Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL124W (SSH4)57956928810.0
Scas_721.12657348817270.0
Kwal_26.766555147616000.0
Sklu_2430.753948415290.0
CAGL0M06545g58746715200.0
KLLA0B12760g54245213860.0
ABL026W48041512821e-173
Kwal_23.34885023543301e-32
ADL279W4933743071e-29
CAGL0F07799g5802322992e-28
Sklu_2101.35682482941e-27
KLLA0D10065g4662312882e-27
YMR171C5502712876e-27
Scas_669.105851722495e-22
Scas_590.1469351740.69
KLLA0E04851g11255634.0
YHR016C (YSC84)46848649.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL124W
         (569 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confer...  1114   0.0  
Scas_721.126                                                          669   0.0  
Kwal_26.7665                                                          620   0.0  
Sklu_2430.7 YKL124W, Contig c2430 12905-14524                         593   0.0  
CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces c...   590   0.0  
KLLA0B12760g 1114942..1116570 some similarities with sp|P32343 S...   538   0.0  
ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH] complement(3...   498   e-173
Kwal_23.3488                                                          131   1e-32
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....   122   1e-29
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...   119   2e-28
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                           117   1e-27
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...   115   2e-27
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...   115   6e-27
Scas_669.10                                                           100   5e-22
Scas_590.14                                                            33   0.69 
KLLA0E04851g join(437719..437721,437833..438168) similar to sp|P...    29   4.0  
YHR016C (YSC84) [2302] chr8 complement(136873..138232,138401..13...    29   9.5  

>YKL124W (SSH4) [3142] chr11 (210239..211978) Protein that confers
           resistance to immunosuppressive drug leflunomide upon
           overproduction [1740 bp, 579 aa]
          Length = 579

 Score = 1114 bits (2881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/569 (96%), Positives = 548/569 (96%)

Query: 1   MYVTFNEALDSSFGNLESPNHDFKVGDPNMVPTPPMDSDSAAISLAFLISLSITFAILML 60
           MYVTFNEALDSSFGNLESPNHDFKVGDPNMVPTPPMDSDSAAISLAFLISLSITFAILML
Sbjct: 1   MYVTFNEALDSSFGNLESPNHDFKVGDPNMVPTPPMDSDSAAISLAFLISLSITFAILML 60

Query: 61  ILVVIAAYVTFCGDDESEYDEENALGTRTSGTLHSLFGKKHSGILLDSSFASPGGFDDEI 120
           ILVVIAAYVTFCGDDESEYDEENALGTRTSGTLHSLFGKKHSGILLDSSFASPGGFDDEI
Sbjct: 61  ILVVIAAYVTFCGDDESEYDEENALGTRTSGTLHSLFGKKHSGILLDSSFASPGGFDDEI 120

Query: 121 VLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFL 180
           VLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFL
Sbjct: 121 VLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFL 180

Query: 181 LPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRH 240
           LPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRH
Sbjct: 181 LPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRH 240

Query: 241 IQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVG 300
           IQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVG
Sbjct: 241 IQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVG 300

Query: 301 FGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFR 360
           FGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFR
Sbjct: 301 FGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFR 360

Query: 361 EALSEGKDIEVAKDLQRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVY 420
           EALSEGKDIEVAKDLQRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVY
Sbjct: 361 EALSEGKDIEVAKDLQRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVY 420

Query: 421 GQIGIPPAYNGTEIKKDTILQKGEELPPRYADTDNFFGSMKVKEGSSSRITAQTSKPLWS 480
           GQIGIPPAYNGTEIKKDTILQKGEELPPRYADTDNFFGSMKVKEGSSSRITAQTSKPLWS
Sbjct: 421 GQIGIPPAYNGTEIKKDTILQKGEELPPRYADTDNFFGSMKVKEGSSSRITAQTSKPLWS 480

Query: 481 VGTYERISSNFDRENNVYHDSLETXXXXXXXXXXXXXXXXXXXXXSPLLEDDGNKRPENS 540
           VGTYERISSNFDRENNVYHDSLET                     SPLLEDDGNKRPENS
Sbjct: 481 VGTYERISSNFDRENNVYHDSLETDDNNTDNNVNNNDENAGCNENSPLLEDDGNKRPENS 540

Query: 541 NTPREVSDGAINKNPRNKSTKKRQRNRGK 569
           NTPREVSDGAINKNPRNKSTKKRQRNRGK
Sbjct: 541 NTPREVSDGAINKNPRNKSTKKRQRNRGK 569

>Scas_721.126
          Length = 573

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/488 (66%), Positives = 392/488 (80%), Gaps = 21/488 (4%)

