + ++D+T+ ++L   R W  + +   G ++  I 
Sbjct: 66  FSIMDLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYRQAR---GFNETAIP 122

Query: 122 LL-GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180
           LL G K DL           + +    EE       ++ + +YAQ  G      S  +  
Sbjct: 123 LLVGTKYDLFV---------NLDVAYQEEL------SKTSMRYAQVMGAPLVFCSTASSI 167

Query: 181 GVKEIFQDIGEKLYDL 196
            V++IF+ I  K ++L
Sbjct: 168 NVQKIFKVIIAKAFNL 183

>Kwal_47.16983
          Length = 223

 Score = 68.2 bits (165), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 93/193 (48%), Gaps = 25/193 (12%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+ IT+   +        I F 
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSKKITLGSAE--------ILFY 70

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLL 123
           I D  GQ  + ++ P+    A A + ++D+T+ ++L+  + W  +      ++  V  L+
Sbjct: 71  IMDLGGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHRQATG--FNEQAVPLLV 128

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           G K DL                 D E + +   ++++ +YAQ         S      V+
Sbjct: 129 GTKYDLFVNL-------------DPEYQAQI--SKQSMRYAQAMDAPLIFCSTSHSINVQ 173

Query: 184 EIFQDIGEKLYDL 196
           +IF+ +  KLY+L
Sbjct: 174 KIFKIVIAKLYNL 186

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 68.2 bits (165), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 97/206 (47%), Gaps = 36/206 (17%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIH---PNDGNETKD 57
           M   K V++GD +VGK+S++  +  +TF +     I   F + S TI    P+D +  ++
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQ---DYIPTVFDNYSTTIALADPSDLSAEQE 57

Query: 58  VVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDD 116
           V  K  +WDTAGQE Y  L P+ Y   +  ++ + + +  S +   + W  E+++    +
Sbjct: 58  V-FKLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYE 116

Query: 117 DLVIY---------LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTE-----EAKQ 162
           ++ ++         L+G K DL              E   E  ++R ++++     E   
Sbjct: 117 NMELFSSCGKFPILLVGTKADL-------------REDEHELDRLRELNSDFVDRHEIDH 163

Query: 163 YAQEQGLL-FREVSAKTGEGVKEIFQ 187
              + G + + E SA T  GV+E+F+
Sbjct: 164 AVSKCGFMGYVECSAATQFGVREVFE 189

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 67.0 bits (162), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 26/190 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F S+++ +          V+   EI
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKL--------GKVMYTLEI 77

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVG-DDDLVIYLL 123
            DTAGQ+ +  +           LVVY +    S +      D++ +++G D+++ + + 
Sbjct: 78  CDTAGQDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVA 137

Query: 124 GNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVK 183
           GNK+DLC         PD   GG+  Q  R    EE +Q A+  G  F E SAK    V+
Sbjct: 138 GNKIDLC---------PD---GGNNRQVTR----EEGQQLAKSLGAGFSECSAKLNWNVE 181

Query: 184 EIFQDIGEKL 193
           ++   + +K+
Sbjct: 182 DVMMLLLKKI 191

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 68.2 bits (165), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 97/219 (44%), Gaps = 40/219 (18%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFD--------ELRESTIGAAFLSQSITIHPNDG 52
           M   K V++GD +VGK+S++  +  ++F         +   +TI     + S  +  ++G
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNG 60

Query: 53  NE-------------TKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSL 99
           N+             T   + K  +WDTAGQE Y  L P+ Y   +  L+ + +++  S 
Sbjct: 61  NDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASF 120

Query: 100 QK-ARNWVDELKNKVGDDDLVIY---------LLGNKVDLCQETPSTETSPDSNEGGDEE 149
                 W+ ELK     +   +Y         L+G K DL ++ P+T+          +E
Sbjct: 121 ANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDL-RDDPATQKKL-------QE 172

Query: 150 QKVRAISTEEAKQYAQEQGLL-FREVSAKTGEGVKEIFQ 187
                +S EE  +  Q  G + + E SA T  GV+E+F+
Sbjct: 173 ANSDYVSQEEIDELVQRCGFMGYTECSAATQAGVREVFE 211

>Scas_671.35
          Length = 234

 Score = 67.0 bits (162), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (46%), Gaps = 28/204 (13%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+V+LGD + GK+S+++ F +  F E+ E T+   ++      + +         I 
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDNKH---------IT 65

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVI 120
             +WDTAGQE +  L  + Y + +  ++ + I   DSL   ++ WV E+ +      LV+
Sbjct: 66  LSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHCEGVKLVL 125

Query: 121 YLLGNKVDLCQE-------TPST---ETSPDSNEGGDEEQKVR-----AISTEEAKQYAQ 165
             L  K DL          TP     ++  DS     +++  R      IS EE    A+
Sbjct: 126 VAL--KCDLRNNDNERSAITPGVIKQQSQTDSVNDLQQQEYQRNNGNNLISYEEGLAMAK 183

Query: 166 EQGLL-FREVSAKTGEGVKEIFQD 188
           + G L + E SAK  +GV E F +
Sbjct: 184 KVGALRYLECSAKLNKGVNEAFTE 207

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 67.0 bits (162), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 11/128 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
             K+V++GD +VGK+ ++  +V+ TF      TI   +++    I   +G      +I+ 
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTN---IEGPNGQ-----IIEL 123

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIY 121
            +WDTAGQE Y  L P+ Y NA+  +V Y +  + SL+   + W  E+K+        I 
Sbjct: 124 ALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTP--IM 181

Query: 122 LLGNKVDL 129
           L+G K DL
Sbjct: 182 LVGLKSDL 189

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 66.6 bits (161), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 96/192 (50%), Gaps = 31/192 (16%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDT 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + ++I   D        I F + D 
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTD--------IVFSLMDL 84

Query: 68  AGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVG-DDDLVIYLLGNK 126
            GQ  + ++ P+    ++  ++++D+T+ ++L   + W    +  +G +D  +  L+G K
Sbjct: 85  GGQREFINMLPIATLGSSVIILLFDLTRPETLNSIKEW---YRQALGLNDSAIPILVGTK 141

Query: 127 VDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQ--EQGLLFREVSAKTGEGVKE 184
            DL                 D E++ +   ++ + +YAQ  +  L+F   S      +++
Sbjct: 142 YDLFI---------------DLEEEYQEKVSKTSMKYAQVMDAPLIF--CSTAKSINIQK 184

Query: 185 IFQDIGEKLYDL 196
           IF+    K++DL
Sbjct: 185 IFKVALAKIFDL 196

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 89/188 (47%), Gaps = 21/188 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V++GD +VGK+ ++  +  + F       +   F + ++T+   D   T     
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYT----- 52

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLV 119
              ++DTAGQE Y  L P+ Y + +  LV + +    S +  +  W  E+ +       +
Sbjct: 53  -LGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPGVPCL 111

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKT 178
           I  +G ++DL +     E          + Q++R I+ E+ +++A+E + + + E SA T
Sbjct: 112 I--VGTQIDLRENKMVIEKL--------QRQRLRPITPEQGEKFARELRAVKYVECSALT 161

Query: 179 GEGVKEIF 186
             G+K +F
Sbjct: 162 QRGLKNVF 169

>Kwal_33.14015
          Length = 271

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 29/196 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
             K+V++GD +VGK+ ++  + +  F E    T+   ++++             + V++ 
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPEEYIPTVFENYVTKM--------KGPDNTVVEL 116

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIY 121
            +WDTAGQE Y  L P+ Y + +  +V Y +  + SL   +  W+ E+++   D    I 
Sbjct: 117 ALWDTAGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTP--IL 174

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTGE 180
           L+G K DL                 D   K+  +   EA  +A E  LL   + S+K+ +
Sbjct: 175 LVGLKSDL--------------YALDNLDKL--VDPGEADLFATEHNLLGHYQCSSKSRQ 218

Query: 181 GVKEIFQ-DIGEKLYD 195
            V+E+F   +   LYD
Sbjct: 219 NVEELFNVAMATLLYD 234

>Kwal_55.21971
          Length = 421

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 3/73 (4%)

