Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKR010C (TOF2)77175735860.0
Scas_675.2413191542875e-26
YJL076W (NET1)11891602572e-22
CAGL0H02783g17852562521e-21
Kwal_14.242112052382501e-21
CAGL0B03179g9271542357e-20
KLLA0C09394g11841652322e-19
AAL181C12212462242e-18
Scas_711.389981511964e-15
AAL016C1478120685.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKR010C
         (757 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...  1385   0.0  
Scas_675.24                                                           115   5e-26
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   103   2e-22
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   101   1e-21
Kwal_14.2421                                                          100   1e-21
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...    95   7e-20
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...    94   2e-19
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...    91   2e-18
Scas_711.38                                                            80   4e-15
AAL016C [171] [Homologous to ScYCL014W (BUD3) - SH] (311460..315...    31   5.3  

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/757 (91%), Positives = 692/757 (91%)

Query: 1   MIKMWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSIXXXXXXXXXX 60
           MIKMWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSI          
Sbjct: 1   MIKMWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSINNCSDPSPTS 60

Query: 61  XXXXXXXXXXXXXDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIV 120
                        DFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIV
Sbjct: 61  PSSQNSIQSNRSSDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIV 120

Query: 121 SLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISXXXXXXXXXXXDNKPST 180
           SLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHIS           DNKPST
Sbjct: 121 SLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQLARQRRRQDNKPST 180

Query: 181 KSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILPLASKYDA 240
           KSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILPLASKYDA
Sbjct: 181 KSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILPLASKYDA 240

Query: 241 LNKEKCPMPLTSTVVASNVHKDVKDHARAKEGVVTQGSDNNKENIPSSTQQQKNDGAKRA 300
           LNKEKCPMPLTSTVVASNVHKDVKDHARAKEGVVTQGSDNNKENIPSSTQQQKNDGAKRA
Sbjct: 241 LNKEKCPMPLTSTVVASNVHKDVKDHARAKEGVVTQGSDNNKENIPSSTQQQKNDGAKRA 300

Query: 301 ESKDLDLLRNSSEDADYEPADENSPQISFDSIDTDFQLSTTSHTNSDMHIQYSNPSSGAH 360
           ESKDLDLLRNSSEDADYEPADENSPQISFDSIDTDFQLSTTSHTNSDMHIQYSNPSSGAH
Sbjct: 301 ESKDLDLLRNSSEDADYEPADENSPQISFDSIDTDFQLSTTSHTNSDMHIQYSNPSSGAH 360

Query: 361 SPRKSSLEIKVQNKKGDDLPLNDKDIGENCRRIEAFSDEEDFNETDNDRADSFINNSKKA 420
           SPRKSSLEIKVQNKKGDDLPLNDKDIGENCRRIEAFSDEEDFNETDNDRADSFINNSKKA
Sbjct: 361 SPRKSSLEIKVQNKKGDDLPLNDKDIGENCRRIEAFSDEEDFNETDNDRADSFINNSKKA 420

Query: 421 SMGFRDINSDLDSVSFNSDIENAVQSTQSTKNVVSPPFFPEKELNNRLHQSQGKEALFRL 480
           SMGFRDINSDLDSVSFNSDIENAVQSTQSTKNVVSPPFFPEKELNNRLHQSQGKEALFRL
Sbjct: 421 SMGFRDINSDLDSVSFNSDIENAVQSTQSTKNVVSPPFFPEKELNNRLHQSQGKEALFRL 480

Query: 481 VEKEFPDKSLGAASSTSHAKDVKIQETIRKLNRFKPTGETKVQKRNSITEPYYGKFGIMK 540
           VEKEFPDKSLGAASSTSHAKDVKIQETIRKLNRFKPTGETKVQKRNSITEPYYGKFGIMK
Sbjct: 481 VEKEFPDKSLGAASSTSHAKDVKIQETIRKLNRFKPTGETKVQKRNSITEPYYGKFGIMK 540

Query: 541 KDKPKSITSKGVSLETKHFDDPNTIISGEKFAKFGKIKVKRKTDDVGSKVIEFKRKRNMG 600
           KDKPKSITSKGVSLETKHFDDPNTIISGEKFAKFGKIKVKRKTDDVGSKVIEFKRKRNMG
Sbjct: 541 KDKPKSITSKGVSLETKHFDDPNTIISGEKFAKFGKIKVKRKTDDVGSKVIEFKRKRNMG 600

Query: 601 NRSLKDIFANAGKPPNAASTIKVVKLMRDPVDNSKDKVEATSNSTAQEQEQVSPKLPVMN 660
           NRSLKDIFANAGKPPNAASTIKVVKLMRDPVDNSKDKVEATSNSTAQEQEQVSPKLPVMN
Sbjct: 601 NRSLKDIFANAGKPPNAASTIKVVKLMRDPVDNSKDKVEATSNSTAQEQEQVSPKLPVMN 660