Query: 36  MDSDSAAISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDEENALGTRTSGTLHS 95
           +DSD   +SLAFLISLS+TFAILML+L+V+AAY+TFCG DE+EYDEE+    R     + 
Sbjct: 35  VDSDPETVSLAFLISLSVTFAILMLLLMVMAAYITFCGADEAEYDEESGQRPRGPPRFNI 94

Query: 96  LFGKKHSGILLDSSFASPGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMV 155
           LF K+H GILLDSSF SPG FDDE   QERE  EL +MS +E+ELY R+ EFQ ++PP +
Sbjct: 95  LFSKRHDGILLDSSFTSPGQFDDECEHQEREHTELNRMSPFELELYKRSNEFQEVAPPHI 154

Query: 156 KDFGTYLDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSS 215
            +FGTYL + D Q IKDRGIQSYFLLPSINDN+++ GNFLPSF++QDKLD+ F+K+NKSS
Sbjct: 155 DEFGTYLKATDLQVIKDRGIQSYFLLPSINDNVNKQGNFLPSFLIQDKLDMVFTKYNKSS 214

Query: 216 STVMNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYEST 275
           STVMNYPLP+ ++DAVYFEVK+F+H   SN+IFSIGL TVPYPYFR+PGMAK+SIAYEST
Sbjct: 215 STVMNYPLPYTKRDAVYFEVKVFKHQPVSNTIFSIGLVTVPYPYFRIPGMAKFSIAYEST 274

Query: 276 GKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIG 335
           GKLRINNPF ASTLLPKL EGD VGFGYRY +GTIFITHNGKKLMDVTQN+G+DLF+G+G
Sbjct: 275 GKLRINNPFMASTLLPKLVEGDVVGFGYRYSSGTIFITHNGKKLMDVTQNVGVDLFVGLG 334

Query: 336 AFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDLQRVHDPHDESDEMTSDEVEL 395
           AFNA+YTR+YT+DGLLEDPDN+  REALSEG++I +  +LQRV DPH+E+D++ S+EVEL
Sbjct: 335 AFNASYTRSYTKDGLLEDPDNIELREALSEGREIVLPDELQRVRDPHNENDQIDSEEVEL 394

Query: 396 HVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQKGEELPPRYA---D 452
           HVNLGQVGFVFIEANVKKYAFG+VYG IGIPP+YNG EIK D +LQKG+ELPP Y    D
Sbjct: 395 HVNLGQVGFVFIEANVKKYAFGTVYGNIGIPPSYNGEEIKNDKLLQKGDELPPNYGTLLD 454

Query: 453 TDNFFGSMKVKEG-----SSSRITAQTSKPLWSVG-------------TYERISSNFDRE 494
           ++ FFG + + EG      ++ I   +S      G             TYERISS FDRE
Sbjct: 455 SNGFFGDIHINEGHRNNEENANIIIGSSDTTLRQGAHNVLMRKTPETETYERISSRFDRE 514

Query: 495 NNVYHDSL 502
           NN+Y D++
Sbjct: 515 NNLYDDNI 522

>Kwal_26.7665
          Length = 551

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/476 (64%), Positives = 370/476 (77%), Gaps = 30/476 (6%)

Query: 34  PPM--DSDSAAISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDEENALGTRTSG 91
           PP+    D  AISL FLISLS+TFAILM++L+VIA YVTFCG DESEYDEE A       
Sbjct: 63  PPIGESQDGEAISLVFLISLSVTFAILMVMLIVIAVYVTFCGADESEYDEEVA------S 116

Query: 92  TLHSLFGKKHSGILLDSSFASPGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMS 151
            + ++F KK SG+LLD SF +PG FDDE  L E+E  ELP+MS +EVELY R +EFQ M 
Sbjct: 117 AIPNMFRKKRSGVLLDGSFLTPGQFDDEHALLEQEAVELPRMSRFEVELYQRCREFQKMC 176

Query: 152 PPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQDKLDIQFSKF 211
           PP V +FGTY  + D+QFIKDRG+QSY+ LPSINDN+D YGNFLPSFIVQDKLD+ F+KF
Sbjct: 177 PPNVTEFGTYTSASDKQFIKDRGVQSYYFLPSINDNVDHYGNFLPSFIVQDKLDVLFTKF 236

Query: 212 NKSSSTVMNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIA 271
           N+S+ST+MNYPLP N+K+AVYFEVK+F+   KSNSIFS GL T PYPYFR+PGMA++SIA
Sbjct: 237 NRSASTIMNYPLPQNKKEAVYFEVKVFKFPAKSNSIFSCGLVTCPYPYFRIPGMAQFSIA 296

