Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKR011C35334817870.0
Scas_675.263193503887e-44
AAL180C2973142704e-27
CAGL0B03201g3182272409e-23
Kwal_14.24142933202337e-22
KLLA0C09372g2942211993e-17
Sklu_1768.254223653.8
KLLA0D04994g142886645.6
Sklu_1927.259250646.2
Kwal_33.1463660881646.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR011C
         (348 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protei...   692   0.0  
Scas_675.26                                                           154   7e-44
AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)...   108   4e-27
CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02...    97   9e-23
Kwal_14.2414                                                           94   7e-22
KLLA0C09372g 816494..817378 weakly similar to sp|Q02209 Saccharo...    81   3e-17
Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement         30   3.8  
KLLA0D04994g 427195..431481 similar to sp|P25558 Saccharomyces c...    29   5.6  
Sklu_1927.2 YDR479C, Contig c1927 1209-2987                            29   6.2  
Kwal_33.14636                                                          29   6.4  

>YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protein
           of unknown function [1062 bp, 353 aa]
          Length = 353

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/348 (96%), Positives = 336/348 (96%)

Query: 1   MSKLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKID 60
           MSKLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKID
Sbjct: 1   MSKLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKID 60

Query: 61  CAPAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVKNTSWKE 120
           CAPAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVKNTSWKE
Sbjct: 61  CAPAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVKNTSWKE 120

Query: 121 VFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFNME 180
           VFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFNME
Sbjct: 121 VFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFNME 180

Query: 181 VFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCSNNEP 240
           VFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCSNNEP
Sbjct: 181 VFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCSNNEP 240

Query: 241 SASLESESRHFXXXXXXXXXXXXTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKSNF 300
           SASLESESRHF            TDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKSNF
Sbjct: 241 SASLESESRHFSPVNSLSPSSLSTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKSNF 300

Query: 301 ESYFKLMAEDYETFDLRAWSRQRPRKFQLVEKKKITKNPPNSHHPHKN 348
           ESYFKLMAEDYETFDLRAWSRQRPRKFQLVEKKKITKNPPNSHHPHKN
Sbjct: 301 ESYFKLMAEDYETFDLRAWSRQRPRKFQLVEKKKITKNPPNSHHPHKN 348

>Scas_675.26
          Length = 319

 Score =  154 bits (388), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 108/350 (30%), Positives = 171/350 (48%), Gaps = 42/350 (12%)

Query: 1   MSKLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKID 60
           M+  ET+YLY G+ QP+VKLT +++    + +IK+ HSIQ+ Y IE Q  ETITENLK+ 
Sbjct: 1   MTTSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENLKLT 60

Query: 61  CAPAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVK------ 114
              +       P F I+EY EI D+F++WKS+G+W++  +   +Y        K      
Sbjct: 61  STSSLATS---PTF-IIEYNEIYDSFYVWKSEGKWEMTDIVTQIYNTQSQPKAKTKTPNG 116

Query: 115 -NTSWKEVFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKK 173
              SW+  F+ND R K++ K+  L+  L  +N D S +++ +FW+Q D ICQ  +     
Sbjct: 117 ATKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDS----- 171

Query: 174 QEQFNMEVFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLA 233
               +M    + K+ + +A+ +T++  NK+LL   +  Y    +   N  E    +NS  
Sbjct: 172 ----HMGNESSCKSFIVMALFRTRISRNKKLLQKLISEYGERCRN--NSTEAITSDNSAE 225

Query: 234 SCSNNEPSASLESESRHFXXXXXXXXXXXXTDDEAVSTDYIYKGPESKPNVNFMHSSATN 293
               + P A L  E                    + +  Y Y  P ++ + + +      
Sbjct: 226 LAIEDSPLADLPIEEEGLKT-------------SSSNQHYSYHQPSTRDSKDIVAKQ--- 269

Query: 294 DLIKSNFESYFKLMAEDYETFDLRAWSRQRPRKFQLVEKKKITKNPPNSH 343
             + SNF  +FK+ AEDYE FDL+      PRK +     KITK+    H
Sbjct: 270 --VFSNFNRHFKVTAEDYELFDLKT-KAGIPRKLRR-NSSKITKDTRTKH 315

>AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)
           [894 bp, 297 aa]
          Length = 297

 Score =  108 bits (270), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 149/314 (47%), Gaps = 53/314 (16%)