Query: 60  IKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDD 117
            K  +WDTAGQERY+ ++ P  Y+ +N  L+ YDI    S Q   + W+ E+ N   DD 
Sbjct: 220 FKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDICSRKSFQNCLDYWLQEVLNCCADDK 279

Query: 118 -LVIYLLGNKVDL 129
            L IYL+GNK+DL
Sbjct: 280 ALRIYLVGNKIDL 292

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 69/128 (53%), Gaps = 10/128 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + I +   D        + 
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKIALGSTD--------VV 109

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
           F I D  GQ  + ++ P+    A + + ++D+T+ ++L   + W  + +    ++  +  
Sbjct: 110 FSIMDLGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYRQARG--FNETAIAL 167

Query: 122 LLGNKVDL 129
           L+G K DL
Sbjct: 168 LVGTKYDL 175

>Kwal_23.3135
          Length = 191

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 88/188 (46%), Gaps = 21/188 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V++GD +VGK+ ++  +  + F       +   F + ++T+   D   T     
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYT----- 52

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLV 119
              ++DTAGQE Y  L P+ Y + +  LV + +    S +  +  W  E+ +       +
Sbjct: 53  -LGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCL 111

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKT 178
           I  +G ++DL  +    E          + Q++R IS E+ ++ A+E + + + E SA T
Sbjct: 112 I--VGTQIDLRDDKVIIEKL--------QRQRLRPISAEQGERLARELRAIKYVECSALT 161

Query: 179 GEGVKEIF 186
             G+K +F
Sbjct: 162 QRGLKNVF 169

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 62.8 bits (151), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 88/188 (46%), Gaps = 21/188 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V++GD +VGK+ ++  +  + F       +   F + ++T+   D   T     
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYT----- 52

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLV 119
              ++DTAGQE Y  L P+ Y + +  LV + +    S +  +  W  E+ +       +
Sbjct: 53  -LGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCL 111

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKT 178
           I  +G ++DL  +    E          + Q++R I+ E+ ++ A+E + + + E SA T
Sbjct: 112 I--VGTQIDLRDDKVIIEKL--------QRQRLRPITPEQGERLARELRAVKYVECSALT 161

Query: 179 GEGVKEIF 186
             G+K +F
Sbjct: 162 QRGLKNVF 169

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 63.5 bits (153), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 87/190 (45%), Gaps = 30/190 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     TI      E  + V 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRK---TI------EIDNKVF 51

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
             EI DTAG  ++ ++  +Y ++    L+VY +T   SL++     +++      D + +
Sbjct: 52  DLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPM 111

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTG 179
            L+GNK DL  E                    R IS EE  + + + G + F E SA   
Sbjct: 112 VLIGNKADLINE--------------------RVISVEEGIEVSSKWGRVPFYETSALLR 151

Query: 180 EGVKEIFQDI 189
             V E+F D+
Sbjct: 152 SNVDEVFVDL 161

>Scas_721.96
          Length = 191

 Score = 62.0 bits (149), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 88/188 (46%), Gaps = 21/188 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V +GD +VGK+ ++  +  + F       +   F + ++T+   D   T     
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYT----- 52

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKVGDDDLV 119
              ++DTAGQE Y  L P+ Y + +  LV + +    S +  +  W  E+ +       +
Sbjct: 53  -LGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCL 111

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAKT 178
           I  +G ++DL        + P   E   + Q++R IS E+ ++ A+E + + + E SA T
Sbjct: 112 I--VGTQIDL-------RSDPIIIEKL-QRQRLRPISPEQGERLARELKAVKYVECSALT 161

Query: 179 GEGVKEIF 186
             G+K +F
Sbjct: 162 QRGLKNVF 169

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 89/189 (47%), Gaps = 23/189 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V++GD +VGK+ ++  +  + F       +   F + ++T+   D   T     
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYT----- 52

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKV-GDDDL 118
              ++DTAGQE Y  L P+ Y + +  LV + +    S +  +  W  E+ +   G   L
Sbjct: 53  -LGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCL 111

Query: 119 VIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAK 177
           V+   G ++DL  +    E          + Q++R I++E+  + A+E + + + E SA 
Sbjct: 112 VV---GTQIDLRDDKVIIEKL--------QRQRLRPITSEQGSRLARELKAVKYVECSAL 160

Query: 178 TGEGVKEIF 186
           T  G+K +F
Sbjct: 161 TQRGLKNVF 169

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 88/189 (46%), Gaps = 23/189 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K V++GD +VGK+ ++  +  + F       +   F + ++T+   D   T     
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYT----- 52

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKAR-NWVDELKNKV-GDDDL 118
              ++DTAGQE Y  L P+ Y + +  LV + +    S +  +  W  E+ +   G   L
Sbjct: 53  -LGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCL 111

Query: 119 VIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQE-QGLLFREVSAK 177
           V+   G +VDL  +    E            Q++R I+ E+ ++ A+E + + + E SA 
Sbjct: 112 VV---GTQVDLRDDKVIIEKL--------RRQRLRPITAEQGERLARELRAVKYVECSAL 160

Query: 178 TGEGVKEIF 186
           T  G+K +F
Sbjct: 161 TQRGLKNVF 169

>Kwal_23.4875
          Length = 230

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 96/200 (48%), Gaps = 26/200 (13%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E T+   ++      + +         I 
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTVFENYIHDIFVDNQH---------IT 64

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVI 120
             +WDTAGQE +  L  + Y + +  ++ + +   DSL   ++ WV E+ +      LV+
Sbjct: 65  LSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHCEGVKLVL 124

Query: 121 YLLGNKVDLCQETPSTETSPDS--NEGGDEEQKVRA---------ISTEEAKQYAQEQGL 169
             L  K DL   + + E + DS    G  ++Q+ +          IS EE    A++ G 
Sbjct: 125 VAL--KCDL--RSNNEEFALDSAITPGNIQQQQQQQQSSLQSNGLISYEEGLAMAKKIGA 180

Query: 170 L-FREVSAKTGEGVKEIFQD 188
           L + E SAK   GV E F +
Sbjct: 181 LRYLECSAKMNRGVNEAFTE 200

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 11/131 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
             K+V++GD +VGK+S++  +V+  F   +   I   F +    I    G      +I+ 
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVF---KHENIPTIFENYVTNIQGPKGQ-----IIEL 134

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIY 121
            +WDTAGQE Y  L P+ Y  A+  ++ Y I    SL+   + W  E+++      ++  
Sbjct: 135 ALWDTAGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTPVM-- 192

Query: 122 LLGNKVDLCQE 132
           L+G K DL +E
Sbjct: 193 LVGLKSDLYEE 203

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 65/123 (52%), Gaps = 10/123 (8%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDT 67
           L+GD+ VGK+S++ ++V++ +D+    T+G  FL + ++I   D        I F I D 
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTD--------IIFSIMDL 76

Query: 68  AGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKV 127
            GQ  + ++ P+    ++  + ++D+T+ ++L   + W  +      +D  +  L+G K 
Sbjct: 77  GGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGL--NDSAIPILVGTKY 134

Query: 128 DLC 130
           DL 
Sbjct: 135 DLL 137

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 91/195 (46%), Gaps = 27/195 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
             K+V++GD +VGK+S++  + +  F E    TI   +++        +G   K  +++ 
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTIFENYVTNL------EGPNGK--IVEL 82

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIY 121
            +WDTAGQE Y  L P+ Y + +  ++ Y I  + S       W+ E+K+     D+ I 
Sbjct: 83  ALWDTAGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFC--PDVPIM 140

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           ++G K DL  E   ++              V A   EE  +  +    +  + S+K+ + 
Sbjct: 141 IVGLKSDLYAEDNISDF-------------VDAFKAEETAK--RIGAFVHLQCSSKSQQK 185

Query: 182 VKEIFQD-IGEKLYD 195
           V+E+F   I   LYD
Sbjct: 186 VREVFDTAITAALYD 200

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 61.2 bits (147), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 90/197 (45%), Gaps = 29/197 (14%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
              K+V++GD +VGK+ ++  + +  F      TI   ++S+        G   K  VI+
Sbjct: 76  CHLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVSKV------QGPRNK--VIE 127