Query: 272 YESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLF 331
           YESTGKLR+NNPF A+TLLPKL+EGD +GFGYRYKTGTI ITHNGKKLMD+T N+GIDLF
Sbjct: 297 YESTGKLRMNNPFYANTLLPKLQEGDVIGFGYRYKTGTILITHNGKKLMDLTHNVGIDLF 356

Query: 332 IGIGAFNAAYTRTYTRDGLLEDPDNVSFRE-ALSEGKDIEVAK----DLQRVHDPHDESD 386
           +GIGA NAAYTRTYTR+GLLED DNVS RE  L+   D +  +     L+ +HDPH+  D
Sbjct: 357 VGIGAMNAAYTRTYTREGLLEDCDNVSLRERILASDADQKAPRAINDQLETIHDPHN--D 414

Query: 387 EMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQKGEEL 446
           ++TSDE+ELHVNLGQ+GFV++EANVKKYAFGSVYG IG+PPAYNG EIKKD +LQKGEEL
Sbjct: 415 DITSDEIELHVNLGQLGFVYVEANVKKYAFGSVYGDIGVPPAYNGDEIKKDVVLQKGEEL 474

Query: 447 PPRYADTD------NFFGSMKVKEGSSSRITAQTSKPLWSVGTYERISSNFDRENN 496
           PP Y   +         G++ V+EG  S      SK   ++  YE  SS FDRE +
Sbjct: 475 PPMYPTEELAPLAPPAAGTITVREGGPS------SK---NIEEYEHESSAFDREED 521

>Sklu_2430.7 YKL124W, Contig c2430 12905-14524
          Length = 539

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/484 (62%), Positives = 369/484 (76%), Gaps = 22/484 (4%)

Query: 26  GDPNMVPTPPMDSDSAAISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDEENAL 85
           GDP   P    + DS  +SLAFLISLS+TF +LM++L+++A YVTFC  DES+YDEE  +
Sbjct: 21  GDPVFSPPEGNNGDSETLSLAFLISLSVTFGVLMVLLIIMAVYVTFCNADESDYDEE--M 78

Query: 86  GTRTSGTLHSLFGKKH--SGILLDSSFASPGGFDDEIVLQERELEELP-KMSAYEVELYI 142
           G  T GT  S F ++H  S + LD SF +PG FDDE  +QE+E E    K S +E+ELY 
Sbjct: 79  GA-THGTGASSFFRRHKNSSLFLDGSFITPGKFDDEQAVQEQEDECFKDKFSKFEIELYQ 137

Query: 143 RAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQD 202
           RAKEFQ ++PP+VK FGTY    D+Q IKDRGIQSY+ LPSINDN+D+ GNFLPSF++QD
Sbjct: 138 RAKEFQKVNPPIVKSFGTYTPLKDKQLIKDRGIQSYYFLPSINDNLDKAGNFLPSFLIQD 197

Query: 203 KLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTVPYPYFRV 262
           KLDI+F+K+NKSSS +MN+PLP+NRKDAVYFEVK+F++  KSNSIF+IGL T PYPYFR+
Sbjct: 198 KLDIEFTKYNKSSSAIMNFPLPYNRKDAVYFEVKVFKYPSKSNSIFTIGLITPPYPYFRM 257

Query: 263 PGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDV 322
           PG  K+SIAYESTGKLRI+NPF A+TLLPKLEEGD VGFGYR+++GTIFITHNGKKL+D+
Sbjct: 258 PGYNKHSIAYESTGKLRISNPFYANTLLPKLEEGDVVGFGYRFRSGTIFITHNGKKLLDL 317

Query: 323 TQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGK-------DIEVAKDL 375
           T+NIG+DLFIG+GA NA YT++YT +GLL DPDN    E L   +          +   L
Sbjct: 318 TENIGVDLFIGLGAMNACYTKSYTLEGLLADPDNPGLHEQLVAAQLTPESDTTAAINPQL 377

Query: 376 QRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIK 435
           +RVHD   E  ++ SDE+EL VNLGQ+GFVFIEANVKKY FGSVYG+IGIPP+YNG EIK
Sbjct: 378 ERVHDYTTE--DIPSDEIELQVNLGQLGFVFIEANVKKYVFGSVYGEIGIPPSYNGDEIK 435

Query: 436 KDTILQKGEELPPRYADTD-NFFGSMKVKEGSSSRITAQTSKPLWSVGTYERISSNFDRE 494
           +DT+LQKGEELPP Y   D  FFG++KV+EG S    A        V  YER SS FDRE
Sbjct: 436 QDTVLQKGEELPPEYPAEDVGFFGNIKVREGPSKEQHA------MDVEHYERASSAFDRE 489

