Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL127W (PGM1)57056027870.0
Scas_721.12356955922720.0
YMR105C (PGM2)56956022500.0
CAGL0K07480g56755822160.0
CAGL0K03421g56855621840.0
Scas_717.7056955921570.0
Sklu_2430.457156021350.0
Kwal_26.762857056020590.0
KLLA0B12694g56856020350.0
ABL029W56856020320.0
KLLA0E21263g429108692.4
Sklu_1994.26241286410.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL127W
         (560 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,...  1078   0.0  
Scas_721.123                                                          879   0.0  
YMR105C (PGM2) [4062] chr13 complement(475896..477605) Phosphogl...   871   0.0  
CAGL0K07480g complement(739633..741336) highly similar to sp|P37...   858   0.0  
CAGL0K03421g complement(313851..315557) highly similar to sp|P37...   845   0.0  
Scas_717.70                                                           835   0.0  
Sklu_2430.4 YMR105C, Contig c2430 6115-7830                           827   0.0  
Kwal_26.7628                                                          797   0.0  
KLLA0B12694g 1107696..1109402 highly similar to sp|P37012 Saccha...   788   0.0  
ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C (P...   787   0.0  
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    31   2.4  
Sklu_1994.2 YMR278W, Contig c1994 3654-5528                            29   10.0 

>YKL127W (PGM1) [3139] chr11 (203187..204899) Phosphoglucomutase,
           minor isoform, interconverts Glc-1-P and Glc-6-P [1713
           bp, 570 aa]
          Length = 570

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/560 (94%), Positives = 528/560 (94%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG
Sbjct: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHY                   Y
Sbjct: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFPKLNLNKLGKNQKY 180

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV
Sbjct: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
           DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY
Sbjct: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHIREKDG             YHRRNPEKEASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIK 420

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480
           TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC
Sbjct: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480

Query: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540
           GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA
Sbjct: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540

Query: 541 DVFLKPVINSIVKFLRFKEI 560
           DVFLKPVINSIVKFLRFKEI
Sbjct: 541 DVFLKPVINSIVKFLRFKEI 560

>Scas_721.123
          Length = 569

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/559 (76%), Positives = 466/559 (83%), Gaps = 1/559 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MSL I+++ T  Y+DQKPGTSGLRKKT +FM+EP+YTENFIQA + +IP GS+  TLVVG
Sbjct: 1   MSLQIETIETKPYQDQKPGTSGLRKKTAIFMNEPNYTENFIQAMLDAIPEGSQDATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGRFYNDVIMNKIAA+ AANGV+KL+IGQ GLLSTPAASHIIR+YEEK TGG IILTAS
Sbjct: 61  GDGRFYNDVIMNKIAAISAANGVKKLIIGQNGLLSTPAASHIIRSYEEKVTGG-IILTAS 119

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGGPENDLGIKYNL NGGPAPESVTNAIWE SKKLTHY                   Y
Sbjct: 120 HNPGGPENDLGIKYNLANGGPAPESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKY 179

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           GPLLVDIID  K YV FLKEIFDF+LIK F+ KQR+ K WKLLFDSLNGITGPYGKAIFV
Sbjct: 180 GPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFV 239

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
           DEF LPA EVLQNWHP PDFGGLHPDPNLTYA+TLV+RVDREKI FGAASDGDGDRNMIY
Sbjct: 240 DEFDLPANEVLQNWHPKPDFGGLHPDPNLTYAKTLVERVDREKIEFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           G GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS+AIDRVA   GL CYEVPT
Sbjct: 300 GAGPAFVSPGDSVAIIAEYASEIPYFVKQGIYGLARSFPTSAAIDRVAKAHGLSCYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNHIREKDG             Y++ NPEK+ASIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIVAWLNVLAIYNKHNPEKDASIK 419

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480
           TIQ+EFWN+YGRTFFTRYDYEHI  E A KVV LL+ FVS+PNV GS FP DESLTV+D 
Sbjct: 420 TIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNVIGSAFPGDESLTVVDA 479

Query: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540
           GDFSY DLDGS+S++QGLF K SNG + VLRLSGTGSSGATIR+YVE YTD K  Y ++A
Sbjct: 480 GDFSYTDLDGSVSDHQGLFFKLSNGARIVLRLSGTGSSGATIRIYVENYTDDKTKYEESA 539

