Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKR013W (PRY2)3292869061e-122
CAGL0G07667g2581345871e-74
Scas_675.272901355786e-73
KLLA0D02442g3681335673e-70
Kwal_14.24103731345552e-68
YJL079C (PRY1)2991295483e-68
Sklu_956.13191215363e-66
Scas_711.372671355298e-66
YJL078C (PRY3)8811335571e-64
AAL179W3601344523e-53
CAGL0F05137g2271374231e-50
KLLA0D02420g2121344117e-49
Kwal_14.24092381333998e-47
AAL178W2051333751e-43
KLLA0C01496g4561352684e-26
AFR700W4341432596e-25
Kwal_33.131927991462414e-22
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR013W
         (324 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   353   e-122
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   230   1e-74
Scas_675.27                                                           227   6e-73
KLLA0D02442g complement(207613..208719) some similarities with s...   223   3e-70
Kwal_14.2410                                                          218   2e-68
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   215   3e-68
Sklu_956.1 YJL079C, Contig c956 998-1957                              211   3e-66
Scas_711.37                                                           208   8e-66
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   219   1e-64
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   178   3e-53
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   167   1e-50
KLLA0D02420g complement(206544..207182) some similarities with s...   162   7e-49
Kwal_14.2409                                                          158   8e-47
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   149   1e-43
KLLA0C01496g complement(113533..114903) some similarities with s...   107   4e-26
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   104   6e-25
Kwal_33.13192                                                          97   4e-22

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  353 bits (906), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/286 (64%), Positives = 185/286 (64%)

Query: 39  GIVRVENGQTLTTFITKGXXXXXXXXXXXXXXPIVVANAQVDSIATSVIQXXXXXXXXXX 98
           GIVRVENGQTLTTFITKG              PIVVANAQVDSIATSVIQ          
Sbjct: 39  GIVRVENGQTLTTFITKGTQTASASPVATTSAPIVVANAQVDSIATSVIQESAVVAESAT 98

Query: 99  XXXXXXXXXXXXXXXXXXIQAVQTSASATQDDVXXXXXXXXXXXXXXXXXXXXXXXXXXX 158
                             IQAVQTSASATQDDV                           
Sbjct: 99  FEESSTETSEAFSTATATIQAVQTSASATQDDVTTTLTSSTQPTSTTTPTTTTTSPTTTT 158

Query: 159 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFSTSMVNEHNTKRALHKDTGSLTWSDT 218
                                           DFSTSMVNEHNTKRALHKDTGSLTWSDT
Sbjct: 159 SPTTTASPTTTASPTTATTTQSTASSTQSSSSDFSTSMVNEHNTKRALHKDTGSLTWSDT 218

Query: 219 LATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESA 278
           LATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESA
Sbjct: 219 LATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESA 278

Query: 279 GHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGEFADN 324
           GHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGEFADN
Sbjct: 279 GHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGEFADN 324

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  230 bits (587), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 100/134 (74%), Positives = 115/134 (85%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250
           DF+ SM+NEHN KRALH+DT  LTWSD LA YAQNYA++YDCSGNLVHSGGPYGENLA+G
Sbjct: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIG 179

Query: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310
           Y   GSVDAWY+EI  Y+Y+NPGFSES GHFTQVVWK +++VGC +KSCGG WGDY+ICS
Sbjct: 180 YSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICS 239

Query: 311 YKAAGNVIGEFADN 324
           Y  AGN +GEFA N
Sbjct: 240 YDPAGNFLGEFAQN 253

>Scas_675.27
          Length = 290

 Score =  227 bits (578), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 119/135 (88%), Gaps = 1/135 (0%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250
           +F++S++NEHN KRALH++T +L+WSD LA+YAQNYAD+YDCSGNLVHSGGPYGENLALG
Sbjct: 151 EFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALG 210

Query: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGE-WGDYIIC 309
           Y   GSVDAWYNEI+SYDYSNPGFSE+AGHFTQVVWK +++VGCG+K C    WG Y+IC
Sbjct: 211 YDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVIC 270

Query: 310 SYKAAGNVIGEFADN 324
           SY  AGN IGEFA+N
Sbjct: 271 SYNPAGNFIGEFAEN 285

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  223 bits (567), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 97/133 (72%), Positives = 115/133 (86%)

Query: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251
           F++SM++EHN KRALHKDT +L+WSD LA+YAQNYAD YDCSG+L HSGGPYGENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 252 GTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSY 311
           GTTG+VDAWY+EI  Y +SNP +S S GHFTQVVWK T++VGCG+K CGG WGDYIICSY
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 312 KAAGNVIGEFADN 324
             AGN++G FA N
Sbjct: 351 DPAGNMLGTFASN 363