Query: 495 NNVY 498
           NNVY
Sbjct: 490 NNVY 493

>CAGL0M06545g 677238..679001 similar to sp|P32343 Saccharomyces
           cerevisiae YKL124w SSH4, hypothetical start
          Length = 587

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/467 (62%), Positives = 370/467 (79%), Gaps = 14/467 (2%)

Query: 23  FKVGDPNMVPTP-PMDSDSAAISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDE 81
           F V DP   P P P D+D   ++ AF I +++ F++L++ LV  AAY+      E EYDE
Sbjct: 14  FHVDDP-FNPMPDPGDADPETVAFAFFIGIAVVFSLLLITLVCTAAYLVCTSSYEGEYDE 72

Query: 82  E---NALGTRTSGTLH--SLFGKKHS-GILLDSSFASPGGFDDEIVLQERELEELPKMSA 135
           E   N  G+R  G L+   LFGKK+S G+LLDS+F +PG FDD     ERE E L KMS 
Sbjct: 73  ELANNGDGSR-RGILNFRPLFGKKNSNGLLLDSNFTNPGEFDDNEEFIEREREALIKMSP 131

Query: 136 YEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFL 195
           +EV+ Y+RAKEFQ++SPP V++FGTYLDS D Q IKDRGIQSY+ +PSINDN+D+ G+FL
Sbjct: 132 FEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDLQMIKDRGIQSYYFIPSINDNVDKSGHFL 191

Query: 196 PSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTV 255
           PSF+VQDKL+++F+++NKSSS V+NYPLP+N+KDAVYFEVK++ H   SNSIFSIGL TV
Sbjct: 192 PSFLVQDKLEVEFTRWNKSSSAVLNYPLPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTV 251

Query: 256 PYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHN 315
           PYPYFR+PGM K+SIAYESTGKLRIN+PF  STLLPKL EGD VGFGYR+KTGTIFITHN
Sbjct: 252 PYPYFRIPGMCKFSIAYESTGKLRINDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHN 311

Query: 316 GKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDL 375
           GKKLMDVTQN+ ++LFI +GA NA+YTRTYT+DGLLEDPDN+  R AL+EG++++++KD+
Sbjct: 312 GKKLMDVTQNVSVELFIALGAMNASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDI 371

Query: 376 QRVHDPHDES--DEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTE 433
           Q  H+P DE+  D + SDE+ELHVNLGQ GFVFIEANVKKY FGSV+G+IGIPPAYN  +
Sbjct: 372 QNPHNPMDETKWDIIDSDEIELHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPND 431

Query: 434 IKKDTILQKGEELPPRYA-DTDNF--FGSMKVKEGSSSRITAQTSKP 477
           I+KD ++QKGEELPP+Y  DT+NF  FG++K+K    + +   +S P
Sbjct: 432 IQKDKLIQKGEELPPQYPEDTENFGLFGNLKIKSHIKNPLKEVSSNP 478

>KLLA0B12760g 1114942..1116570 some similarities with sp|P32343
           Saccharomyces cerevisiae YKL124w SSH4 suppressor of
           SHR3, hypothetical start
          Length = 542

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/452 (61%), Positives = 340/452 (75%), Gaps = 20/452 (4%)

Query: 42  AISLAFLISLSITFAILMLILVVIAAYVTFCGDDESEYDEENALGTRTSGTLHSLFGKKH 101
           A SL FLISLSITF +L+L+L++I+ Y+TFC        +++        ++   F +K 
Sbjct: 37  AFSLMFLISLSITFGLLLLVLILISIYLTFC---GGNDGDDSDDEDEDGTSVSFKFFRKR 93

Query: 102 SGILLDSSFASPGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTY 161
           + +LLDSSF +PG FDD+  L+ RE +ELPKMS++EVELY R KEFQ MSPPMVK  G++
Sbjct: 94  NSLLLDSSFMTPGKFDDDESLKVREAKELPKMSSFEVELYERTKEFQKMSPPMVKPLGSF 153

Query: 162 LDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNY 221
           L+S D+Q IKDRGIQSYF LPSINDN+D  G FLPSF V+DKL++ F+KFN SSS +MNY
Sbjct: 154 LNSQDKQVIKDRGIQSYFFLPSINDNVDINGAFLPSFFVEDKLNVSFTKFNISSSAIMNY 213