Query: 541 DVFLKPVINSIVKFLRFKE 559
             FL P I ++VKFL+FKE
Sbjct: 540 QDFLAPTIKTVVKFLKFKE 558

>YMR105C (PGM2) [4062] chr13 complement(475896..477605)
           Phosphoglucomutase, major isozyme, interconverts Glc-1-P
           and Glc-6-P [1710 bp, 569 aa]
          Length = 569

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/560 (74%), Positives = 468/560 (83%), Gaps = 1/560 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MS  I++VPT  Y+DQKPGTSGLRKKTKVF DEP+YTENFIQ+ M++IP GS+G TLVVG
Sbjct: 1   MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGR+YNDVI++KIAA+GAANG++KLVIGQ GLLSTPAASHI+RTYEEKCTGG IILTAS
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGG-IILTAS 119

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGGPEND+GIKYNL NGGPAPESVTNAIWE SKKLT Y                   Y
Sbjct: 120 HNPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKY 179

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           GPLLVDIID  K YV FLKEIFDFDLIK F+  QR  K WKLLFDS+NG+TGPYGKAIFV
Sbjct: 180 GPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFV 239

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
           DEFGLPA+EVLQNWHP PDFGG+HPDPNLTYA +LV RVDREKI FGAASDGDGDRNMIY
Sbjct: 240 DEFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           GYGP+FVSPGDSVAIIAEYA EIPYFAKQGIYGLARSFPTS AIDRVA   GL CYEVPT
Sbjct: 300 GYGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG             Y++ +PE EASIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIK 419

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480
           TIQ+EFW +YGRTFFTRYD+E +E E+A K+V  L  +V++  V  S FPADESL V DC
Sbjct: 420 TIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPADESLKVTDC 479

Query: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540
           GDFSY DLDGS+S++QGL+VK SNG +FVLRLSGTGSSGATIRLY+EKY D K  Y +TA
Sbjct: 480 GDFSYTDLDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTA 539

Query: 541 DVFLKPVINSIVKFLRFKEI 560
           + +LKP+INS++KFL FK++
Sbjct: 540 EEYLKPIINSVIKFLNFKQV 559

>CAGL0K07480g complement(739633..741336) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, hypothetical start
          Length = 567

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/558 (74%), Positives = 461/558 (82%), Gaps = 1/558 (0%)

Query: 3   LLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVGGD 62
           + +++VPT  Y+DQKPGTSGLRKKTKVFM+EP+YTENFIQA M +IP G++   LVVGGD
Sbjct: 1   MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDAIPEGAKDAVLVVGGD 60

Query: 63  GRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTASHN 122
           GRFYNDVIM KIAA+GAANGVRKL+IGQ GLLSTPAASH+IR+Y EKCTGG IILTASHN
Sbjct: 61  GRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSYAEKCTGG-IILTASHN 119

Query: 123 PGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXYGP 182
           PGGPENDLGIKYNL NGGPAPE VTN +WE SK+LTHY                   YGP
Sbjct: 120 PGGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGP 179

Query: 183 LLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDE 242
           LLVDIID  + YV+F+KEIFDF LIK F+ KQR+ K WKLLFDSLNGITGPYGKAIFVDE
Sbjct: 180 LLVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDE 239

Query: 243 FGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIYGY 302
           F LPA+EVLQNWHP PDFGGLHPDPNLTYA TLV+RVDREKI FGAASDGDGDRNMIYG 
Sbjct: 240 FDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKIEFGAASDGDGDRNMIYGA 299

Query: 303 GPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPTGW 362
           GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS AIDRVA  +GL CYEVPTGW
Sbjct: 300 GPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGAIDRVAKAQGLNCYEVPTGW 359

Query: 363 KFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIKTI 422
           KFFCALFDAKKLSICGEESFGTGSNHIREKDG             Y++ NPEKEASIKTI
Sbjct: 360 KFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWLNILALYNKHNPEKEASIKTI 419

Query: 423 QDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDCGD 482
           Q+EFW +YGRTFFTRYDYE I  E+A KVV LL +FV+ P    + FP DESLTV DCGD
Sbjct: 420 QEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVNDPKSKNAPFPGDESLTVSDCGD 479

Query: 483 FSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTADV 542
           FSY DLDGS+S++QGLFVK SNG +FVLRLSGTGS+GATIRLY+E+Y+D K  Y Q+AD 
Sbjct: 480 FSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGATIRLYIEEYSDDKSTYTQSADQ 539

Query: 543 FLKPVINSIVKFLRFKEI 560
           +L+ +I S+  FL FKE+
Sbjct: 540 YLQKMIKSVTSFLNFKEL 557

>CAGL0K03421g complement(313851..315557) highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c Phosphoglucomutase 2,
           start by similarity
          Length = 568

