Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL122C (SRP21)1671455932e-79
Scas_721.1271571353292e-39
Kwal_26.76621341262873e-33
Sklu_2430.81581512762e-31
ABL025C1371292646e-30
CAGL0K11660g187802304e-24
KLLA0B12782g1431241979e-20
Kwal_56.2466348442740.094
Sklu_1985.444942641.6
CAGL0I07975g29461604.9
AER020W29261605.1
Kwal_56.2312829461588.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL122C
         (165 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL122C (SRP21) [3143] chr11 complement(212141..212644) Signal r...   233   2e-79
Scas_721.127                                                          131   2e-39
Kwal_26.7662                                                          115   3e-33
Sklu_2430.8 YKL122C, Contig c2430 14655-15131 reverse complement      110   2e-31
ABL025C [567] [Homologous to ScYKL122C (SRP21) - SH] (352547..35...   106   6e-30
CAGL0K11660g 1125697..1126260 similar to sp|P32342 Saccharomyces...    93   4e-24
KLLA0B12782g complement(1116729..1117160) weakly similar to sp|P...    80   9e-20
Kwal_56.24663                                                          33   0.094
Sklu_1985.4 YLR195C, Contig c1985 6795-8144                            29   1.6  
CAGL0I07975g complement(779156..780040) highly similar to tr|Q08...    28   4.9  
AER020W [2525] [Homologous to ScYOL077C (BRX1) - SH] complement(...    28   5.1  
Kwal_56.23128                                                          27   8.9  

>YKL122C (SRP21) [3143] chr11 complement(212141..212644) Signal
           recognition particle core subunit [504 bp, 167 aa]
          Length = 167

 Score =  233 bits (593), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 119/145 (82%)

Query: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK 60
           MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK
Sbjct: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK 60

Query: 61  SKDVSRLLSALGPRGVSITPGKIXXXXXXXXXXXXXXXXXXXXXXXXXXDIVGLATLIVN 120
           SKDVSRLLSALGPRGVSITPGKI                          DIVGLATLIVN
Sbjct: 61  SKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVN 120

Query: 121 TDVEKSDPAAKKTATEPKQKANAVQ 145
           TDVEKSDPAAKKTATEPKQKANAVQ
Sbjct: 121 TDVEKSDPAAKKTATEPKQKANAVQ 145

>Scas_721.127
          Length = 157

 Score =  131 bits (329), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 90/135 (66%), Gaps = 4/135 (2%)

Query: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKT-DTKVSFRTHNSHLSLNYKFTTN 59
           MSVKPID +IT+SV+LFEVNPSQT+ S++YK PT+K   + V F+THN HL  +YKF+TN
Sbjct: 1   MSVKPIDTFITSSVKLFEVNPSQTVISLTYKTPTEKKRQSDVIFKTHNPHLGTSYKFSTN 60

Query: 60  KSKDVSRLLSALGPRGVSITPGKIXXXXXXXXXXXXXXXXXXXXXXXXXXDIVGLATLIV 119
           KSKDVSRLL+A+GPRGVS+ PG+I                          D+VGL +LIV
Sbjct: 61  KSKDVSRLLNAVGPRGVSVIPGRI---ERLNQTAAKVSKKKTSIKKKTIKDVVGLGSLIV 117

Query: 120 NTDVEKSDPAAKKTA 134
           NTDV++  P    +A
Sbjct: 118 NTDVKEYVPIQPGSA 132

>Kwal_26.7662
          Length = 134

 Score =  115 bits (287), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 81/126 (64%), Gaps = 18/126 (14%)

Query: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK 60
           MSV+P+D++ITNSV+L E NPS+T+ S++Y    +   +KV+F+THN+ LS  YKF+T K
Sbjct: 1   MSVEPLDSFITNSVKLLEANPSETILSVTYN--CKGKGSKVAFKTHNASLSTRYKFSTRK 58

Query: 61  SKDVSRLLSALGPRGVSITPGKIXXXXXXXXXXXXXXXXXXXXXXXXXXDIVGLATLIVN 120
           SKDVSRLLSALGPRGVSIT GK+                          D+ G++TL+ N
Sbjct: 59  SKDVSRLLSALGPRGVSITNGKV----------------EKNKTGKKTKDVGGMSTLLAN 102

Query: 121 TDVEKS 126
            D+ +S
Sbjct: 103 VDIPES 108

>Sklu_2430.8 YKL122C, Contig c2430 14655-15131 reverse complement
          Length = 158

 Score =  110 bits (276), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 83/151 (54%), Gaps = 31/151 (20%)

Query: 3   VKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTD--------------TKVSFRTHNS 48
           VKP+D +I NS+ L E NPSQTL SISY    +K                + VSF+THN+
Sbjct: 6   VKPLDTFIINSISLLEANPSQTLVSISYGSEAKKRKLGEKDSSRVLSQHKSLVSFKTHNT 65

Query: 49  HLSLNYKFTTNKSKDVSRLLSALGPRGVSITPGKIXXXXXXXXXXXXXXXXXXXXXXXXX 108
           HL ++YKF TNK KDVSRLLSALGPRGV I+ GK                          
Sbjct: 66  HLGISYKFRTNKFKDVSRLLSALGPRGVQISKGK------------IEKKKTSKKDASDS 113

Query: 109 XDIVGLATLIVNTDV-----EKSDPAAKKTA 134
            D VG++TL+VNTDV     E S PA+K+ A
Sbjct: 114 KDTVGMSTLLVNTDVKEHIEEISKPASKQQA 144

>ABL025C [567] [Homologous to ScYKL122C (SRP21) - SH]
           (352547..352960) [414 bp, 137 aa]
          Length = 137