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVI 120
             +WDTAGQE Y  L P+ Y + +  +V Y +  + S    +  W  E+K+   D  ++ 
Sbjct: 128 LALWDTAGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAPVM- 186

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFR-EVSAKTG 179
            L+G K DL                 D  +++  +  ++A   AQ+ G     + SAK+ 
Sbjct: 187 -LVGLKSDL--------------YALDNLEQL--VDPKDADTLAQQLGAFAHVQCSAKSR 229

Query: 180 EGVKEIFQ-DIGEKLYD 195
           + V E+F   +   LYD
Sbjct: 230 DNVDEVFNLAMTTALYD 246

>Kwal_14.2244
          Length = 244

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 30/190 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++             E  + V 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY---------RKTMEIDNKVF 51

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
             EI DTAG  ++ ++  +Y ++    L+VY +T   SL++     +++     +  + +
Sbjct: 52  DLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKDNSRVPM 111

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTG 179
            L+GNK DL  E                    R IS EE  + + + G + F E SA   
Sbjct: 112 VLVGNKADLQDE--------------------RVISVEEGIEMSSKWGKVPFYETSALLR 151

Query: 180 EGVKEIFQDI 189
             V E+F D+
Sbjct: 152 SNVDEVFVDV 161

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 81/190 (42%), Gaps = 30/190 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++             E  D   
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSY---------RKSMEIDDKAF 51

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
             EI DTAG  ++ ++  +Y ++    L+VY +T   SL +     +++        + +
Sbjct: 52  DLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPM 111

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTG 179
            L+GNK DL  E                    RAIS EE    +   G + F E SA   
Sbjct: 112 VLVGNKADLQNE--------------------RAISVEEGIDVSSRWGKVPFYETSALLK 151

Query: 180 EGVKEIFQDI 189
             V E+F D+
Sbjct: 152 SNVDEVFIDL 161

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 84/190 (44%), Gaps = 30/190 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++             E  + V 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY---------RKTMEIDNKVF 51

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
             EI DTAG  ++ ++  +Y ++    L+VY ++   SL +     +++      D + I
Sbjct: 52  DLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVLRIKDSDRVPI 111

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTG 179
            L+GNK DL  E                    R IS EE  + + + G + F E SA   
Sbjct: 112 VLVGNKADLQDE--------------------RVISVEEGIEVSSKWGKVPFYEASALLR 151

Query: 180 EGVKEIFQDI 189
             V E+F D+
Sbjct: 152 SNVDEVFIDL 161

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 93/196 (47%), Gaps = 29/196 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K+V++GD + GK+S++  + +  F E    TI   +++        +G   K  VI+ 
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTIFENYVTNI------EGPRGK--VIEL 103

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDDLVIY 121
            +WDTAGQE Y  L P+ Y + +  +V Y      SL  A   W  E+++      ++  
Sbjct: 104 ALWDTAGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM-- 161

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTGE 180
           L+G K DL         S D+ +        R +   +A+  A++ G  +  + SAKT +
Sbjct: 162 LVGLKSDL--------YSLDALD--------RLVDPTDAELVARKMGAFVHLQCSAKTRQ 205

Query: 181 GVKEIFQD-IGEKLYD 195
            ++++F   I   LYD
Sbjct: 206 CLEDVFNTAIHTALYD 221

>Scas_575.10
          Length = 271

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 87/190 (45%), Gaps = 30/190 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++     TI      E  + V 
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSYRK---TI------EIDNKVF 51

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
             EI DTAG  ++ ++  +Y ++    L+VY +T   SL +     +++      D + +
Sbjct: 52  DLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVLRIKDTDRVPM 111

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLL-FREVSAKTG 179
            L+GNK DL ++                    R IS EE  + + + G + F E SA   
Sbjct: 112 VLVGNKADLTED--------------------RVISVEEGIEVSSKWGKVPFYETSALLR 151

Query: 180 EGVKEIFQDI 189
             V E+F D+
Sbjct: 152 SNVDEVFVDL 161

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 85/190 (44%), Gaps = 30/190 (15%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++     TI      E  + V 
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSYRK---TI------EIDNKVF 51

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
             EI DTAG  ++ ++  +Y +     L+VY +T  DSL++     +++        + +
Sbjct: 52  DLEILDTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIKDSQRVPM 111

Query: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG-LLFREVSAKTG 179
            L+GNK DL  +                    R I  EE    + + G + F E SA   
Sbjct: 112 VLVGNKADLVDD--------------------RIIPVEEGIGVSSQWGKVPFYETSALLR 151

Query: 180 EGVKEIFQDI 189
             V E+F D+
Sbjct: 152 SNVDEVFVDL 161

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 57.8 bits (138), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 86/189 (45%), Gaps = 26/189 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           K+++LG  +VGK++++ +  +  F E    TI   F+ + +   PN G E K      +I
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFVLKKPN-GTELK---FNLDI 62

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
            DT+GQ+ +  +           +++Y +    S +      D++ + +G  +L + L+G
Sbjct: 63  VDTSGQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVG 122

Query: 125 NKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKE 184
           NK+DL                       R +S +E ++ A+     F E+  K G G++ 
Sbjct: 123 NKIDL----------------------DRQVSYKEGEELAKRLKCGFVEICVKQGSGIEM 160

Query: 185 IFQDIGEKL 193
            F+ + +K+
Sbjct: 161 PFKTLIQKI 169

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 67/144 (46%), Gaps = 21/144 (14%)

Query: 56  KDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVG 114
           K  + K  +WDTAGQE Y  L P+ YR  +  L+ + +++  S +   + W  ELK   G
Sbjct: 113 KRQIFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSG 172

Query: 115 --DDDLV-------IYLLGNKVDLCQETPSTETSPDSNE-GGDEEQKVRAISTEEAKQYA 164
               DL        I L+G K DL           D NE     +Q +  +S EE  +  
Sbjct: 173 IESGDLYTNFKKYPILLVGTKSDL---------RDDENEIQKMRDQNLSFVSKEEIDKVV 223

Query: 165 QEQGLL-FREVSAKTGEGVKEIFQ 187
           ++ G + + E SA T   V+++F+
Sbjct: 224 EDNGFMGYVECSAATQNNVRQVFE 247

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 1  MLQFKLVLLGDSSVGKSSIVHRFVKDTF 28
          M   K V++GD +VGK+S++  +  +TF
Sbjct: 1  MRSIKCVVIGDGAVGKTSLLISYTTNTF 28

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 64  IWDTAGQERYK-SLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDDDLV-- 119
           +WDTAGQERY+ ++ P  Y+  NA ++ YDIT   S Q     W+ +        DL+  
Sbjct: 164 LWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKA 223

Query: 120 -IYLLGNKVDLCQETPSTE 137
             +L+GNK+DL +E   T 
Sbjct: 224 RFFLVGNKIDLYKERQVTH 242

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 55.8 bits (133), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 80/186 (43%), Gaps = 17/186 (9%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F ++ I    +D          
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF-TRIIPYKSHD--------CT 65

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
            EI DTAGQ+    L           ++ Y I    S        D+L +++G D+L + 
Sbjct: 66  LEILDTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVI 125

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           L+G K DL + T   +      EG   E+    I +++ +  A      F E SA+    
Sbjct: 126 LVGTKADLGRSTKGVKRCVTKAEG---EKLASTIGSQDKRNQAA-----FIECSAELDYN 177

Query: 182 VKEIFQ 187
           V+E F 
Sbjct: 178 VEETFM 183

>Kwal_34.16142
          Length = 192

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 77/180 (42%), Gaps = 25/180 (13%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F  Q +      G  T       EI
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQFTKQIVL-----GRTTYT----LEI 63

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
            DTAGQ+ +  +            +VY      S +      D++ ++VG + +   +LG
Sbjct: 64  CDTAGQDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILG 123

Query: 125 NKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKE 184
           NK+DL              + G    KVR    +E ++ A   G  F E SAK   GV+E
Sbjct: 124 NKIDL-------------RDSGINGGKVR---RQEGEELAARLGAGFVECSAKLNIGVEE 167

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 22/199 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
           M   K VL+GDS VGK++ +  +   +F      T+   +L+   TI   +   T     
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLT---TIQDKETGYT----F 53