Query: 661 STPGKRKNGQAIPSSLERTPQLKKVKVTRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
           STPGKRKNGQAIPSSLERTPQLKKVKVTR                               
Sbjct: 661 STPGKRKNGQAIPSSLERTPQLKKVKVTRSHSSPSSSSSMSLESSLDSSSSDDSDDDSDS 720

Query: 721 RNVQVKKINFKTSHGPAGNSNGKPMLDVDDNEINTKK 757
           RNVQVKKINFKTSHGPAGNSNGKPMLDVDDNEINTKK
Sbjct: 721 RNVQVKKINFKTSHGPAGNSNGKPMLDVDDNEINTKK 757

>Scas_675.24
          Length = 1319

 Score =  115 bits (287), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 84/154 (54%)

Query: 4   MWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSIXXXXXXXXXXXXX 63
           M++LQ+VLVPPSA+D +  L    N P S   M   N   I   + I             
Sbjct: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60

Query: 64  XXXXXXXXXXDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQ 123
                              KKFLHFT   N+LL LS+E+L K +++YPN  E +EI++LQ
Sbjct: 61  NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDLEILTLQ 120

Query: 124 DRHGCDLDSEFIIKDVFENDGVVLVILKDELDWS 157
           D +GCDLD +F +KD+F  D VV+V++K+ELD S
Sbjct: 121 DINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVS 154

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 86/160 (53%), Gaps = 8/160 (5%)

Query: 4   MWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSIXXXXXXXXXXXXX 63
           M++LQ+VLVPPS       L+A +       P +  +  ++ +  ++             
Sbjct: 1   MYKLQVVLVPPS-------LQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYAN 53

Query: 64  XXXXXXXXXXDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQ 123
                      + N     +KFL FT   NTLL LS+EI+ K +++YP+ +E IEI+SLQ
Sbjct: 54  LRSANVSFTPSYFNQS-RFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQ 112

Query: 124 DRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHIS 163
           D  GCDLD +F++KDVF  + +V VILK+E+D   +  +S
Sbjct: 113 DNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVS 152

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 122/256 (47%), Gaps = 37/256 (14%)

Query: 4   MWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDII-----THNNSIXXXXXXXX 58
           M++LQ++LVPPS Q+         N  Q+ + +   ++ +      T NN+         
Sbjct: 1   MYKLQVLLVPPSIQN--NNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDS 58

Query: 59  XXXXXXXXXXXXXXXDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIE 118
                                 + KKFLHFT  +NTLL LS+EI  K   +YP+ +  ++
Sbjct: 59  SIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLD 118

Query: 119 IVSLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISXXXXXXXXXXXDNKP 178
           I+SLQD +GCDLD +F++KDVF  D +V VIL DELD S    +S               
Sbjct: 119 ILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVS--------------- 163

Query: 179 STKSIVTEKRKKISKEDLSSISNK-------DTMHLIAKSSLKNNFIN-----KSRVSTP 226
           S +SI   KR++++ E L+   ++        ++ ++ K    +N I        R+STP
Sbjct: 164 SYRSI---KRRRLNPESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTP 220

Query: 227 LMNEILPLASKYDALN 242
           L  ++ P ++ ++  N
Sbjct: 221 LARQLYPPSAIFEPQN 236

>Kwal_14.2421
          Length = 1205

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 111/238 (46%), Gaps = 31/238 (13%)

Query: 4   MWRLQIVLVPPSAQDIITFLEARLNTP---QSVSPMVQYNEDIITHNNSIXXXXXXXXXX 60
           M++LQ+VLVPP    +   L     T    Q + P +  N   I   N            
Sbjct: 1   MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN 60

Query: 61  XXXXXXXXXXXXXDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIV 120
                              P  +K LHFT   NTL  L+ EI+ + D++YPN    +E++
Sbjct: 61  NLFMSSFASTH-----GSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVL 115

Query: 121 SLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISXXXXXXXXXXXDNKPST 180
           +LQD + CDLD ++++KDVF  D VV  +L+++++ S +Q                   +
Sbjct: 116 TLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQ-------------------S 156

Query: 181 KSIVTEKRKKISKEDLSSISNKDTMHLIAKSS--LKNNFINKSRVSTPLMNEILPLAS 236
           +++ + KR++++    +     + +H+  K    L+N+  +  RVSTPL N+I P A+
Sbjct: 157 QTLYSAKRRRLNSSLPNPSGQPNVLHIAKKRPHMLRNS--SAMRVSTPLANQIYPPAT 212

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score = 95.1 bits (235), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 11/154 (7%)

Query: 82  CKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFK-ESIEIVSLQDRHGCDLDSEFIIKDVF 140
            +KFLHFT  +NTLLQL++EI  +  +LY N   ES EI+SLQD + CDLD+ +++KDVF
Sbjct: 46  TRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKDVF 105

Query: 141 ENDGVVLVILKDELDWSRNQHISXXXXXXXXXXXDNKPSTKSIVTEKRKKISKEDLSSIS 200
             D  VLVILK+EL++     I            D      S  +  RK+ S +   + S
Sbjct: 106 SMDNTVLVILKNELEF-----IDANGTLNANDLHD--AGRISAYSSVRKRRSSKAFGNSS 158