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/556 (72%), Positives = 459/556 (82%), Gaps = 1/556 (0%)

Query: 5   IDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVGGDGR 64
           I+SVPT  Y+DQKPGTSGLRKKTKVF D+P+Y ENFIQ+ M++IP G++G  LVVGGDGR
Sbjct: 4   IESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVMEAIPEGAKGAVLVVGGDGR 63

Query: 65  FYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTASHNPG 124
           +YNDVI+ KIAA+GAANGV+KLVIGQ GLLSTPAASHI+RTY+EKCTGG IILTASHNPG
Sbjct: 64  YYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRTYKEKCTGG-IILTASHNPG 122

Query: 125 GPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXYGPLL 184
           GPEND+GIKYNL NGGPAPE VTN IWE SKKLTHY                   YGPLL
Sbjct: 123 GPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLL 182

Query: 185 VDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDEFG 244
           VD+ID   AY+Q LKEIFDF+LI  F+AKQRK+KGWKLL DS+NG+TGPY KAIFVDEFG
Sbjct: 183 VDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFG 242

Query: 245 LPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIYGYGP 304
           L ++EVLQNWHP PDFGGLHPDPNLTYA TLV+RV++EKI FGAASDGDGDRNMIYGYGP
Sbjct: 243 LDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEKIEFGAASDGDGDRNMIYGYGP 302

Query: 305 AFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPTGWKF 364
           AFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPT+SAIDRVA K GL CYEVPTGWKF
Sbjct: 303 AFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTASAIDRVAKKHGLNCYEVPTGWKF 362

Query: 365 FCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIKTIQD 424
           FCALFDAKKLSICGEESFGTGSNH+REKDG             +++R+P+KEASIKTIQ+
Sbjct: 363 FCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAWLNILAIFNQRHPDKEASIKTIQN 422

Query: 425 EFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDCGDFS 484
           EFW+ YGRTFFTRYDYE +E ++A KV+  L ++V+     GS FP D +LTV+D GDFS
Sbjct: 423 EFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVADSGTKGSKFPTDSALTVVDAGDFS 482

Query: 485 YRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTADVFL 544
           Y DLDG+IS +QGL+V  SNG +FV+RLSGTGSSGATIRLY+E+YTD K  Y   A  +L
Sbjct: 483 YTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYL 542

Query: 545 KPVINSIVKFLRFKEI 560
           KP+I SIV+FL  K I
Sbjct: 543 KPIIKSIVQFLDLKTI 558

>Scas_717.70
          Length = 569

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/559 (72%), Positives = 451/559 (80%), Gaps = 1/559 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MS  I +VPT  Y+DQKPGTSGLRKKTK+F D P+YTENFIQA M +IP GS+G TLVVG
Sbjct: 1   MSFQIQTVPTKPYQDQKPGTSGLRKKTKIFKDTPNYTENFIQAIMDAIPEGSKGATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGR+YNDVI++KIAA+GAANGV+KLVIGQ GLLSTPAASHI+RTYEEK T GGIILTAS
Sbjct: 61  GDGRYYNDVILHKIAAIGAANGVKKLVIGQRGLLSTPAASHIMRTYEEK-TQGGIILTAS 119

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGG +ND+GIK+NL NGGPAPE VTN IWE SKK+T +                   Y
Sbjct: 120 HNPGGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKY 179

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           GPLLVD+ID  KAYV+F+K+IFDFDLIK F+ KQR  K WKLLFD +NG+TGPYGKAIFV
Sbjct: 180 GPLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFV 239

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
           DE GLPA+EVLQ WHP PDFGG+HPDPNLTYA+ LVDRVDRE I FGAASDGDGDRNMIY
Sbjct: 240 DELGLPADEVLQQWHPSPDFGGVHPDPNLTYAKALVDRVDRENIEFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           G GPAFVSPGDSVAIIAEYA EIPYFAKQGIYGLARSFPTSSAIDRVA   GL CYEVPT
Sbjct: 300 GAGPAFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG             Y++ +P+++ SIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAILAWLNLLAIYNKHHPDRDVSIK 419

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480
            IQDEFWN+YGRTFFTRYDYE +  E A KV+  L + V         FP DESLTV++ 
Sbjct: 420 IIQDEFWNKYGRTFFTRYDYEKVATEDAAKVIDNLRKHVESKTFVNHKFPTDESLTVVEA 479