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGDDD-- 117
               WDT+G +++  L P+ Y   +  L  +      S +  ++ W+ ELK  +   D  
Sbjct: 54  HTTFWDTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNS 113

Query: 118 --LVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEA---KQYAQEQGLLFR 172
             + I L+  K DL  +         SN   ++ Q+V  +   E+        E  L F 
Sbjct: 114 STVPILLVATKCDLNDDN-------SSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFV 166

Query: 173 EVSAKTGEGVKEIFQDIGE 191
           + S+KTG G++++  ++ +
Sbjct: 167 KCSSKTGYGLQDVIDNVAK 185

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 88/185 (47%), Gaps = 31/185 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           ++K+V++G   VGKS++  +F++  F +  + TI  ++  Q +           D V   
Sbjct: 10  EYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVI---------DDKVSIL 60

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV-IY 121
           +I DTAGQE Y ++   Y R     L+VY +T  +S  +  ++  +++ +V D D + + 
Sbjct: 61  DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQ-RVKDSDYIPVV 119

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           ++GNK+DL  E                    R +S E+  + A++    F E SAK    
Sbjct: 120 VVGNKLDLENE--------------------RQVSYEDGLRLAKQLNAPFLETSAKQAIN 159

Query: 182 VKEIF 186
           V E F
Sbjct: 160 VDEAF 164

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 60  IKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDITQEDSLQKARN-WVDELKNKVGD-D 116
            K  +WDTAGQERY+ ++ P  Y+ +N  ++ YDI    S     N W+ E      D  
Sbjct: 226 FKVIMWDTAGQERYRNAMIPSLYKGSNGIILTYDICDRASFDSCLNHWLREAIQNCKDLG 285

Query: 117 DLVIYLLGNKVDL 129
               YL+GNK+DL
Sbjct: 286 KTRFYLVGNKIDL 298

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 22/140 (15%)

Query: 57  DVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDD 116
           D V   +I DTAGQE Y ++   Y RN    L+VY IT + SL +   +  ++  +V D 
Sbjct: 55  DEVSILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL-RVKDT 113

Query: 117 DLV-IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVS 175
           D V I ++GNK DL  E                    + +S ++    A++    F E S
Sbjct: 114 DYVPIVVVGNKSDLENE--------------------KQVSYQDGLNMAKQMNAPFLETS 153

Query: 176 AKTGEGVKEIFQDIGEKLYD 195
           AK    V+E F  +   + D
Sbjct: 154 AKQAINVEEAFYTLARLVRD 173

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 67/129 (51%), Gaps = 19/129 (14%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
            K+++LG  + GK++I+++      ++++ S     F  +++T + N         +KF 
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVT-YKN---------VKFN 47

Query: 64  IWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDL---VI 120
           +WD  GQER + L   Y+    A + V D   +D L +A+   +E  + VG+ ++   V+
Sbjct: 48  MWDVGGQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAK---EEFYSIVGEKEMEKVVL 104

Query: 121 YLLGNKVDL 129
            +L NK DL
Sbjct: 105 LVLANKQDL 113

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 59  VIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDD 116
           + K  +WDTAGQERY+ ++ P  Y+     ++ YDI   ++      +W+ E       +
Sbjct: 183 LFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICSRETFPDCLEHWLPEALEHCQVE 242

Query: 117 DLVIYLLGNKVDL 129
               YL+GNKVDL
Sbjct: 243 HTRFYLVGNKVDL 255

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 64  IWDTAGQERYK-SLAPMYYRNANAALVVYDITQEDSLQKA-RNWVDELKNKVGDDDL--- 118
           +WDTAGQERY+ ++ P  Y+ +NA ++ YDIT + S + +  +W+ E        D    
Sbjct: 260 LWDTAGQERYRNAIMPSLYKKSNAIILSYDITDKCSFKNSYEHWLVEAMGHFAARDYEKA 319

Query: 119 VIYLLGNKVDL 129
             Y +GNK DL
Sbjct: 320 RFYFIGNKTDL 330

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 50.8 bits (120), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 70/130 (53%), Gaps = 19/130 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K+++LG    GK++I+++      ++++ ST    F  +++T + N         +KF
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVT-YKN---------VKF 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGD---DDLV 119
            +WD  GQ+R + L   Y+    A + V D +  + +++A+   +EL + +G+   +++V
Sbjct: 64  NMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAK---EELYSIIGEKEMENVV 120

Query: 120 IYLLGNKVDL 129
           + +  NK DL
Sbjct: 121 LLVWANKQDL 130

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 89/194 (45%), Gaps = 31/194 (15%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +     DG      V   
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI----DGQ-----VSIL 60

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV-IY 121
           +I DTAGQE Y ++   Y R     L+VY +T   S ++   +  ++  +V D + V I+
Sbjct: 61  DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL-RVKDVEYVPIF 119

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           ++GNK DL  E                    R +S EE  + A+     F E SAK    
Sbjct: 120 VVGNKSDLEGE--------------------RQVSFEEGAELARHFNASFLETSAKQAIN 159

Query: 182 VKEIFQDIGEKLYD 195
           V+E F  +   + D
Sbjct: 160 VEESFYGLARLVRD 173

>Kwal_26.8387
          Length = 292

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 84/185 (45%), Gaps = 31/185 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q +           D V   
Sbjct: 16  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI---------DDKVSIL 66

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV-IY 121
           +I DTAGQE Y ++   Y R     L+VY +T   S  +   +  ++  +V D D V ++
Sbjct: 67  DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQIL-RVKDADYVPVF 125

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           L+GNK DL  E                    R ++ EE    A++    F E SAK    
Sbjct: 126 LVGNKSDLEDE--------------------RQVAYEEGVSLAKQFNAPFMETSAKQAIN 165

Query: 182 VKEIF 186
           V++ F
Sbjct: 166 VEDSF 170

>Scas_697.46
          Length = 324

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 31/185 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           ++KLV++G   VGKS++  + +   F +  + TI  ++  Q +           D V   
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIEDSYRKQVVI---------DDKVTVL 60

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV-IY 121
           ++ DTAGQE Y ++   Y R     L+VY +T ++S ++   +  +++ +V D D + + 
Sbjct: 61  DVLDTAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQ-RVKDSDYIPVV 119

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           ++GNK DL  E                    R +  +     A++    F E SAK    
Sbjct: 120 IVGNKSDLEDE--------------------RQVPYQSGVNLAKQMNAPFLETSAKQAIN 159

Query: 182 VKEIF 186
           V+E F
Sbjct: 160 VEEAF 164

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 28/183 (15%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           QF +++LG  + GK++ +    K+     +        + Q++   P      +D V+KF
Sbjct: 17  QFSILILGLDNAGKTTFLETLKKEYSLHSKPLEKITPTVGQNVATIP-----VQDCVLKF 71

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDD---LV 119
             WD  GQE  +SL   YY  A+  + V D T  D L + +   + L++ V D+D   + 
Sbjct: 72  --WDVGGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECK---ETLRSIVMDEDVEGVP 126

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           + +L NK D               E   E Q ++ I  + A+        +   +SA TG
Sbjct: 127 VLMLANKQD--------------REDRMEVQDIKEIFNKIAEHLGARDSRVL-PISALTG 171

Query: 180 EGV 182
           EGV
Sbjct: 172 EGV 174

>Kwal_23.2944
          Length = 184

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 67/130 (51%), Gaps = 19/130 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K+++LG  + GK++I+++      ++++ S     F  ++++             +KF
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFRN----------VKF 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGD---DDLV 119
            +WD  GQ+R + L   Y+    A + V D    + L +A+   +EL + +GD   +++V
Sbjct: 64  NMWDVGGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAK---EELYSIIGDKEMENVV 120

Query: 120 IYLLGNKVDL 129
           + +L NK DL
Sbjct: 121 LLVLANKQDL 130

>Scas_503.2
          Length = 527

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 5/71 (7%)

Query: 64  IWDTAGQERYKS-LAPMYYRNANAALVVYDITQEDSLQK-ARNWVDELKNKVGDDDLV-- 119
            WD AGQ+R+K+ +    Y+ +NA ++ YDI    S Q   R W++E    V   DL   
Sbjct: 273 FWDPAGQDRFKNVMMDSLYKISNAIILCYDICNLTSFQNCCRYWLNETLENVRSGDLSEI 332

