Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL120W (OAC1)32431916070.0
Scas_721.12932331713500.0
CAGL0K11616g32031413450.0
Sklu_2430.1032432012651e-176
Kwal_26.765332531612571e-175
KLLA0B12826g31931312081e-168
ABL023W3093006971e-90
Sklu_2432.52882902693e-27
CAGL0G01166g2952902414e-23
YLR348C (DIC1)2982872325e-22
Sklu_2359.69022832325e-21
Kwal_47.173218812822245e-20
CAGL0K02365g9192852202e-19
YPR021C (AGC1)9022832192e-19
ADL049W9122872192e-19
Scas_602.88852862158e-19
YMR056C (AAC1)3092792099e-19
KLLA0E13453g9062992122e-18
CAGL0F04213g3062772028e-18
Sklu_2363.23233101983e-17
Scas_702.103022901973e-17
Sklu_2334.23192901905e-16
YEL006W3352981905e-16
YPR011C3263111897e-16
CAGL0J02002g3612921899e-16
Scas_667.43082871871e-15
ADL009W3792941881e-15
YOR222W (ODC2)3072911842e-15
YBR085W (AAC3)3073021842e-15
Scas_721.273743441862e-15
KLLA0D15015g3173121843e-15
Scas_640.253062951843e-15
CAGL0J01661g3273081843e-15
KLLA0E18810g3773101853e-15
Scas_709.93652961853e-15
Scas_718.243372731825e-15
YBL030C (PET9)3182731816e-15
CAGL0L02079g2972991808e-15
YBR291C (CTP1)2993171791e-14
Sklu_2431.53703471801e-14
Scas_489.42972991781e-14
Sklu_1149.22963111762e-14
KLLA0E12353g3052861762e-14
Scas_589.103162241754e-14
Kwal_26.86692962881737e-14
YPL134C (ODC1)3103021737e-14
Scas_716.293163311702e-13
YJR095W (SFC1)3222931693e-13
YIL134W (FLX1)3113031683e-13
KLLA0D07073g2972991683e-13
CAGL0M05225g3813191694e-13
Kwal_27.124813042871674e-13
KLLA0D09889g3642081685e-13
AAR036W3173111665e-13
AGL047C3162931666e-13
Scas_691.43343091667e-13
AER184W3052781658e-13
Kwal_26.79672972991631e-12
AGL311C3622031632e-12
ACR109W2992881603e-12
Kwal_14.22103152991595e-12
Kwal_23.39653073151578e-12
Kwal_55.208683803021561e-11
KLLA0E23705g3681631552e-11
CAGL0M09020g3483191533e-11
YIL006W3732891543e-11
KLLA0F03212g3052881523e-11
Kwal_47.182163332371509e-11
Kwal_27.120813693461509e-11
YGR096W (TPC1)3143191481e-10
KLLA0E02772g2842771472e-10
Kwal_23.47313142981472e-10
AEL253W3653261446e-10
KLLA0D04290g1881801361e-09
Scas_669.63732121402e-09
KLLA0A00979g3431381392e-09
Kwal_47.192282811161382e-09
Scas_328.12271551353e-09
CAGL0J04114g3032931373e-09
AFL196W3611781383e-09
CAGL0G03135g3073161373e-09
KLLA0D14036g4313181383e-09
YBR192W (RIM2)3771661374e-09
Sklu_2037.23102041355e-09
KLLA0E09680g3072911347e-09
CAGL0F07711g3682461341e-08
CAGL0B03883g3062941321e-08
YPR058W (YMC1)3073091321e-08
Sklu_2260.53021721321e-08
CAGL0H03839g2822971302e-08
Kwal_55.213353172721293e-08
YGR257C (MTM1)3662731294e-08
Scas_667.223063061285e-08
Scas_662.123081821267e-08
Kwal_23.35293951491278e-08
Sklu_2433.84201161269e-08
Kwal_33.140503142941251e-07
CAGL0D01606g3053001251e-07
KLLA0F04697g3073001223e-07
Sklu_2194.33121911223e-07
Scas_718.53243291214e-07
Sklu_2075.33452941214e-07
CAGL0B04543g3173221205e-07
YMR166C3682261205e-07
AFR253W3441291205e-07
Scas_632.92923061196e-07
CAGL0F08305g3742731206e-07
Scas_687.15*3281161196e-07
Scas_562.123001631196e-07
YDL198C (YHM1)3001511197e-07
Scas_558.22893061187e-07
Kwal_23.30425423331208e-07
YOR100C (CRC1)3273091189e-07
ACR260W3111661171e-06
Kwal_33.154463053051161e-06
YBR104W (YMC2)3293091161e-06
AFR131C3443591162e-06
CAGL0G08910g2892101152e-06
AER366W2931991152e-06
AGR383W2933061152e-06
YOR130C (ORT1)2921891142e-06
CAGL0J09790g3001561142e-06
YFR045W2851451133e-06
YMR241W (YHM2)3141961133e-06
Kwal_27.116262991511124e-06
Kwal_34.159073121931134e-06
YNL003C (PET8)2843021115e-06
KLLA0F08547g3081931116e-06
KLLA0F13464g3001631108e-06
YJL133W (MRS3)3142331091e-05
Kwal_23.57573072841072e-05
KLLA0A09383g3662831082e-05
Sklu_2117.22981581072e-05
CAGL0H10538g2972021072e-05
Sklu_2398.43091781072e-05
KLLA0B08503g3033001072e-05
Sklu_2374.75133281063e-05
Kwal_23.43543432691053e-05
YHR002W (LEU5)357961054e-05
CAGL0L05742g3051141044e-05
CAGL0K07436g3071901045e-05
Scas_697.473283501045e-05
Scas_379.23012961036e-05
CAGL0K02915g3421131037e-05
Scas_696.93121831028e-05
CAGL0J05522g5193311021e-04
Kwal_23.29133201661011e-04
Sklu_1275.13113151011e-04
Scas_645.93912801011e-04
Kwal_0.2322741671001e-04
KLLA0C11363g5173271012e-04
Kwal_55.21106328345992e-04
CAGL0K12210g311308992e-04
Scas_717.20356116992e-04
KLLA0E02750g304290992e-04
KLLA0D04950g274167982e-04
Sklu_2127.5278274983e-04
CAGL0K08250g297111983e-04
Scas_715.45305174983e-04
KLLA0F17864g307161973e-04
Kwal_27.11419298180973e-04
Sklu_2442.8275167974e-04
AGR191W298154974e-04
KLLA0E18788g38193974e-04
KLLA0E08877g294175956e-04
YER053C300321956e-04
AFR147C315172956e-04
Kwal_26.797235880957e-04
CAGL0C02013g329127957e-04
Kwal_55.2133832378957e-04
AFR146W281272947e-04
YKR052C (MRS4)304197948e-04
Sklu_2115.4299301940.001
Sklu_2435.2344322930.001
YNL083W545325930.001
Scas_671.1*12380870.002
Kwal_27.12599304186910.002
KLLA0C13431g328321910.002
Scas_714.18305307910.002
AFR542W310196900.002
AAL014C271167890.003
Scas_578.3*524207900.003
Sklu_1119.1307320890.003
KLLA0E15532g326101890.003
Scas_582.7329301890.004
Scas_198.17232790.008
AER419W493149850.012
Kwal_33.15597305259850.012
KLLA0D04312g10381790.013
CAGL0D04774g322162840.014
Kwal_56.23011303298840.016
YDL119C30778830.017
YPR128C (ANT1)328101830.019
AGL065C335108820.025
CAGL0K10362g301308820.026
CAGL0F00231g307175810.034
KLLA0B14454g305174790.057
Scas_705.9323111780.086
AGL064W29671760.12
YJR077C (MIR1)311172760.13
Scas_673.17314176760.14
CAGL0K06545g512101750.23
Sklu_2127.4323270730.36
KLLA0A01342g78185720.51
Scas_613.2417733690.61
CAGL0I03586g86747710.82
ADL264C329137700.85
AER450C308173690.89
Scas_628.962152681.5
Sklu_1926.2305124671.6
Kwal_33.12988303156671.6
Sklu_2250.17528612.2
KLLA0C15983g189354672.4
KLLA0B11319g355157662.6
ADR036C34031653.7
CAGL0M05423g81241645.0
YDR470C (UGO1)502113645.4
Kwal_56.2264172243628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL120W
         (319 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...   623   0.0  