Query: 222 PLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRIN 281
           PLP N+KDAVYFEVK+++    SNSIFSIGL T PYPYFR+PG A YSIAYESTGKLRIN
Sbjct: 214 PLPMNKKDAVYFEVKVYKFKTCSNSIFSIGLMTCPYPYFRIPGTAAYSIAYESTGKLRIN 273

Query: 282 NPFTASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAY 341
           N F A TLLPKLEEGD VGFGYRY +GTIFITHNGKK+MDVT  +GIDLF+G+GA NAAY
Sbjct: 274 NAFGADTLLPKLEEGDVVGFGYRYSSGTIFITHNGKKMMDVTHKVGIDLFVGLGAMNAAY 333

Query: 342 TRTYTRDGLLEDPDNVSFREALSEGKDIE--------------VAKDLQRVHDPHDESDE 387
           TRTYT+DGL EDPDNVSFR+  SE +                 ++KDL +VHDP +  D 
Sbjct: 334 TRTYTKDGLFEDPDNVSFRQKWSELQAFNNGESSSDYIDARNVISKDLLQVHDPKE--DT 391

Query: 388 MTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQKGEELP 447
           ++SD +ELHVNLGQ+GFVFIEANVKKYAFGSVYG IGIPPAYNG +IK+D +LQKG+ELP
Sbjct: 392 VSSDNIELHVNLGQLGFVFIEANVKKYAFGSVYGDIGIPPAYNGDDIKQDMLLQKGDELP 451

Query: 448 PRYA-DTDNFFGSMKVKEGSSSRITAQTSKPL 478
           P Y  D  +FFG +     +S   +A  S  L
Sbjct: 452 PEYPDDAVDFFGDIHSPASTSEPPSATFSAGL 483

>ABL026W [566] [Homologous to ScYKL124W (SSH4) - SH]
           complement(350985..352427) [1443 bp, 480 aa]
          Length = 480

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 256/415 (61%), Positives = 317/415 (76%), Gaps = 21/415 (5%)

Query: 65  IAAYVTFCG-DDESEYDEENALGTRTSGTLHSLFGKKHSGILLDSSFASPGGFDDEIVLQ 123
           +A Y+TFC   DE EY E+        G  H L   K    L  S F + G  + + + +
Sbjct: 1   MARYLTFCHIQDEREYIEK-------VGGAHGLARSKRHSDLYRSPFLNLGQANVKELAE 53

Query: 124 ERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQQFIKDRGIQSYFLLPS 183
              LE  P+MS +EVELY+RAKEFQ M+PP+VK FGTY+  +D+Q ++DRGIQ+Y+LLPS
Sbjct: 54  LELLEL-PRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGIQAYYLLPS 112

Query: 184 INDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKI--FRHI 241
           INDN+D  GNFLPSF+VQDKL++ F+K+NKSSST+MNYPLPHN++DAVYFEVK+  FR+ 
Sbjct: 113 INDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFEVKVYKFRNY 172

Query: 242 QKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTASTLLPKLEEGDTVGF 301
             SNSIFSIGL T PYPYF +PGM +YSIAYESTGKLRINN F ASTLLPKL+EGD VG 
Sbjct: 173 LASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLPKLQEGDVVGL 232

Query: 302 GYRYKTGTIFITHNGKKLMDVTQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFRE 361
           GYRY+TGT+FITHNGKK+MD+T NIGIDLF+GIGA NAAYTRTYT++GLL+D DNV  R+
Sbjct: 233 GYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGLLDDIDNVELRK 292

Query: 362 ALS-----EGKDI-EVAKD-LQRVHDPHDESDEMTSDEVELHVNLGQVGFVFIEANVKKY 414
            +      + +DI EV  + L R HDP   +  + SDE+EL VNLG VGFVF+EANVKKY
Sbjct: 293 QIQDLEADQKRDITEVMNEQLLRPHDP--RTRHINSDEIELQVNLGGVGFVFVEANVKKY 350

Query: 415 AFGSVYGQIGIPPAYNGTEIKKDTILQKGEELPPRYADTD-NFFGSMKVKEGSSS 468
           AFGS+YG+IGIPPAYNG E K D ILQKG++LPP+Y + + NFFG++KV  G+ S
Sbjct: 351 AFGSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKVNLGNGS 405

>Kwal_23.3488
          Length = 502

 Score =  131 bits (330), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 104/354 (29%), Positives = 157/354 (44%), Gaps = 83/354 (23%)

Query: 113 PGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMV---------KDFGTYLD 163
           P   DD   ++++    L +MSA E   Y + +EF   +PP++         +     ++
Sbjct: 109 PSALDDADAVRDK----LARMSAEEQFYYKQGEEFIKQNPPLLLPDRSPVGAETVDPIIN 164