Query: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540
           GDFSY DLDGS+S +QGLF K SNG + V+RLSGTGSSGATIRLYVEKYTD K  YGQ A
Sbjct: 480 GDFSYTDLDGSVSAHQGLFFKLSNGARVVVRLSGTGSSGATIRLYVEKYTDDKSVYGQNA 539

Query: 541 DVFLKPVINSIVKFLRFKE 559
            V+LKPVI S+VKFL FKE
Sbjct: 540 QVYLKPVIQSVVKFLNFKE 558

>Sklu_2430.4 YMR105C, Contig c2430 6115-7830
          Length = 571

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/560 (71%), Positives = 451/560 (80%), Gaps = 1/560 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MS  I+++PT  Y DQKPGTSGLRKKTKVFM+EP+YTENFIQA M +IP GS+  TLVVG
Sbjct: 1   MSFKIETIPTTPYTDQKPGTSGLRKKTKVFMEEPNYTENFIQAVMDAIPEGSQDATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGRFYNDV++ KIAA+GAANGV KLVIGQ G+LSTPAASHIIRTY      GGIILTAS
Sbjct: 61  GDGRFYNDVVVQKIAAIGAANGVHKLVIGQNGILSTPAASHIIRTYPHAKITGGIILTAS 120

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGG +ND GIKYNL NGGPAPESVTN I+E SK+LT Y                   Y
Sbjct: 121 HNPGGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRY 180

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           GPLLVDIID  +AYV+ +K IFDFDLIK F+  Q++  G+KLLFDSLNG+TGPYGKA+FV
Sbjct: 181 GPLLVDIIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFV 240

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
           DE GL AEE LQN+ P PDFGGLHPDPNLTYA TLV+RVD++KIAFGAASDGDGDRNMIY
Sbjct: 241 DELGLSAEESLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKDKIAFGAASDGDGDRNMIY 300

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           GYGPAFVSPGDSVAIIAEYA EIPYFAKQGIYGLARSFPTS+AIDRVA   GL CYEVPT
Sbjct: 301 GYGPAFVSPGDSVAIIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPT 360

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG             Y+R+NP KEASIK
Sbjct: 361 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNRKNPTKEASIK 420

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPN-VCGSHFPADESLTVID 479
           TIQ+EFWN+YGRTFFTRYD+E I  E A+KV+ LL  FVS+ + V    FPA   LTV+D
Sbjct: 421 TIQEEFWNKYGRTFFTRYDFEQIASENADKVIQLLHNFVSKKDSVVNKAFPAATDLTVVD 480

Query: 480 CGDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQT 539
            GDFSY DLDGS+S NQGLFVK SNG KFV+RLSGTGSSGATIRLYVE+Y+D K +Y  T
Sbjct: 481 AGDFSYTDLDGSVSSNQGLFVKLSNGCKFVVRLSGTGSSGATIRLYVERYSDNKSDYSLT 540

Query: 540 ADVFLKPVINSIVKFLRFKE 559
           AD FL   I  +++FL+FKE
Sbjct: 541 ADQFLGNDIKHVLQFLKFKE 560

>Kwal_26.7628
          Length = 570

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/560 (69%), Positives = 446/560 (79%), Gaps = 2/560 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MSL I+SVPT  + DQKPGTSGLRKKTKVF DEPHYTENFIQA +++IP GSE  TLVVG
Sbjct: 1   MSLTIESVPTKPFDDQKPGTSGLRKKTKVFKDEPHYTENFIQAILEAIPEGSENATLVVG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGR+YN+ +M  I A+ AANGVRK+++GQ G+LSTPAASHIIR+Y EKCTGG IILTAS
Sbjct: 61  GDGRYYNNEVMQIIGAIAAANGVRKMILGQNGILSTPAASHIIRSYPEKCTGG-IILTAS 119

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGGPEND GIKYNL NGGPAPESVTNAI+E SK+LTHY                   Y
Sbjct: 120 HNPGGPENDFGIKYNLSNGGPAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGKDQKY 179

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           GPLLVD++D    YV  +KEIFDFDLIK F+  QR  KG+K+LFDSLNG+TGPYG+AIFV
Sbjct: 180 GPLLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFV 239

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
            E GLPAEEVLQN+ P PDFGGLHPDPNLTYA TLV+RVD+E+IAFGAASDGDGDRNMIY
Sbjct: 240 KELGLPAEEVLQNYVPKPDFGGLHPDPNLTYAHTLVERVDKEQIAFGAASDGDGDRNMIY 299