Scas_721.129                                                          524   0.0  
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...   522   0.0  
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                        491   e-176
Kwal_26.7653                                                          488   e-175
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...   469   e-168
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...   273   1e-90
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement      108   3e-27
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    97   4e-23
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    94   5e-22
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          94   5e-21
Kwal_47.17321                                                          91   5e-20
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    89   2e-19
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    89   2e-19
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    89   2e-19
Scas_602.8                                                             87   8e-19
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    85   9e-19
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    86   2e-18
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    82   8e-18
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          81   3e-17
Scas_702.10                                                            80   3e-17
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         78   5e-16
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    78   5e-16
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    77   7e-16
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    77   9e-16
Scas_667.4                                                             77   1e-15
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    77   1e-15
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    75   2e-15
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    75   2e-15
Scas_721.27                                                            76   2e-15
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    75   3e-15
Scas_640.25                                                            75   3e-15
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    75   3e-15
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    76   3e-15
Scas_709.9                                                             76   3e-15
Scas_718.24                                                            75   5e-15
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    74   6e-15
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    74   8e-15
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    74   1e-14
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            74   1e-14
Scas_489.4                                                             73   1e-14
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         72   2e-14
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    72   2e-14
Scas_589.10                                                            72   4e-14
Kwal_26.8669                                                           71   7e-14
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    71   7e-14
Scas_716.29                                                            70   2e-13
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    70   3e-13
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    69   3e-13
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    69   3e-13
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    70   4e-13
Kwal_27.12481                                                          69   4e-13
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    69   5e-13
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    69   5e-13
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    69   6e-13
Scas_691.4                                                             69   7e-13
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    68   8e-13
Kwal_26.7967                                                           67   1e-12
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    67   2e-12
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    66   3e-12
Kwal_14.2210                                                           66   5e-12
Kwal_23.3965                                                           65   8e-12
Kwal_55.20868                                                          65   1e-11
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    64   2e-11
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    64   3e-11
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    64   3e-11
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    63   3e-11
Kwal_47.18216                                                          62   9e-11
Kwal_27.12081                                                          62   9e-11
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    62   1e-10
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    61   2e-10
Kwal_23.4731                                                           61   2e-10
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    60   6e-10
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    57   1e-09
Scas_669.6                                                             59   2e-09
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    58   2e-09
Kwal_47.19228                                                          58   2e-09
Scas_328.1                                                             57   3e-09
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    57   3e-09