Query: 120 -IYLLGNKVDL 129
             YL+GNK+DL
Sbjct: 333 KFYLVGNKLDL 343

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + IT  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVITTIPTIGFNVETVQYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ+R +SL   YYRN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
             +  NK DL +   + E +
Sbjct: 121 WLVFANKQDLPEAMSAAEIT 140

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 66/130 (50%), Gaps = 19/130 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K+++LG  + GK++I+++      ++++ S     F  +++              +KF
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFRN----------VKF 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGD---DDLV 119
            +WD  GQER + L   Y+    A + V D   +  L +A+   +EL + +G+   +++V
Sbjct: 64  NMWDVGGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAK---EELYSIIGEKEMENVV 120

Query: 120 IYLLGNKVDL 129
           + +L NK DL
Sbjct: 121 LLVLANKQDL 130

>Scas_701.42*
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + IT  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVITTIPTIGFNVETVQYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ+R +SL   YYRN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
             +  NK DL +   + E +
Sbjct: 121 WLVFANKQDLPEAMSAAEIT 140

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + IT  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVITTIPTIGFNVETVQYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ+R +SL   YYRN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
             +  NK DL +   + E +
Sbjct: 121 WLVFANKQDLPEAMSAAEIT 140

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + IT  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVITTIPTIGFNVETVQYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ+R +SL   YYRN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
             +  NK DL +   + E +
Sbjct: 121 WLVFANKQDLPEAMSAAEIT 140

>Scas_624.4*
          Length = 181

 Score = 48.5 bits (114), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + IT  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVITTIPTIGFNVETVQYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ+R +SL   YYRN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
             +  NK DL +   + E +
Sbjct: 121 WLVFANKQDLPEAMSAAEIT 140

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 64  IWDTAGQERYK-SLAPMYYRNANAALVVYDITQEDSLQKARNW--VDELKNKVGDDDLVI 120
           +WDTAGQERY+ ++    Y+ +N  ++ YDI   +S     N+  V+ ++N         
Sbjct: 181 MWDTAGQERYRNAMISSLYKGSNGVILSYDICDFNSFLNCLNFWLVESIENIPNLSMTRF 240

Query: 121 YLLGNKVDLCQE 132
           YL+GNK+DL +E
Sbjct: 241 YLVGNKLDLYKE 252

>Scas_697.54*
          Length = 181

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 69/130 (53%), Gaps = 19/130 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K+++LG  + GK++I+++      ++++ ST    F  ++++ + N         +KF
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVS-YKN---------VKF 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDL---V 119
            +WD  GQER + L   Y+    A + V D + ++ L +A+   +EL + + + ++   V
Sbjct: 64  NMWDVGGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAK---EELYSIISEKEMEKVV 120

Query: 120 IYLLGNKVDL 129
           + +  NK DL
Sbjct: 121 LLVWANKQDL 130

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 62/140 (44%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + +T  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVVTTIPTIGFNVETVEYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ++ + L   Y+RN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
           + +  NK DL +  P+ E +
Sbjct: 121 LLVFANKQDLPEAMPAAEIT 140

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 69/140 (49%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K+++LG  + GK++I+++      ++++ S     F  ++++             +KF
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFKN----------VKF 63

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDL---V 119
            +WD  GQ R + L   Y+   +A + V D   ++ L +A+   +EL + +G+ ++   V
Sbjct: 64  NMWDVGGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAK---EELFSIIGEKEMEKVV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
           + +L NK DL       E S
Sbjct: 121 LLVLANKQDLPGALSPNEVS 140

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 31/185 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           ++KLV++G   VGKS++  + V   F +  + TI  ++  Q +           D V   
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSYRKQVVI---------DDKVTIL 58

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV-IY 121
           +I DTAGQE Y ++   Y R     L+VY +T   S ++   +  +++ +V D + + + 
Sbjct: 59  DILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQ-RVKDVEYIPVV 117

Query: 122 LLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEG 181
           ++GNK DL  E                    R +S EE    A++    F E SAK    
Sbjct: 118 VVGNKSDLETE--------------------RQVSFEEGASLAKQLNAPFLETSAKQAIN 157

Query: 182 VKEIF 186
           V++ F
Sbjct: 158 VEDAF 162

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + +++++G    GK++++++                  L + IT  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVITTIPTIGFNVETVQYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ+R +SL   YYRN    + V D      + +AR  +  + N+    +  
Sbjct: 61  ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAA 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
             +  NK DL +   + E +
Sbjct: 121 WLVFANKQDLPEAMSAAEIT 140

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 75/185 (40%), Gaps = 36/185 (19%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDV---V 59
           + +++++G    GK++++++                  L + +T  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVVTTIPTIGFNVETVEYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ++ + L   Y+RN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           + +  NK DL          P++    +  +K+   S  +   Y Q          A +G
Sbjct: 121 LLVFANKQDL----------PEAMSAAEITEKLGLHSIRQRPWYIQ-------ATCATSG 163

Query: 180 EGVKE 184
           EG+ E
Sbjct: 164 EGLYE 168

>Kwal_56.24453
          Length = 181

 Score = 45.1 bits (105), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDV---V 59
           + +++++G    GK++++++                  L + +T  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVVTTIPTIGFNVETVEYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ++ + L   Y+RN    + V D      + +AR  +  + N+    + V
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAV 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
           + +  NK DL +   + E +
Sbjct: 121 LLVFANKQDLPEAMSAAEIT 140

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 60/139 (43%), Gaps = 19/139 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDV---VI 60
            +++++G    GK++I+++                  L + +T  P  G   + V    I
Sbjct: 1   MRVLMVGLDGAGKATILYKLK----------------LGEVVTTIPTIGFNVETVEYKNI 44

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120
            F +WD  GQ++ + L   Y+RN    + V D      + +AR  +  + N+    + V+
Sbjct: 45  SFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVL 104

Query: 121 YLLGNKVDLCQETPSTETS 139
            +  NK DL +   + E +
Sbjct: 105 LVFANKQDLPEAMSAAEIT 123

>Kwal_56.24462
          Length = 181

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 60/140 (42%), Gaps = 19/140 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDV---V 59
           + +++++G    GK++++++                  L + +T  P  G   + V    
Sbjct: 17  EMRILMVGLDGAGKTTVLYKLK----------------LGEVVTTIPTIGFNVETVEYKN 60

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           I F +WD  GQ++ + L   YYRN    + V D      + +AR  +  + N+    +  
Sbjct: 61  ISFTVWDVGGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAS 120

Query: 120 IYLLGNKVDLCQETPSTETS 139
           + +  NK DL +   + E +
Sbjct: 121 LLVFANKQDLPEAMSAAEIT 140

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 79/185 (42%), Gaps = 26/185 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           Q+ +++LG  + GK++ +    K+     +     A  + Q++   P D N +   ++KF
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKIAPTVGQNVATIPVDNNRS---ILKF 73

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDD---LV 119
             WD  GQ   +++   YY   +  + V D T    + +     + L+  V DD+   + 
Sbjct: 74  --WDVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECS---ETLRTIVMDDEIEGIP 128

Query: 120 IYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTG 179
           I +L NK    Q+ P             E Q ++ I    A+  +     +   V A TG
Sbjct: 129 ILMLANK----QDKPERM----------EVQDIKEIFNRIAEHMSARDSRVL-PVCALTG 173

Query: 180 EGVKE 184
           EG+K+
Sbjct: 174 EGIKD 178

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 53/133 (39%), Gaps = 13/133 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KL+ LG  + GK++++H    D    L+             T HP    E     IKF  
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKNDRLATLQP------------TWHPTS-EELAIGNIKFTT 70

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
           +D  G  + + L   Y+   N  + + D    D   +AR  +D L N     D+   +LG
Sbjct: 71  FDLGGHVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILG 130

Query: 125 NKVDLCQETPSTE 137
           NK+D        E
Sbjct: 131 NKIDAANAVSEAE 143

>Kwal_47.18241
          Length = 230

 Score = 42.7 bits (99), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 16/150 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           Q  +V++G  + GK+S+    +   F++    T+G     +  T+  N            
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRM--EQFTMGLN----------IV 51