Query: 164 SDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPL 223
               QFI + G  ++   P      D       S +V++K +I F  +N   S + N P+
Sbjct: 165 EQTLQFIDEEGAHAWEFQPDPKLPND-------SVLVENKSEITFLNYNYDVSVMTNLPI 217

Query: 224 PHNRKDAVYF-EVKIFR-------HIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIAYEST 275
           P  R + VY+ E KIF        +    N + S GL+T PYPYFR+PG   +SIAY+ST
Sbjct: 218 P--RLNRVYYCEFKIFELNTAGSNNNSSQNEMLSFGLSTSPYPYFRLPGRHHHSIAYDST 275

Query: 276 GKLRINNPFTAS----TLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDVTQNIGIDLF 331
           G  R N+ F  S    ++ P+ E+GD +G GYR  +GT+F T NGKKL + +        
Sbjct: 276 GGRRFNDSFELSPELASIFPRCEKGDVIGIGYRTNSGTVFFTRNGKKLNEKS-------- 327

Query: 332 IGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDLQRVHDPHDESDEMTSD 391
             IG     +   Y    +               G +I                      
Sbjct: 328 --IGGHIKGWKFKYVYPIV---------------GSNIPC-------------------- 350

Query: 392 EVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQKGEE 445
             ++HVN G  GFVFIEANVKK+ +    G    PP+Y   +  +D +L+   E
Sbjct: 351 --KVHVNFGTYGFVFIEANVKKWGYAKSNGMKLPPPSYE--DYSQDVLLESSYE 400

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score =  122 bits (307), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 161/374 (43%), Gaps = 92/374 (24%)

Query: 113 PGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGTY----------- 161
           P   DDE+ ++ +    L ++S  E   Y + +EF   +PP +  + T            
Sbjct: 93  PTVLDDELEVRHK----LAQLSPEEQFYYKQGEEFIKQNPPALMPYQTVAGGGSHGEPAD 148

Query: 162 -----LDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLPSFI-VQDKLDIQFSKFNKSS 215
                ++    ++I++ G Q++   PS         +  P F+ V+++ ++ F   N   
Sbjct: 149 VFDPVINDQTLRYIEEEGAQAWEFQPS--------PSLPPDFVKVENRTELTFMNSNSDV 200

Query: 216 STVMNYPLPHNRKDAVYFEVKIFRHIQK---------SNSIFSIGLTTVPYPYFRVPGMA 266
           S   N P+P   K   YFE KIF    +          N I S GL T PYPYFR+PG  
Sbjct: 201 SVATNLPIPLANK-VYYFECKIFELCDRLGRPVSHLSENQIVSFGLATSPYPYFRLPGRH 259

Query: 267 KYSIAYESTGKLRINNPFTA----STLLPKLEEGDTVGFGYRYKTGTIFITHNGKKLMDV 322
            +S+AY+S G  R+NN F      S+L P+ E+GD +G GYR ++GT+F           
Sbjct: 260 HHSVAYDSNGARRLNNSFKLPQELSSLFPRCEKGDVIGIGYRTRSGTVF----------- 308

Query: 323 TQNIGIDLFIGIGAFNAAYTRTYTRDGLLEDPDNVSFREALSEGKDIEVAKDLQRVHDPH 382
                                 +TR+G   +   +       +G  I+    +   + P 
Sbjct: 309 ----------------------FTRNGKKLNEKRIG---GHIKGWKIKYLYPIVGANVP- 342

Query: 383 DESDEMTSDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQK 442
                      ++HVN G  GFV+IEANVKK+ +  + G    PPAY   +  +D +L+ 
Sbjct: 343 ----------CKIHVNFGTYGFVYIEANVKKWGYAKLNGMKLPPPAYE--DYDRDVLLES 390

Query: 443 GEELPPRYADTDNF 456
             E      +T++F
Sbjct: 391 SYEDEVSEGETNSF 404

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score =  119 bits (299), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 119/232 (51%), Gaps = 40/232 (17%)

Query: 113 PGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPMVKDFGT-----------Y 161
           P   DDE  ++ +    L K+S  E   Y + +E+   +PP++   G+            
Sbjct: 134 PSALDDENEVKSK----LQKLSPEEQFYYKQGEEYIKQNPPLIISTGSRSGDQNTVNDPI 189

Query: 162 LDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDKLDIQFSKFNKSSSTVM 219
           ++   +QFI++ G  ++   P+ N         LP  + IV++K +I F  +N  +S   
Sbjct: 190 INDQTRQFIEEEGALAWEFQPNPN---------LPNDTIIVENKTEISFLNYNYDASVTT 240