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    58   3e-09
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    57   3e-09
KLLA0D14036g complement(1203522..1204817) some similarities with...    58   3e-09
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    57   4e-09
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         57   5e-09
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    56   7e-09
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    56   1e-08
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    55   1e-08
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    55   1e-08
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         55   1e-08
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    55   2e-08
Kwal_55.21335                                                          54   3e-08
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    54   4e-08
Scas_667.22                                                            54   5e-08
Scas_662.12                                                            53   7e-08
Kwal_23.3529                                                           54   8e-08
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       53   9e-08
Kwal_33.14050                                                          53   1e-07
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    53   1e-07
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    52   3e-07
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            52   3e-07
Scas_718.5                                                             51   4e-07
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                51   4e-07
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    51   5e-07
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    51   5e-07
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    51   5e-07
Scas_632.9                                                             50   6e-07
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    51   6e-07
Scas_687.15*                                                           50   6e-07
Scas_562.12                                                            50   6e-07
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    50   7e-07
Scas_558.2                                                             50   7e-07
Kwal_23.3042                                                           51   8e-07
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    50   9e-07
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    50   1e-06
Kwal_33.15446                                                          49   1e-06
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    49   1e-06
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    49   2e-06
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    49   2e-06
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    49   2e-06
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    49   2e-06
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    49   2e-06
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    49   2e-06
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    48   3e-06
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    48   3e-06
Kwal_27.11626                                                          48   4e-06
Kwal_34.15907                                                          48   4e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    47   5e-06
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    47   6e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    47   8e-06
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    47   1e-05
Kwal_23.5757                                                           46   2e-05
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    46   2e-05
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            46   2e-05
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    46   2e-05
Sklu_2398.4 , Contig c2398 9476-10405                                  46   2e-05
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    46   2e-05
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       45   3e-05
Kwal_23.4354                                                           45   3e-05
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    45   4e-05
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    45   4e-05
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    45   5e-05
Scas_697.47                                                            45   5e-05
Scas_379.2                                                             44   6e-05
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    44   7e-05
Scas_696.9                                                             44   8e-05
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    44   1e-04
Kwal_23.2913                                                           44   1e-04
Sklu_1275.1 , Contig c1275 314-1249                                    44   1e-04
Scas_645.9                                                             44   1e-04
Kwal_0.232                                                             43   1e-04
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    44   2e-04
Kwal_55.21106                                                          43   2e-04
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    43   2e-04
Scas_717.20                                                            43   2e-04
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    43   2e-04
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    42   2e-04
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         42   3e-04
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    42   3e-04