>Kwal_14.2410
          Length = 373

 Score =  218 bits (555), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 95/134 (70%), Positives = 114/134 (85%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250
           DF+++++  HN KR+LHKDT  L+WSD LA+YAQ+YAD YDCSG+L HSGGPYGENLA+G
Sbjct: 235 DFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVG 294

Query: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310
           Y TTGSVDAWY EI  YD+SNP +S S GHFTQVVWKG+S +GCG+KSCGG  GDY+ICS
Sbjct: 295 YSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVICS 354

Query: 311 YKAAGNVIGEFADN 324
           YK AGN +GEFA+N
Sbjct: 355 YKTAGNFLGEFAEN 368

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  215 bits (548), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 94/129 (72%), Positives = 112/129 (86%)

Query: 196 MVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTG 255
           ++ EHN KRALHKDT +L+WSDTLA+YAQ+YAD+YDCSG L HSGGPYGENLALGY    
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 256 SVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAG 315
           +VDAWYNEI++YD+SNPGFS + GHFTQVVWK T++VGCG+K+CGG WGDY+ICSY  AG
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 316 NVIGEFADN 324
           N  GE+ADN
Sbjct: 286 NYEGEYADN 294

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  211 bits (536), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (86%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250
           DF++S+++EHN KRALHKDT +LTWS+TLA YAQ YADSYDCSG+L HSGGPYGENLALG
Sbjct: 171 DFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALG 230

Query: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310
           Y  TG+VDAWY EI+SYD+SNP +S S GHFTQVVWK TSEVGCG+KSC   WG Y+ICS
Sbjct: 231 YSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICS 290

Query: 311 Y 311
           Y
Sbjct: 291 Y 291

>Scas_711.37
          Length = 267

 Score =  208 bits (529), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%), Gaps = 1/135 (0%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADS-YDCSGNLVHSGGPYGENLAL 249
           DF +S++ EHN KRALH++TG LTWS+ LA YAQ YAD+ Y+C G L+HSGGPYGENLA 
Sbjct: 127 DFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAA 186

Query: 250 GYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIIC 309
           GY   GSVDAWYNEI+ YDYSNPGFSES GHFTQ+VWK TS+VGC +KSC   WG Y+IC
Sbjct: 187 GYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLIC 246

Query: 310 SYKAAGNVIGEFADN 324
           SY +AGN  GE+  N
Sbjct: 247 SYNSAGNFDGEYEAN 261

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  219 bits (557), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 94/133 (70%), Positives = 107/133 (80%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250
           +F + ++NEHN  RALH DT  LTWSDTLATYAQNYAD YDCSG L HS GPYGENLALG
Sbjct: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83

Query: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310
           Y  TG+VDAWY EI+ Y+YSNPGFSES GHFTQVVWK T+E+GCG K CG  W +YI+CS
Sbjct: 84  YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143

Query: 311 YKAAGNVIGEFAD 323
           Y   GN +GEFA+
Sbjct: 144 YNPPGNYLGEFAE 156

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  178 bits (452), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 75/134 (55%), Positives = 97/134 (72%), Gaps = 1/134 (0%)

Query: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251
           F   ++  HN++R LHKDT  LTWS+ LA +A+++A+ YDCSG LVHS  PYGENLA+GY
Sbjct: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY 281

Query: 252 GTT-GSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310
            T   +V AWY+EI+ Y YS+P FS S GHF+Q+VWK T  +GC +K CGG  GDY+ICS
Sbjct: 282 PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICS 341

Query: 311 YKAAGNVIGEFADN 324
           Y  AGN +  F +N
Sbjct: 342 YDPAGNFLRRFGEN 355

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  167 bits (423), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (67%), Gaps = 3/137 (2%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGG---PYGENL 247
           ++   M+++HN KR LHKDT SL W+D LA  AQ+YAD YDCSGNL H+       GENL
Sbjct: 86  EWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENL 145

Query: 248 ALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYI 307
           A+GY    ++DAWY+EI  YDYSNP       HFTQ+VWK T  VGC  K+CGG+  +YI
Sbjct: 146 AVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYI 205