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYL 122
            I+D AGQ R++ L   Y+  A+  + V D+  + +  + +  V ++      D + + +
Sbjct: 52  RIFDLAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLI 111

Query: 123 LGNKVDLCQ--ETPSTETS--PDSNEGGDE 148
           LGNK+DL    +TP+   +  P     GD+
Sbjct: 112 LGNKIDLITTLDTPNNGRTRKPVKRSAGDQ 141

>Kwal_27.11872
          Length = 197

 Score = 42.4 bits (98), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 59/129 (45%), Gaps = 13/129 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           Q+ +++LG  + GK++ +    ++     +        + Q++   P       + ++KF
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNVATVP-----VGNCLLKF 71

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDD---LV 119
             WD  GQE  ++L P YY+ A+  + V D    + L +       L+  V D+D   + 
Sbjct: 72  --WDVGGQESLRALWPEYYKQAHGIIFVIDSADRERLDEC---CQTLRTIVMDEDVEGIP 126

Query: 120 IYLLGNKVD 128
           + +L NK D
Sbjct: 127 VLMLANKQD 135

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 13/124 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KL+ LG  + GK++++H    D    L+             T HP    E     IKF  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRLATLQP------------TWHPTS-EELAIGNIKFTT 71

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
           +D  G  + + L   Y+   N  + + D    +   +AR  +D L N     D+   +LG
Sbjct: 72  FDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILG 131

Query: 125 NKVD 128
           NK+D
Sbjct: 132 NKID 135

>Scas_628.21
          Length = 208

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 9/128 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIK 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F ++ I        + K+    
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHF-TKLI--------DFKNQHFT 63

Query: 62  FEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIY 121
            EI DTAGQ+    L           ++ Y +    +        D+L +++  DD+ + 
Sbjct: 64  LEIVDTAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVI 123

Query: 122 LLGNKVDL 129
           ++GNK+DL
Sbjct: 124 IVGNKIDL 131

>Scas_567.9
          Length = 199

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 83/195 (42%), Gaps = 46/195 (23%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------TFDELRESTIGAAFLSQSITIHPNDGNETK 56
           Q+ +++LG  + GK++ +    K+        D++   T+G    + S+        E  
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKI-TPTVGQNVATISV--------ENN 67

Query: 57  DVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVG-- 114
             ++KF  WD  GQE  +S+   YY   +  + V D T        R+ +DE    +G  
Sbjct: 68  KKLLKF--WDVGGQENLRSMWSEYYSQCHGIIFVVDSTD-------RSRIDECSKTLGKI 118

Query: 115 --DDD---LVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGL 169
             DD+   + I +L NK D+ +                E Q ++ I  + A+  +     
Sbjct: 119 VMDDEVEGVPILMLANKQDMPERM--------------EVQDIKEIFNQIAEHLSARDSR 164

Query: 170 LFREVSAKTGEGVKE 184
           +   VSA TGEGVK+
Sbjct: 165 VL-PVSALTGEGVKD 178

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 16/131 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRF--VKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60
            + +++LG  + GK++ + +   V   + +  E  +    + Q++   P D    K  ++
Sbjct: 17  HYSVLILGLDNAGKTTFLEQLKAVYHLYAKPLEKIVPT--VGQNVATVPLD----KTTLL 70

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDD---D 117
           KF  WD  GQE  +++   YY   +  + + D T  + LQ+     D L++ V DD    
Sbjct: 71  KF--WDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQEC---CDSLRSIVTDDGVEG 125

Query: 118 LVIYLLGNKVD 128
           + I +L NK D
Sbjct: 126 VPILMLANKQD 136

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 54/133 (40%), Gaps = 13/133 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KL+ LG  + GK++++H    D    L+             T HP    E     IKF  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRLATLQP------------TWHPTS-EELAIGNIKFTT 71

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
           +D  G  + + L   Y+   N  + + D    +   +AR  +D L      D++   +LG
Sbjct: 72  FDLGGHLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALFQIKELDNVPFAVLG 131

Query: 125 NKVDLCQETPSTE 137
           NK+D       TE
Sbjct: 132 NKIDSPSAVSETE 144

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 82/192 (42%), Gaps = 19/192 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + + ++LG  + GKS+IV+  + ++ ++    T    F   SI +      +T     K 
Sbjct: 16  EIRCLILGLDNSGKSTIVNGLLPES-EKCNSITPTVGFQIHSIVVESAQDGKTY----KV 70

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQ----EDSLQKARNWVDELKNKVG-DDD 117
            +WD  GQ   +     Y+   +  L   DI      ++S  + R  V + ++++G    
Sbjct: 71  NLWDIGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDESFNELRELVMQDRDRIGYQCK 130

Query: 118 LVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAK 177
           LV+ +  NK+DL       E +   +   D EQK+  I     +   +     +   S K
Sbjct: 131 LVVAI--NKIDL------VEQADLEHYAHDIEQKIEHI-LHHGQSVGESSIGHYVLCSGK 181

Query: 178 TGEGVKEIFQDI 189
           TG G++ + Q I
Sbjct: 182 TGAGIENLAQMI 193

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 58/142 (40%), Gaps = 19/142 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + ++++LG    GK++I++R             IG     + +T  P  G   + +    
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIG-----EVVTTKPTIGFNVETLTYKN 61

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           +K  +WD  GQ   +     YY N  A + V D T +D +  A   +  +  +    D  
Sbjct: 62  LKLNVWDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTASKELHMMLQEEELQDAA 121

Query: 120 IYLLGNKVDLCQETPSTETSPD 141
           + +  NK D      ++E S +
Sbjct: 122 LLVFANKQDQPGALSASEVSKE 143

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 19/144 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + ++++LG    GK++I++R             IG     + IT  P  G   + +    
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIG-----EVITTKPTIGFNVETLNYKN 61

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           +K  +WD  GQ   +     YY N  A + V D T +D +  A   +  +  +    D  
Sbjct: 62  LKLNVWDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMNIASKELHLMLQEEELQDSA 121

Query: 120 IYLLGNKVDLCQETPSTETSPDSN 143
           + +  NK D      ++E S + N
Sbjct: 122 LLVFANKQDQPGALSASEVSKELN 145

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 84/190 (44%), Gaps = 37/190 (19%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD---TFDELR--ESTIGAAFLSQSITIHPNDGNETKD 57
           Q+ +++LG  + GK++ +    K+    F  L   + T+G     Q++   P D  +   
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVG-----QNVATIPVDSKQ--- 68

Query: 58  VVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDD 117
            ++KF  WD  GQE  +S+   YY   +  + + D +  + L +       L++ V D++
Sbjct: 69  -ILKF--WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECST---TLQSVVMDEE 122

Query: 118 L---VIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREV 174
           +    I +L NK D               +   E Q ++ +  + A+  +     +   +
Sbjct: 123 IEGVPILMLANKQD--------------RQDRMEVQDIKEVFNKIAEHISARDSRVL-PI 167

Query: 175 SAKTGEGVKE 184
           SA TGEGVK+
Sbjct: 168 SALTGEGVKD 177

>YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein
           involved in chromosome segregation, mutants arrest at
           mitosis with loss of microtubule structure [576 bp, 191
           aa]
          Length = 191

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 81/186 (43%), Gaps = 31/186 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTI--GAAFLSQSITIHPNDGNETKDVVI 60
           + + ++LG  + GKS+IV++ +    DE     I     F   S+ I        KDV I
Sbjct: 16  EIRCLILGLDNSGKSTIVNKLLPK--DEQNNDGIMPTVGFQIHSLMI--------KDVTI 65

Query: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQ----EDSLQKARNWVDELKNKVGDD 116
              +WD  GQ   +     Y+    A +   D++     +++LQ+ +  ++  +N++G +
Sbjct: 66  --SLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYE 123

Query: 117 DLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSA 176
             VI +L NK+DL ++                 ++   + +E    +  +  +   + S 
Sbjct: 124 CAVIVVL-NKIDLVEDKSEL------------HRRCLLVESELKCLFKPDIRIELVKCSG 170