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           G GPAFVSPGDSVAIIAEYA EIPYF KQGIYGLARSFPTS+AIDRVA ++GL CYEVPT
Sbjct: 300 GCGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPT 359

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG             Y+R +P+ + SIK
Sbjct: 360 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIVAWLNILAIYNRDHPDSDVSIK 419

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFV-SRPNVCGSHFPADESLTVID 479
            IQ++FW +YGRTFFTRYD+E +  E A +V+ +L + V ++ +  G  F  + +LTV D
Sbjct: 420 VIQEKFWAKYGRTFFTRYDFEQVSSESAAQVLQVLEDLVAAKDSSVGKPFAGNPALTVAD 479

Query: 480 CGDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQT 539
           CGDFSY DLDGS+SE+QGL+ K SNG +FV+RLSGTGSSGATIRLYVEKYTD    Y   
Sbjct: 480 CGDFSYTDLDGSVSEHQGLYAKLSNGCRFVVRLSGTGSSGATIRLYVEKYTDDASKYSLD 539

Query: 540 ADVFLKPVINSIVKFLRFKE 559
            + FL   I SI+KFL+F E
Sbjct: 540 VEQFLGDDIKSILKFLKFCE 559

>KLLA0B12694g 1107696..1109402 highly similar to sp|P37012
           Saccharomyces cerevisiae YMR105c PGM2
           phosphoglucomutase, major isoform, start by similarity
          Length = 568

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/560 (68%), Positives = 449/560 (80%), Gaps = 4/560 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MSL   SV T  Y DQKPGTSGLRKKTKVF + P+YTENFIQA M++IP GS+G TLV+G
Sbjct: 1   MSLKTVSVATNPYPDQKPGTSGLRKKTKVFEETPNYTENFIQAIMEAIPEGSQGATLVIG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGR+YNDV++ KIAA+G+ANGVRK+VIG  G+LSTPAASHIIR Y EKCTGG IILTAS
Sbjct: 61  GDGRYYNDVVIQKIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGG-IILTAS 119

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGGP ND GIKYNL NGGPAPESVTN+IW  S++LTHY                   Y
Sbjct: 120 HNPGGPTNDFGIKYNLANGGPAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKY 179

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           G LLVDI+D   AYV+ +KEIFDF LIKSF+  Q K+ G+K+LFD++NG+TGPYG+A+FV
Sbjct: 180 GDLLVDIVDSTAAYVELMKEIFDFPLIKSFIDTQAKN-GFKILFDAMNGVTGPYGEALFV 238

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
            E GLP E  LQN+HP PDFGGLHPDPNLTYA TLV+RVD+  I FGAASDGDGDRNMIY
Sbjct: 239 KELGLP-ESSLQNYHPKPDFGGLHPDPNLTYAHTLVERVDKYGIQFGAASDGDGDRNMIY 297

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           G GPAFVSPGDSVAIIAEYA  IPYF KQGIYGLARSFPTSSAIDRVA ++GL CYEVPT
Sbjct: 298 GAGPAFVSPGDSVAIIAEYASAIPYFKKQGIYGLARSFPTSSAIDRVAKEQGLNCYEVPT 357

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFCALFDAKKLSICGEESFGTGSNH+REKDG             Y++R P KEASIK
Sbjct: 358 GWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNQRFPNKEASIK 417

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRP-NVCGSHFPADESLTVID 479
           +IQ +FW +YGRTFFTRYD+E++  E A KV+ LL  +V+ P ++ G+ FPAD+SLTV++
Sbjct: 418 SIQTDFWQKYGRTFFTRYDFENLSSEDAGKVILLLQNYVADPESIKGTKFPADDSLTVVE 477

Query: 480 CGDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQT 539
            GDFSY DLDGS+S +QGL+V+ SNG +FV+RLSGTGSSGATIRLYVE+YT+    Y QT
Sbjct: 478 GGDFSYTDLDGSVSSHQGLYVRLSNGVRFVVRLSGTGSSGATIRLYVERYTNDGSKYEQT 537

Query: 540 ADVFLKPVINSIVKFLRFKE 559
           A+ FL   I +I+KFL+FKE
Sbjct: 538 AEEFLGKDIKTILKFLKFKE 557

>ABL029W [563] [Homologous to ScYKL127W (PGM1) - SH; ScYMR105C
           (PGM2) - SH] complement(343852..345558) [1707 bp, 568
           aa]
          Length = 568