Query: 3   KLETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDCA 62
           ++E +Y+Y+GE  PRV+L  ++    + +V  +V  +Q+ Y + L T ETIT NLKI C 
Sbjct: 8   EMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGC- 66

Query: 63  PAYLKPNCIPHFYILEYEEISDTFFIWK-SDGRWQLNKLSALLYVDNDANVVKNTSWKEV 121
             +      P FYILEY E++  + +WK +D  W+L+ + A +Y        +       
Sbjct: 67  DTHADCEACP-FYILEYNEVTTEYSLWKAADADWRLDSIVATMYTGAGGPARERGGLPRE 125

Query: 122 FQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFNMEV 181
            Q  +   + +   ++ +CL ++N  L +++    W+++ ++ +S+   K+  +   +  
Sbjct: 126 LQGLREGLDME---YVWDCLRRLNLPLEQID----WAEFRELLESMLAAKRVADDDCV-- 176

Query: 182 FDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCSNNEPS 241
               + +V++A ++  V ++KR + + L+ Y   ++            ++ AS   + P 
Sbjct: 177 --TLRGVVALAALQATVQTSKRAVRSQLRAYDRRVRAA----------STPASTRTSSPE 224

Query: 242 ASLESESRHFXXXXXXXXXXXXTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKSNFE 301
           + L ++SR               +    S  Y Y  P ++              + +NF+
Sbjct: 225 SLLPADSR---------------ESSVSSVHYTYGLPATQ--------------LDANFK 255

Query: 302 SYFKLMAEDYETFD 315
           +YF+ MAE++E F+
Sbjct: 256 TYFRSMAENFELFE 269

>CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5, hypothetical
           start
          Length = 318

 Score = 97.1 bits (240), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 116/227 (51%), Gaps = 15/227 (6%)

Query: 5   ETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDC--A 62
           ETVY+  GE    V+L+ +       +++ +   IQ+   ++ + SETI +NLK++    
Sbjct: 4   ETVYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVFLG 62

Query: 63  PAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDN------DANVVKNT 116
             ++K   +P FYI+E+ +  + F +W+SDG+W  ++     + D        A   K+ 
Sbjct: 63  NTHIKSG-MP-FYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120

Query: 117 SWKEVFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQ 176
            W+E F   +R + +  +  L+N L+K+N D S  N   FW + D  C+  AKQ  K   
Sbjct: 121 DWRE-FVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQASKHAT 179

Query: 177 FNMEVFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQ 223
            + E    F +IV +A+IK ++  NK ++   +  +H  M +K+  +
Sbjct: 180 ASTE---GFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFR 223

>Kwal_14.2414
          Length = 293

 Score = 94.4 bits (233), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 159/320 (49%), Gaps = 52/320 (16%)

Query: 7   VYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDCAPAYL 66
           +Y+  G++Q  VKLT +     ++QV +F+HS+Q+ + +EL    TIT+NLKI C  ++ 
Sbjct: 12  IYVPIGDDQS-VKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDNLKIQCV-SHR 69

Query: 67  KPNCIPHFYILEYEEISDTFFIWKSDGRWQLN-KLSALLYVDNDANVVKNTSWKEVFQND 125
             N  P  YILE++++S  + +WKS G W L   L++L    N A  V  T   +    +
Sbjct: 70  ACNSCP-LYILEFDDVSQGYALWKSPGDWALGIMLTSLYATKNGARRVHPT--LKALVAE 126

Query: 126 QRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFN--MEVFD 183
           Q    +D   +L   L+K+N D   ++    ++ + K+ +   + +     ++  +++  
Sbjct: 127 QVSSKHDA-PFLMETLQKLNVDWDNIDTRFDFTLFLKLLEEALELEIGTRDYSSYLDIVT 185

Query: 184 --NFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCS---NN 238
              +K+++++A+++TKV  +KRLL  +L +Y + M+   +  ++  +E S+ S S   + 
Sbjct: 186 RLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRMRAADDACKEASREASVLSDSIVHSR 245

Query: 239 EPSASLESESRHFXXXXXXXXXXXXTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLIKS 298
            PS S                     DDE     Y+    +                + +
Sbjct: 246 SPSTS-----------------APVPDDE-----YLLSSKQ----------------LVT 267