Query: 177 KTGEGV 182
            TGEG+
Sbjct: 171 VTGEGI 176

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1, start by
           similarity
          Length = 408

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 70/157 (44%), Gaps = 27/157 (17%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHP----NDGN--ETK 56
            F++++LGD  VGK+S++ +++ D +    E+T       + I  +     ND      K
Sbjct: 20  NFRIMVLGDPKVGKTSMIMQWLTDNYRSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEK 79

Query: 57  DVV-----------------IKFEIWDTAGQ---ERYKS-LAPMYYRNANAALVVYDITQ 95
           DV+                 IK EI D       E Y + L  +  + ++A ++ +D   
Sbjct: 80  DVIDFNLDNSHRFQYTNKDLIKLEILDANIHDISEYYSNELRSLQVKQSDAIVICFDGKS 139

Query: 96  EDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQE 132
           + + +  R + + +K+ +G++ + + +   K+D   E
Sbjct: 140 QTTFEHVREYYNTIKDALGEEQIPVVICNTKIDYLME 176

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 76/189 (40%), Gaps = 44/189 (23%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + ++++LG    GK++I++R                  + + +T  P  G   + +    
Sbjct: 18  ELRILILGLDGAGKTTILYRLQ----------------VGEVVTTKPTIGFNVETLTYRN 61

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDL- 118
           +K  +WD  GQ   +     YY N  A + V D T +D +  A     EL   + +++L 
Sbjct: 62  LKLNVWDLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVA---ARELHTMLQEEELQ 118

Query: 119 --VIYLLGNKVDLCQETPSTETSPD-SNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVS 175
              + +  NK    Q+ P  +++ + S E    E K R+ S   A              S
Sbjct: 119 DAALLVFANK----QDQPGAQSALEVSRELRLAELKDRSWSIVAA--------------S 160

Query: 176 AKTGEGVKE 184
           A  GEG+ E
Sbjct: 161 ALRGEGITE 169

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 52/133 (39%), Gaps = 13/133 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KL+ LG  + GK++++H    D    L+             T HP    E     IKF  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRLATLQP------------TWHPTS-EELAIGSIKFTT 71

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
           +D  G  + + L   Y+   N  + + D    +   +AR  +D L        +   +LG
Sbjct: 72  FDLGGHIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILG 131

Query: 125 NKVDLCQETPSTE 137
           NK+D       TE
Sbjct: 132 NKIDAPSAVSETE 144

>Scas_706.2*
          Length = 190

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 59/153 (38%), Gaps = 19/153 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           KL+ LG  + GK++++H    D    L+             T HP    E     IKF  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKNDRLATLQP------------TWHPTS-EELAIGNIKFTT 71

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLG 124
           +D  G  + + L   Y+   N  + + D    +   +A   +D L       D+   +LG
Sbjct: 72  FDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILG 131

Query: 125 NKVDLCQETPSTE------TSPDSNEGGDEEQK 151
           NK+D        E       +  +N GG + Q+
Sbjct: 132 NKIDAPTAVSEAELRNALGLNNTTNYGGAQNQR 164

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 59/144 (40%), Gaps = 19/144 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + ++++LG    GK++I++R             IG     + +T  P  G   + +    
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIG-----EVVTTKPTIGFNVETLTYKN 61

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           +K  +WD  GQ   +     YY +  A + V D T +D +  A   +  +  +    D  
Sbjct: 62  LKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAA 121

Query: 120 IYLLGNKVDLCQETPSTETSPDSN 143
           + +  NK D      ++E S + N
Sbjct: 122 LLVFANKQDQPGALTASEVSKELN 145

>Scas_700.11
          Length = 183

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 59/144 (40%), Gaps = 19/144 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + ++++LG    GK++I++R             IG     + +T  P  G   + +    
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIG-----EVVTTKPTIGFNVETLTYKN 61

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           +K  +WD  GQ   +     YY +  A + V D T +D +  A   +  +  +    D  
Sbjct: 62  LKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTASKELHLMLQEEELQDAA 121

Query: 120 IYLLGNKVDLCQETPSTETSPDSN 143
           + +  NK D      ++E S + N
Sbjct: 122 LLVFANKQDQPGALSASEVSKELN 145

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 59/144 (40%), Gaps = 19/144 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVV--- 59
           + ++++LG    GK++I++R             IG     + +T  P  G   + +    
Sbjct: 18  ELRILILGLDGAGKTTILYRL-----------QIG-----EVVTTKPTIGFNVETLSYKN 61

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           +K  +WD  GQ   +     YY +  A + V D T +D +  A   +  +  +    D  
Sbjct: 62  LKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAA 121

Query: 120 IYLLGNKVDLCQETPSTETSPDSN 143
           + +  NK D      ++E S + N
Sbjct: 122 LLVFANKQDQPGALSASEVSKELN 145

>Kwal_56.24149
          Length = 149

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%)

Query: 60  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV 119
           IKF  +D  G  + + L   Y+   N  + + D    + L +AR  +D L N     D+ 
Sbjct: 26  IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERLNEARVELDALFNIAELKDVP 85

Query: 120 IYLLGNKVDLCQETPSTE 137
             +LGNK+D       TE
Sbjct: 86  FVILGNKIDSPNAVSETE 103

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 36.2 bits (82), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 10/109 (9%)

Query: 25  KDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI----KFEIWDTAGQERYKSLAPMY 80
           K TF  L     G  F+  +I   P  G   KDV +      +++D AGQ R++ L    
Sbjct: 36  KTTFTNL---IAGEEFVVDTI---PTLGVNIKDVKLPNHTNLKVYDLAGQTRFQKLWDRC 89

Query: 81  YRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDL 129
           ++  +  + + D++   + ++A+N + ++      + + I +LGNKVDL
Sbjct: 90  FQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPILILGNKVDL 138

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 35.4 bits (80), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 22/112 (19%)

Query: 76  LAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV-IYLLGNKVDLCQETP 134
           +   Y R     L+VY +T + S ++   +  ++  +V D D V ++++GNK DL  E  
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL-RVKDSDYVPVFVIGNKSDLEDE-- 57

Query: 135 STETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIF 186
                             R +S EE +  A++    F E SAK    V+E F
Sbjct: 58  ------------------RQVSYEEGQTLAKQFDAPFLETSAKQNINVEESF 91

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 33.1 bits (74), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 67/131 (51%), Gaps = 22/131 (16%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEI 64
           +++LLG  + GK++++++ + +  D++ + TIG    +  ++      N+        ++
Sbjct: 18  RVLLLGLDNSGKTTVLNQLLNEPIDKI-QPTIGFQIKTLKLS------NKV------LQM 64

Query: 65  WDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLV----- 119
           WD  GQ+  +     Y+   +  + V DI  ++ L ++   ++E+   V ++D +     
Sbjct: 65  WDIGGQKTLRPFWFNYFEKTDYLIWVIDIL-DNRLMESLTLLEEI---VQENDRINLQFE 120

Query: 120 IYLLGNKVDLC 130
           +++L NK+DL 
Sbjct: 121 VFILLNKIDLL 131

>Kwal_26.6810
          Length = 664

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 12/75 (16%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDTF-----DELRESTIGAAFLSQSITIHPNDGNETKD 57
          Q K+V+ GD  VGK+S++   +KD F     D L   TI   F S  +          K 
Sbjct: 5  QIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPVTIPQYFSSSPVC-------PKKS 57

Query: 58 VVIKFEIWDTAGQER 72
          V++    +D  G +R
Sbjct: 58 VLVDTTSYDLPGLQR 72

>AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 309
           aa]
          Length = 309

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 56/139 (40%), Gaps = 30/139 (21%)

Query: 5   KLVLLGDSSVGKSSIV-----HRFVKDTFDEL----RESTIGAAFLSQSITIHPNDGNET 55
           ++ ++G  + GK+++      H F  DT   L    R +TIG   L              
Sbjct: 70  QIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLL-------------- 115

Query: 56  KDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGD 115
                  +++D AGQ R++ L        +  + V D++ + + + A++ +  +      
Sbjct: 116 -------QVYDLAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNA 168