Query: 201 NKDTMHLIAKSSLKNNFI---NKSRVSTPLMNEI 231
             +   L+ K S  NN     N  RV++PL NEI
Sbjct: 159 RIEPQILVPKRSKPNNLAPLSNNLRVTSPLANEI 192

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 90/165 (54%), Gaps = 27/165 (16%)

Query: 80  PNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQDRHGCDLDSEFIIKDV 139
           P  KKFL FT   NTL QLS EIL K +++YPN    +EI +LQD   CDLD +F++KDV
Sbjct: 84  PKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTELEIDTLQDVDECDLDPDFVVKDV 143

Query: 140 FENDGVVLVILKDELDWSRNQHISXXXXXXXXXXXDNKPSTKSIVTEKRKKI----SKED 195
           F     V VIL++++D   N                     +S+ + KR+K+    S+++
Sbjct: 144 FNVYNTVRVILRNDVDLESNPD-----------------RQESLYSSKRRKLNNGNSQQN 186

Query: 196 LSSISNKDTMHLIAK---SSLKNNFINKSRVSTPLMNEILPLASK 237
            S+ +  D    +AK    +LKN+ +   R+STPL ++I P  S+
Sbjct: 187 TSTGATLDQPVTVAKRRPQALKNSAL---RISTPLAHQIYPPPSQ 228

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 105/246 (42%), Gaps = 42/246 (17%)

Query: 4   MWRLQIVLVPPSAQD---IITFLEARLNTPQSVSPMVQYNEDIITHNNSIXXXXXXXXXX 60
           M++LQ+VLVPPS +    ++      L+     S   Q       H   I          
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDN----SGFAQ------GHAQPISTSSIAGGRG 50

Query: 61  XXXXXXXXXXXXXDFINYLPNC-------KKFLHFTDGDNTLLQLSNEILTKFDRLYPNF 113
                         +++ L          +KFLHFT   N+L +L++EI+ K  ++YP  
Sbjct: 51  EFSSGIGNTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGL 110

Query: 114 KESIEIVSLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISXXXXXXXXXX 173
            E  EIV+LQD + CDLD +F++KDVF  D  V V+L+++LD +                
Sbjct: 111 AEEPEIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGD------------- 157

Query: 174 XDNKPSTKSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKS--RVSTPLMNEI 231
                  ++I  +KRK  +       +       +   + K   I  S  RVSTPL N+I
Sbjct: 158 -------RTIYMKKRKLNTGAAGVPAAGGSVQAAVLNVAKKRASIKTSALRVSTPLANQI 210

Query: 232 LPLASK 237
            P  +K
Sbjct: 211 YPPPTK 216

>Scas_711.38
          Length = 998

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 77/151 (50%), Gaps = 6/151 (3%)

Query: 83  KKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQDRHGCDLDSEFIIKDVFEN 142
           KKFL FT   N L  LS EI+ K + +YP+  E +EI +L+D   CDLD +FI+++VF +
Sbjct: 65  KKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEEVFSS 124

Query: 143 DGVVLVILKDELDWSRNQHISXXXXXXXXXXXDNKPSTKSIVTEKRKKISKEDLSSISNK 202
             +V VILK+++D+   + +S             + S          K+S++  + +   
Sbjct: 125 SNLVKVILKNDIDFQSLEQVSNYKSIKR------RKSNTGSYQPLSNKVSQQQANGVYGI 178

Query: 203 DTMHLIAKSSLKNNFINKSRVSTPLMNEILP 233
                +A SS K       R+STPL  +I P
Sbjct: 179 PRKQYLAISSTKTPSNVGRRISTPLAQQIYP 209

>AAL016C [171] [Homologous to ScYCL014W (BUD3) - SH]
           (311460..315896) [4437 bp, 1478 aa]
          Length = 1478

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 16/120 (13%)

Query: 516 PTGETKVQKRNSITEPYYGKF--------GIMKKDKPKSITSKGVSLETKHFDDP---NT 564
           P G  +V K  SIT PY+ K             +D    +++ G SL   +F      +T
Sbjct: 320 PYGSLEVLKACSITAPYFYKAYTRHEAATKFFSRDIKSFLSTFGKSLSDLNFYSEIKLDT 379

Query: 565 IISG--EKFAKFGKIKVKRKTDDVGSKVIEFKRKRNMGNRSLKDIFANAGK--PPNAAST 620
           +I G  EK  K  K+ + R  D    +  E +++ +   RS+ D+  + GK  PPN   T
Sbjct: 380 LIHGPQEKLTKL-KLIIDRLFDSKDWETNEEQKEADRCYRSICDVIDSFGKDEPPNTYDT 438

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,099,166
Number of extensions: 1172107
Number of successful extensions: 5277
Number of sequences better than 10.0: 278
Number of HSP's gapped: 5230
Number of HSP's successfully gapped: 317
Length of query: 757
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 648
Effective length of database: 12,822,747
Effective search space: 8309140056
Effective search space used: 8309140056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)