Query: 299 NFESYFKLMAEDYETFDLRA 318
           NF+++F+ MAE +ETFD+++
Sbjct: 268 NFQNHFRNMAETFETFDVKS 287

>KLLA0C09372g 816494..817378 weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5 hypothetical
           protein singleton, start by similarity
          Length = 294

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/221 (28%), Positives = 117/221 (52%), Gaps = 36/221 (16%)

Query: 4   LETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDC-- 61
           ++ +Y+YAGE +P+V+LT IK    + ++I+++H +Q+++ ++L+  ETIT NLKI    
Sbjct: 1   MDKIYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNS 60

Query: 62  ----APAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDNDANVVKNTS 117
                  + KP     FYILEY    DT+ +WKS   W+L+   A LY  N    + +  
Sbjct: 61  HSDDTDDHDKP-----FYILEYCVAEDTYSLWKSRSEWKLSSAIATLYGSNTLTDLPD-R 114

Query: 118 WKEVFQNDQRFKNYDKRAWLQNCLEKMN-RDLSKLNVEQFWSQYDKICQSI-----AKQK 171
             E  ++ Q          ++N L++ N RD  K++       +D I   +     A++ 
Sbjct: 115 LVEALKDSQHI------FMVRNLLKEFNIRDTMKID-------WDSIATDLMIFFEAREL 161

Query: 172 KKQEQFNMEVFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNY 212
           KK     ++ ++  K  ++++++++ V  NKR L +TL +Y
Sbjct: 162 KKP----IDPYE-LKTSMALSLLRSMVDLNKRELGSTLLSY 197

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 285 NFMHSSATNDLIKSNFESYFKLMAEDYETFDLRAWSRQRPRKFQLVEKKKITKNPPNSHH 344
           ++ H  +T   ++SNF ++F+ MAE++ET+D       R  +     K K  K P    H
Sbjct: 227 DYTHMPSTQ--LQSNFNTFFQSMAENFETYDTERQPSTRSLRLPSFAKNK--KTPAGQVH 282

>Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement
          Length = 542

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%)

Query: 82  ISDTFFIWKSD-GRWQLNKLSAL 103
           IS  +FIW  +  RW L KLSAL
Sbjct: 268 ISSVYFIWDPEYARWSLGKLSAL 290

>KLLA0D04994g 427195..431481 similar to sp|P25558 Saccharomyces
           cerevisiae YCL014w BUD3 budding protein singleton,
           hypothetical start
          Length = 1428

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query: 69  NCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDN---DANVVKNTSWKEVFQND 125
           NC P+   LE  E+   FF     G+  L KL++    DN     + +     KE+  N 
Sbjct: 649 NCPPNIKQLEEHELDLAFFATLDTGKISLTKLTSEGTSDNVEVTLDELVTVLTKELMSNY 708

Query: 126 QRFKNYDKRAWLQNCLEKMNRDLSKL 151
            ++  Y  +A   N L ++N  L+KL
Sbjct: 709 GKY-TYSFKAPFYNELLRINEQLTKL 733

>Sklu_1927.2 YDR479C, Contig c1927 1209-2987
          Length = 592

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 4/50 (8%)

Query: 105 YVDNDANVVKNTSWKEVFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVE 154
           YVD D      T W      D    +Y +R W++ C+ K + D+   N++
Sbjct: 422 YVDIDVG----TKWVYDLNFDGSRGDYRRRRWIRVCVRKADEDIPSRNID 467

>Kwal_33.14636
          Length = 608

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 4/81 (4%)

Query: 128 FKNY-DKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQFNMEVFDNFK 186
            KN+ D   W Q+  E + R    +N E+    Y ++C  I   +  Q + +ME F  FK
Sbjct: 218 MKNFSDNATWFQDVFE-IGRRYKIMNPEKMRDTYGRLCYMIMDSRLPQIEDHME-FHLFK 275

Query: 187 NIVSI-AIIKTKVLSNKRLLT 206
            I ++ + + +K   N R L+
Sbjct: 276 PITTVHSYLSSKPEDNGRALS 296

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.129    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,130,099
Number of extensions: 534142
Number of successful extensions: 2174
Number of sequences better than 10.0: 42
Number of HSP's gapped: 2217
Number of HSP's successfully gapped: 44
Length of query: 348
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 246
Effective length of database: 13,065,073
Effective search space: 3214007958
Effective search space used: 3214007958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)