Query: 308 ICSYKAAGNVIGEFADN 324
           +C Y  AGN  GEFADN
Sbjct: 206 VCEYDPAGNWAGEFADN 222

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  162 bits (411), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 95/134 (70%), Gaps = 1/134 (0%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250
           DF T +++ HN+ R  H+   SL W+  LA+ AQN+A+SY C+G L HS  PYGENLALG
Sbjct: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133

Query: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310
           Y TT +V AWYNE+  YD++NP F+ + GHFTQ+VWK TS++GC    CG  +G Y +C 
Sbjct: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193

Query: 311 YKAAGNVIGEFADN 324
           Y   GNVIG+F++N
Sbjct: 194 YDPPGNVIGKFSEN 207

>Kwal_14.2409
          Length = 238

 Score =  158 bits (399), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 69/133 (51%), Positives = 89/133 (66%), Gaps = 1/133 (0%)

Query: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251
           F + M+  HN  R LH D  +L WS  L  +AQ YA++Y+C+G L+HSG PYGENLALG+
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161

Query: 252 GTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSY 311
            TT +  AWY+E+  Y+Y  PGFSE  GHFTQ+VWK +  +GC    CG  +G Y ICSY
Sbjct: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221

Query: 312 KAAGNVIGEFADN 324
              GNV G++ DN
Sbjct: 222 DPPGNVAGQYQDN 234

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  149 bits (375), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 89/133 (66%), Gaps = 1/133 (0%)

Query: 192 FSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGY 251
           F++++++ HN  R  H     L W+ TL T+AQ+YA+   C+G+LVHSG P+GENLALGY
Sbjct: 71  FASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129

Query: 252 GTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSY 311
               +V AWY+EI  YD+S PGFS + GHFTQ+VW+ T+ VGC    CG  +G YIIC Y
Sbjct: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189

Query: 312 KAAGNVIGEFADN 324
              GNV  ++  N
Sbjct: 190 DPPGNVADQYVAN 202

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  107 bits (268), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 80/135 (59%), Gaps = 13/135 (9%)

Query: 195 SMVNEHNTKRALHKDTGSLTWSDTLATYAQNY------ADSYDCSGNLVHSGGPYGENLA 248
           S++N HN  RA H+ T  L W++ LA YA +Y      +D+  C+  L HSGGPYGENLA
Sbjct: 300 SVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENLA 359

Query: 249 LGYGTTGS--VDAWYNEITSYDYSN-PGFSES---AGHFTQVVWKGTSEVGCGLKSCGGE 302
            G  +  +  V  WY+EI  YDY+N  G S +    GHFTQ+VW  +++VGC +  C   
Sbjct: 360 AGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSS- 418

Query: 303 WGDYIICSYKAAGNV 317
              Y+IC Y  AGNV
Sbjct: 419 GSVYLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  104 bits (259), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 16/143 (11%)

Query: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSY------DCSGNLVHSGGPYG 244
           + ++ +V  HN KR LH+DT  L W++ L+ +A +Y           C+  L HS GPYG
Sbjct: 269 NVASELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYG 328

Query: 245 ENLALGYGT-----TGSVDAWYNEITSYDYSNPG----FSESAGHFTQVVWKGTSEVGCG 295
           EN+A G  +     T  V++WYNEI  YDY++        ++ GHFTQ+VW  + EVGC 
Sbjct: 329 ENIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCA 388

Query: 296 LKSCGGE-WGDYIICSYKAAGNV 317
           +  C     G YI+C Y   GN+
Sbjct: 389 VVYCSNNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score = 97.4 bits (241), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 84/146 (57%), Gaps = 23/146 (15%)

Query: 193 STSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYD------CSGNLVHSGGP--YG 244
           +++++ EHN KR+LH +T  L W D L+ +A NYA+S        CSG L HS      G
Sbjct: 632 ASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQG 691

Query: 245 ENLALGYGTTGS----VDAWYNEITSYDYSN-PGF---SESAGHFTQVVWKGTSEVGCGL 296
           EN+A  +GTT +    VD WY+EI+ YDY +  G     +  GHFTQ+VW  T +VGC +
Sbjct: 692 ENIA--FGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAV 749

Query: 297 KSCG-----GEWGDYIICSYKAAGNV 317
             C      G+   Y++C YK AGNV
Sbjct: 750 VQCDTMAKYGQNSIYLLCEYKDAGNV 775

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,923,191
Number of extensions: 210419
Number of successful extensions: 394
Number of sequences better than 10.0: 17
Number of HSP's gapped: 376
Number of HSP's successfully gapped: 18
Length of query: 324
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 222
Effective length of database: 13,065,073
Effective search space: 2900446206
Effective search space used: 2900446206
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)