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/560 (68%), Positives = 441/560 (78%), Gaps = 2/560 (0%)

Query: 1   MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVG 60
           MS+ I+SVPT A+ DQKPGTSGLRKKTKVF    HYTENFIQA M+SIP GSE   LV+G
Sbjct: 1   MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIMESIPEGSENAVLVIG 60

Query: 61  GDGRFYNDVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTAS 120
           GDGR+YND +M KIA VG+ANGVRKL+IGQ GLLSTPAASHIIRTY +K TGG IILTAS
Sbjct: 61  GDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIRTYHDKVTGG-IILTAS 119

Query: 121 HNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYXXXXXXXXXXXXXXXXXXXY 180
           HNPGGP+ND GIKYNL NG PAPE VTN+++E S+ LTHY                   Y
Sbjct: 120 HNPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQY 179

Query: 181 GPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFV 240
           G LLVD+IDP +AYV+ +KEIFDF LIK FL   +K+ G K+LFD+LNGITGPYGKAIFV
Sbjct: 180 GNLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFV 239

Query: 241 DEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIY 300
           DE GL +E+ LQN+ P PDFGGLHPDPNLTYA TLV RVDRE IAFGAASDGDGDRNMIY
Sbjct: 240 DELGL-SEDSLQNFVPKPDFGGLHPDPNLTYAHTLVSRVDRENIAFGAASDGDGDRNMIY 298

Query: 301 GYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPT 360
           G GPAFVSPGDSVAIIAEYA EIPYF K GI+GLARSFPTS AID VA +K L CYEVPT
Sbjct: 299 GAGPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKNLDCYEVPT 358

Query: 361 GWKFFCALFDAKKLSICGEESFGTGSNHIREKDGXXXXXXXXXXXXXYHRRNPEKEASIK 420
           GWKFFC LFD+KKLSICGEESFGTGS+H+REKDG             YHRR+P++E SIK
Sbjct: 359 GWKFFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAWLNVLAIYHRRHPDREPSIK 418

Query: 421 TIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDC 480
           TIQ+EFW +YGRTFFTRYD+E  + E A KV+ LL  F   P V G  FPA   ++V   
Sbjct: 419 TIQEEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAENPAVVGQPFPAWHEVSVSAA 478

Query: 481 GDFSYRDLDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTA 540
           GDFSY DLDGS+SE+QGL++K SNGT++V+RLSGTGSSGATIRLYVE+YT+    Y QTA
Sbjct: 479 GDFSYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSGATIRLYVERYTNDPAYYAQTA 538

Query: 541 DVFLKPVINSIVKFLRFKEI 560
           D FL P I +++KFLRFK++
Sbjct: 539 DQFLAPDIKAVLKFLRFKDL 558

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 4/108 (3%)

Query: 408 YHRRNPEK--EASIKTIQDEFWNEYGRTFFTRYDYEHIECEQAEK-VVALLSEFVSRPNV 464
           YH R   +  E    TI+D  + + G +F +    + ++    EK ++     F S PN 
Sbjct: 166 YHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPN- 224

Query: 465 CGSHFPADESLTVIDCGDFSYRDLDGSISENQGLFVKFSNGTKFVLRL 512
           C +  P D++  V+   +   R  D  +SEN G   K+ +    +L L
Sbjct: 225 CITFHPKDKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILAL 272

>Sklu_1994.2 YMR278W, Contig c1994 3654-5528
          Length = 624

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 11/128 (8%)

Query: 19  GTSGLRKKTKVFMDEPHYTENFIQAT--MQSIPNGS--EGTTLVVGGDGRFYNDVIMNKI 74
           GT+GLR + +      + T   +QA+  + S       E  +++VG D R++++      
Sbjct: 55  GTAGLRSRMEAGFSRMN-TLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVT 113

Query: 75  AAVGAANGVRKLVIGQGGLLSTPAASH---IIRTYEEKCTGGGIILTASHNPGGPENDLG 131
                  G +   +      ST    H   +  T  +     GI++TASHN   P+ D G
Sbjct: 114 VTAFLQLGFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHN---PKMDNG 170

Query: 132 IKYNLPNG 139
            K    NG
Sbjct: 171 YKVYYSNG 178

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,669,447
Number of extensions: 822946
Number of successful extensions: 1625
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1628
Number of HSP's successfully gapped: 13
Length of query: 560
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 453
Effective length of database: 12,891,983
Effective search space: 5840068299
Effective search space used: 5840068299
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)