Query: 220 NYPLPH-NRKDAVYFEVKIF-------RHIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIA 271
           N P+P  NR    Y E KIF       +   K N I S GL+T PYPYFR+PG   +SIA
Sbjct: 241 NLPIPCINR--VYYCEFKIFELSITDDQTTLKDNEIISFGLSTSPYPYFRLPGRHHHSIA 298

Query: 272 YESTGKLRINNPFT----ASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319
           Y+S G  R N+ F      + L PK ++GD +G GYR ++GT+F T NGKK+
Sbjct: 299 YDSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGYRTRSGTVFFTRNGKKI 350

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 129/248 (52%), Gaps = 37/248 (14%)

Query: 95  SLFGKKHSGILLDSSFASPGGFDDEIVLQERELEELPKMSAYEVELYIRAKEFQMMSPPM 154
           SL       I   +S + P   DDE  ++++    L K+S  E   Y + +E+   +PP+
Sbjct: 139 SLNNNNSPNIRTTTSNSWPSSLDDEEAVKDK----LVKLSPEEQFYYKQGEEYIKQNPPL 194

Query: 155 V-----KDFGTYLDS--DDQ--QFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDK 203
           +     +D    LD   +DQ  +FI++ G+ ++   P  N         LP  + ++++K
Sbjct: 195 LIPHRSEDSQGMLDPIINDQTIRFIEEEGVHAWEFQPDPN---------LPNDTILIENK 245

Query: 204 LDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFR--------HIQKSNSIFSIGLTTV 255
            +I F  +N  +S + N P+P   +   YFE KIF         +    N + S GL++ 
Sbjct: 246 TEITFLNYNYDASVMTNLPVPRVNR-VYYFECKIFELNTSRSDNNYLSDNEMISFGLSSS 304

Query: 256 PYPYFRVPGMAKYSIAYESTGKLRINNPFTAS----TLLPKLEEGDTVGFGYRYKTGTIF 311
           PYPYFR+PG   +SIAY+STG  R N+ F  S    ++ P+ ++GD +G GYR  +GT+F
Sbjct: 305 PYPYFRLPGRHHHSIAYDSTGGRRFNDSFELSAELASIFPRYQKGDIIGIGYRTNSGTVF 364

Query: 312 ITHNGKKL 319
            T NGKKL
Sbjct: 365 FTRNGKKL 372

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score =  115 bits (288), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 120/231 (51%), Gaps = 41/231 (17%)

Query: 117 DDEIVLQERELEE-LPKMSAYEVELYIRAKEFQMMSPPMVKDFGTYLDSDDQ-------- 167
           +D  +  E E++E L  +S  E   Y + +E+   +PP++     YL +D +        
Sbjct: 90  EDRYLDDESEVKEFLQNLSPKEQFYYKQGEEYVKQNPPLLV---PYLPNDPENREEVIPD 146

Query: 168 --------QFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDKLDIQFSKFNKSSST 217
                   QFI++ G  ++      N         LP  + ++Q++ ++ F  F+  +S 
Sbjct: 147 PIVNEQTLQFIEEEGAAAWEFQADPN---------LPNDTVMIQERTELTFLNFSYDASV 197

Query: 218 VMNYPLPHNRKDAVYFEVKIFRHIQ-----KSNSIFSIGLTTVPYPYFRVPGMAKYSIAY 272
           +   P+P   K   Y+E KIF   Q       N + SIGL+T PYPYFR+PG   +SI+Y
Sbjct: 198 MTTLPIPRLNK-VYYYECKIFELNQGKNHLSDNEMISIGLSTSPYPYFRLPGRHHHSISY 256

Query: 273 ESTGKLRINNPFTAS----TLLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319
           +S G  R+N+ F  S    TL P+ E+GD +G GYR ++GTIF THNGKKL
Sbjct: 257 DSDGCRRMNSSFPMSAELQTLFPRFEKGDVIGIGYRTRSGTIFFTHNGKKL 307

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score =  115 bits (287), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 132/271 (48%), Gaps = 54/271 (19%)

Query: 77  SEYDEENALGTRTSGTLHSLFGKKHSGILLDS-SFASPGGFDDEIVLQERELEELPKMSA 135
           S+YDE NA                HS  L+++ S   P   DD   ++++    L ++S 
Sbjct: 93  SDYDENNA--------------HVHSRRLMENMSLRWPNNLDDADEVRDK----LAQLSP 134