Query: 116 DDLVIYLLGNKVDLCQETP 134
               + ++GNK DL    P
Sbjct: 169 RRTPVLIIGNKADLVAPPP 187

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 32.0 bits (71), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 47  IHPNDGNETKDVVI-KFEIW---DTAGQERYKSLAPMYYRNANAALVVY--DITQEDSLQ 100
           I P  G     V +    IW   D +GQE ++ L   Y+   N   +VY  D +  D LQ
Sbjct: 51  IQPTIGQNVSFVSMDTHHIWKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDSDRLQ 110

Query: 101 KARNWVDELK----NKVGDDDLVIYLLGNKVDLCQETPS 135
           ++   ++EL+    N     D+ I ++ NK D C +  S
Sbjct: 111 ES---INELQARYVNTPAAVDIPIAVVLNKTDQCLDVSS 146

>KLLA0C02541g complement(226721..227533) weakly similar to
          sp|P52868 Saccharomyces cerevisiae YGL128c singleton,
          start by similarity
          Length = 270

 Score = 30.4 bits (67), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 6  LVLLGDSSVGKSSIVHRFVKDT--FDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFE 63
          L  + D+ V    I+H  V D    + +  + I   F   S+T+HP+  NE+ D+ I  +
Sbjct: 3  LAHVKDNHVDLYRILHIHVNDNEHLNSVTPTLINKQFRKLSLTLHPDKSNES-DLNITRD 61

Query: 64 IWDTAGQERYKSLA 77
           WD   Q  Y+ L+
Sbjct: 62 RWDNL-QSAYRILS 74

>ADR402W [2142] [Homologous to ScYAL048C - SH]
           complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 30.8 bits (68), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + ++V+ GD  VGKSS++   VKD F    +  + A  + +  +  P     T  +++  
Sbjct: 5   RIRIVVCGDKGVGKSSLIACLVKDQFIPNLQDALPAVTIPRDFSASPYSPQNT--ILVDT 62

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQK-ARNWVDELKNKVGDDDLVIY 121
           +  D AG ++         +NA+   +VY     DS ++ A  W+   ++ +G  +L + 
Sbjct: 63  KNSDLAGLQK-------ELKNADVIWLVY--ADHDSYERIALYWMMMFRS-LG-LNLPVI 111

Query: 122 LLGNKVD 128
           L  NK D
Sbjct: 112 LCRNKSD 118

>Sklu_2411.4 YMR023C, Contig c2411 8898-10388
          Length = 496

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 28/139 (20%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI--- 60
            KLVLLG  + GKSS+++    D      E++I ++         P    ++ DV I   
Sbjct: 248 IKLVLLGPPNAGKSSLLNSLTND------ETSIVSSI--------PGTTRDSIDVPIDVN 293

Query: 61  --KFEIWDTAG-------QERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKN 111
             K  + DTAG       Q   + +     +++ + LVV  +   + L    +  D +K+
Sbjct: 294 GYKVVLCDTAGIRKNSSDQIELQGIRRAKMKSSQSDLVVLLVDASNELYITDDLKDHIKS 353

Query: 112 KVGDDDLVIYLLGNKVDLC 130
           ++ D +++I +  NK DL 
Sbjct: 354 QLRDKNIIIVV--NKSDLV 370

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
          Saccharomyces cerevisiae YAL048c vacuolar aspartic
          proteasse singleton, start by similarity
          Length = 659

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDTF 28
          + ++V+ GDS VGK+S++   VKD F
Sbjct: 5  RIRIVVCGDSGVGKTSLIACLVKDQF 30

>Sklu_2213.1 YGR016W, Contig c2213 1040-1615
          Length = 191

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 45 ITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYY 81
          +T  P D  E +++V KFEI++    ERY  +  + Y
Sbjct: 25 VTFLPLDTEEQEELVNKFEIYNATENERYVQILSIVY 61

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDEL---KNKVGDDDLV 119
           ++WD  GQ   +     Y+   +  L V D+T      ++   +++L   ++++G    +
Sbjct: 91  QLWDIGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRCKM 150

Query: 120 IYLLGNKVDLCQETPST 136
           I LL NK+DL  E  S 
Sbjct: 151 IVLL-NKMDLIDEDESV 166

>Scas_698.27
          Length = 701

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDT----FDELR-------ESTIGA--AFLSQSITIHPN 50
              V+LG+ S GKS+I+ R ++D+     DE+R       +S + A   +LS+ +    +
Sbjct: 271 LNFVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMS 330

Query: 51  DGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARN 104
                   V +F  +D  G  ++ S +    R    A++  D    D+ + A N
Sbjct: 331 STFSLDKNVSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTIDCNT-DAFESAFN 383

>KLLA0D17358g complement(1477523..1483069) similar to sp|P11075
            Saccharomyces cerevisiae YDR170c SEC7 component of
            non-clathrin vesicle coat, start by similarity
          Length = 1848

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 133  TPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQG 168
            TP+  T+ +SN    EE+  RAI+ E  +    EQG
Sbjct: 1575 TPTNNTTKESNNSNVEEEVERAIAEENGQDVGNEQG 1610

>Scas_680.21
          Length = 183

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 45/109 (41%), Gaps = 10/109 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKF 62
           + K ++LG  + GKS++V++ + +      E T    F      ++ N G  T       
Sbjct: 16  ELKCLILGLDNSGKSTLVNKLLPEEERSQVEITPTIGFQ----IVNFNHGGYT------I 65

Query: 63  EIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKN 111
            +WD  GQ   +     Y+    A +   D++     Q++   + +L N
Sbjct: 66  SMWDIGGQTTLRPFWDNYFDKMEALVWCVDVSAPSRFQESLRELSQLLN 114

>Scas_721.90
          Length = 397

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 25/44 (56%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSI 45
          +QF L+LLG++ +GK++ ++       +   ++ +    LS +I
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNI 70

>KLLA0C06358g complement(563583..564482) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein singleton, start by similarity
          Length = 299

 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 59/143 (41%), Gaps = 22/143 (15%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPND----GNETKDVVI 60
           KL+L+G S  GKSS+    +   +       +GA     +I +  +     GN T     
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMT----- 56

Query: 61  KFEIWDTAGQE-----RYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKN-KVG 114
              +WD  GQ+      +       ++     + V+D+  +D L+    +   LK  K  
Sbjct: 57  -LNLWDCGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDVDIFTRALKQLKKY 115

Query: 115 DDDLVIYLLGNKVDLCQETPSTE 137
             D  I++L +K+DL Q    TE
Sbjct: 116 SPDAKIFVLVHKMDLVQLDKRTE 138

>Scas_539.1
          Length = 656

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 57/137 (41%), Gaps = 15/137 (10%)

Query: 6   LVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIW 65
           + + GD  VGKSS+V    K  F    +  I A  + +  + +P     T  V       
Sbjct: 8   IAICGDKGVGKSSLVLSLAKGRFLSNLQDVIPAVTIPRDFSSNPYSARRTILV------- 60

Query: 66  DTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGN 125
           DT+  E  K    M  RNA+   +VY   +E   + + +W+   ++     ++ + L  N
Sbjct: 61  DTSEAEPEK--LQMELRNADVIWLVY-CDRESYERVSLHWMMMFRSM--GLNIPVVLCKN 115

Query: 126 KVDLCQETPSTETSPDS 142
           K   C E P  +   +S
Sbjct: 116 K---CDEYPGGDVYSNS 129

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
            Saccharomyces cerevisiae YLL048c YBT1 yeast bile
            transporter, start by similarity
          Length = 1650

 Score = 28.1 bits (61), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 8/55 (14%)

Query: 5    KLVLLGDSSVGKSSIV---HRFVKD-----TFDELRESTIGAAFLSQSITIHPND 51
            K+ ++G +  GKS+I+    RF+         D++  +TIG   L QSITI P D
Sbjct: 1405 KVGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQD 1459

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKD 26
            KLVLLG  +VGKSS+V+    D
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTND 297

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,529,466
Number of extensions: 327425
Number of successful extensions: 1510
Number of sequences better than 10.0: 240
Number of HSP's gapped: 1280
Number of HSP's successfully gapped: 242
Length of query: 231
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 133
Effective length of database: 13,203,545
Effective search space: 1756071485
Effective search space used: 1756071485
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)