 Score =  106 bits (264), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 76/129 (58%), Gaps = 17/129 (13%)

Query: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPT-QKTDTKVSFRTHNSHLSLNYKFTTN 59
           MSVKP+D++I +S++L   NPSQTL S  Y+  + + +   V FRTHNSHL L+YKF T 
Sbjct: 1   MSVKPVDSFIKDSLQLLCANPSQTLVSFRYRGGSAEGSAVLVRFRTHNSHLGLHYKFKTR 60

Query: 60  KSKDVSRLLSALGPRGVSITPGKIXXXXXXXXXXXXXXXXXXXXXXXXXXDIVGLATLIV 119
           + KDVSR+LSALGPRGV++                               D+VG+ATL+V
Sbjct: 61  RQKDVSRVLSALGPRGVNVV----------------AVGTERRKRKQASRDLVGMATLLV 104

Query: 120 NTDVEKSDP 128
           N DV++  P
Sbjct: 105 NADVKQHVP 113

>CAGL0K11660g 1125697..1126260 similar to sp|P32342 Saccharomyces
          cerevisiae YKL122c SRP21, start by similarity
          Length = 187

 Score = 93.2 bits (230), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 58/80 (72%), Gaps = 2/80 (2%)

Query: 1  MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK 60
          MSVKPID +I NSV+LFE NPS +  +ISY     K D  V FRTHN HLS  YK+ T  
Sbjct: 1  MSVKPIDTFIENSVKLFEANPSGSSITISYHGGA-KADP-VVFRTHNPHLSTTYKYQTKM 58

Query: 61 SKDVSRLLSALGPRGVSITP 80
          +K+VSR+L+ALGPRGVS+ P
Sbjct: 59 NKEVSRVLNALGPRGVSMNP 78

>KLLA0B12782g complement(1116729..1117160) weakly similar to
           sp|P32342 Saccharomyces cerevisiae YKL122c SRP21 signal
           recognition particle subunit singleton, start by
           similarity
          Length = 143

 Score = 80.5 bits (197), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 16/124 (12%)

Query: 1   MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNK 60
           MSV  +D +IT S++L E N SQT   + Y+P +    +KV+FRT N  + L YK+ T  
Sbjct: 1   MSVSDLDTFITGSLKLLETNASQTKIMMKYRPQSDDIHSKVTFRTKNDSVGLTYKYKTAH 60

Query: 61  SKDVSRLLSALGPRGVSITPGKIXXXXXXXXXXXXXXXXXXXXXXXXXXDIVGLATLIVN 120
           SK++SR LSA+GP GV++  GK+                          D+ G+ TL+VN
Sbjct: 61  SKELSRGLSAIGPTGVNLQLGKV----------------GKQVFKKKSKDLPGMTTLLVN 104

Query: 121 TDVE 124
             V+
Sbjct: 105 QKVK 108

>Kwal_56.24663
          Length = 484

 Score = 33.1 bits (74), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%)

Query: 7   DNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNS 48
           +NY+ +    F  N S+  F+ S KPP  + D  V  RT  S
Sbjct: 137 ENYVEDQDATFRFNYSREFFNWSLKPPGWRKDWHVGVRTRQS 178

>Sklu_1985.4 YLR195C, Contig c1985 6795-8144
          Length = 449

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 21/42 (50%)

Query: 7   DNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNS 48
           +NY+ +    F  N S+  F+ + KPP  K +  V  R  +S
Sbjct: 100 ENYVEDQDATFRFNYSREFFNWALKPPGWKKEWHVGVRVKSS 141

>CAGL0I07975g complement(779156..780040) highly similar to tr|Q08235
           Saccharomyces cerevisiae YOL077c BRX1, start by
           similarity
          Length = 294

 Score = 27.7 bits (60), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 3/61 (4%)

Query: 9   YITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLL 68
           Y  N++  FE    Q L+    KPP   T   + F   N H      FT N  K    +L
Sbjct: 81  YNCNNIMFFEARKHQDLYLWMSKPPNGPT---IKFYVQNLHTMDELNFTGNCLKGSRPIL 137

Query: 69  S 69
           S
Sbjct: 138 S 138

>AER020W [2525] [Homologous to ScYOL077C (BRX1) - SH]
           complement(667648..668526) [879 bp, 292 aa]
          Length = 292

 Score = 27.7 bits (60), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 3/61 (4%)

Query: 9   YITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLL 68
           Y  N+V  FE    Q L+    KPP   T   V F   N H      FT N  K    +L
Sbjct: 80  YNCNNVAFFEARKHQDLYMWLSKPPNGPT---VKFYLQNLHTMDELNFTGNCLKGSRPVL 136

Query: 69  S 69
           S
Sbjct: 137 S 137

>Kwal_56.23128
          Length = 294

 Score = 26.9 bits (58), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 24/61 (39%), Gaps = 3/61 (4%)

Query: 9   YITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLL 68
           Y  N+V  FE    Q L+    KPP   T   + F   N H      FT N  K    +L
Sbjct: 80  YNCNNVLFFEARKHQDLYMWLSKPPNGPT---IKFYLQNLHTMDELNFTGNCLKGSRPVL 136

Query: 69  S 69
           S
Sbjct: 137 S 137

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.126    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,694,133
Number of extensions: 113009
Number of successful extensions: 333
Number of sequences better than 10.0: 18
Number of HSP's gapped: 325
Number of HSP's successfully gapped: 19
Length of query: 165
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 71
Effective length of database: 13,342,017
Effective search space: 947283207
Effective search space used: 947283207
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.6 bits)