Query: 136 YEVELYIRAKEFQMMSPPMVKDFGTYLDSDD----------------QQFIKDRGIQSYF 179
            E   Y + +E+   +PP + + G    S+D                +Q+I++ G  ++ 
Sbjct: 135 EEQFYYKQGEEYIKQNPPFLLNQGLLQQSEDSNPDTTREDPIMNEQTRQYIQEEGAYAWE 194

Query: 180 LLPSINDNIDEYGNFLPSFIVQDKLDIQFSKFNKSSSTVMNYPLPHNRKDAVYFEVKIFR 239
             P  N ++  +     + IV++K ++ F  +N  +S   N P+P   K   Y E KIF 
Sbjct: 195 FSP--NPDMPNH-----TVIVENKTEVSFLNYNYDASISTNLPIPCINK-VYYCEFKIFE 246

Query: 240 HIQKSNS-------IFSIGLTTVPYPYFRVPGMAKYSIAYESTGKLRINNPFTAS----T 288
                NS       + S GL+T PYPYFR+PG   +SIAY+S G  R N+ F  +    T
Sbjct: 247 TDGPLNSDENVSKGVISFGLSTQPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLNEQLRT 306

Query: 289 LLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319
           L P+ E+GD VG GYR ++GT+F T NGKKL
Sbjct: 307 LFPQCEKGDIVGIGYRSRSGTVFFTRNGKKL 337

>Scas_669.10
          Length = 585

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 90/172 (52%), Gaps = 25/172 (14%)

Query: 162 LDSDDQQFIKDRGIQSYFLLPSINDNIDEYGNFLP--SFIVQDKLDIQFSKFNKSSSTVM 219
           ++   +QFI++ G  ++      N         LP  + ++++K +I F  +N  +S + 
Sbjct: 189 MNHQTKQFIEEEGASAWEFQADPN---------LPNDTILIENKTEITFLNYNYDASVMT 239

Query: 220 NYPLPH-NRKDAVYFEVKIF-------RHIQKSNSIFSIGLTTVPYPYFRVPGMAKYSIA 271
           N P+P  NR    Y E KIF       +     N + S+GL T PYPYFR+PG   +SIA
Sbjct: 240 NLPIPCINR--VYYCEFKIFELNNSPEQTNLSPNEVISMGLATSPYPYFRLPGRHHHSIA 297

Query: 272 YESTGKLRINNPF----TASTLLPKLEEGDTVGFGYRYKTGTIFITHNGKKL 319
           Y+S G  R N+ F      + L P  E GD +G GYR ++GT F T NGKK+
Sbjct: 298 YDSNGARRFNDSFPLDPELANLFPVCERGDIIGVGYRTRSGTFFFTRNGKKV 349

>Scas_590.14
          Length = 693

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 188 IDEYGNFLPSFI----------VQDKLDIQFSKFNKSSSTVMNYPLPHNRK 228
           + +Y +FLP +I          ++D L++QFS  N S    M +P P  ++
Sbjct: 461 VTQYADFLPDYITVFEKLNSSFMEDPLEVQFSILNSSIKLFMKFPTPETKQ 511

>KLLA0E04851g join(437719..437721,437833..438168) similar to
           sp|P54999| Saccharomyces cerevisiae YPR182w Small
           nuclear ribonucleoprotein F
          Length = 112

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 390 SDEVELHVNLGQVGFVFIEANVKKYAFGSVYGQIGIPPAYNGTEIKKDTILQKGE 444
           ++E+   V+ G+VG +FI  N   Y    V  Q   PP   GT  K D   + GE
Sbjct: 52  AEEIINDVSSGKVGDIFIRCNNVLYVGEDVNKQSDQPPTPTGTTEKSDDKEENGE 106

>YHR016C (YSC84) [2302] chr8
           complement(136873..138232,138401..138447) Protein
           involved in cortical actin patch polarization with
           Lsb5p, also has overlapping funciton with Lsb5p in fluid
           phase endocytosis and vesicle trafficking [1407 bp, 468
           aa]
          Length = 468

 Score = 29.3 bits (64), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 20/48 (41%)

Query: 219 MNYPLPHNRKDAVYFEVKIFRHIQKSNSIFSIGLTTVPYPYFRVPGMA 266
           +N P+P + K       K+ R   K N +F       PY   R  G+A
Sbjct: 3   INNPIPRSLKSETKKAAKVLRSFVKPNQVFGADQVIPPYVLKRAKGLA 50

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,811,131
Number of extensions: 915628
Number of successful extensions: 2833
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2866
Number of HSP's successfully gapped: 32
Length of query: 569
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 462
Effective length of database: 12,891,983
Effective search space: 5956096146
Effective search space used: 5956096146
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)