Scas_715.45                                                            42   3e-04
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    42   3e-04
Kwal_27.11419                                                          42   3e-04
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          42   4e-04
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    42   4e-04
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    42   4e-04
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    41   6e-04
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    41   6e-04
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    41   6e-04
Kwal_26.7972                                                           41   7e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    41   7e-04
Kwal_55.21338                                                          41   7e-04
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    41   7e-04
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    41   8e-04
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            41   0.001
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         40   0.001
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    40   0.001
Scas_671.1*                                                            38   0.002
Kwal_27.12599                                                          40   0.002
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    40   0.002
Scas_714.18                                                            40   0.002
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    39   0.002
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    39   0.003
Scas_578.3*                                                            39   0.003
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             39   0.003
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    39   0.003
Scas_582.7                                                             39   0.004
Scas_198.1                                                             35   0.008
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    37   0.012
Kwal_33.15597                                                          37   0.012
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    35   0.013
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    37   0.014
Kwal_56.23011                                                          37   0.016
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    37   0.017
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    37   0.019
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    36   0.025
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    36   0.026
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    36   0.034
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    35   0.057
Scas_705.9                                                             35   0.086
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    34   0.12 
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    34   0.13 
Scas_673.17                                                            34   0.14 
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    33   0.23 
Sklu_2127.4 , Contig c2127 6322-7293                                   33   0.36 
KLLA0A01342g complement(120385..122730) some similarities with s...    32   0.51 
Scas_613.24                                                            31   0.61 
CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces c...    32   0.82 
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    32   0.85 
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    31   0.89 
Scas_628.9                                                             31   1.5  
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          30   1.6  
Kwal_33.12988                                                          30   1.6  
Sklu_2250.1 YBL030C, Contig c2250 1624-1847                            28   2.2  
KLLA0C15983g 1389936..1395617 highly similar to sp|P19097 Saccha...    30   2.4  
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    30   2.6  
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    30   3.7  
CAGL0M05423g 577097..579535 highly similar to sp|P38132 Saccharo...    29   5.0  
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    29   5.4  
Kwal_56.22641                                                          28   8.8  

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/319 (95%), Positives = 305/319 (95%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA
Sbjct: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ 120
           AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ
Sbjct: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ 120

Query: 121 EPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT 180
           EPHKVQSVGVNVF              PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT
Sbjct: 121 EPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT 180

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG 240
           IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG
Sbjct: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG 240

Query: 241 LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTI 300
           LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTI
Sbjct: 241 LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTI 300

Query: 301 MCLTFMEQTMKLVYSIESR 319
           MCLTFMEQTMKLVYSIESR
Sbjct: 301 MCLTFMEQTMKLVYSIESR 319

>Scas_721.129
          Length = 323

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/317 (77%), Positives = 275/317 (86%)

Query: 3   SDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAK 62
           SD   Q K+IEKTAAQK+SKFGSF+AGG+AACIAVT TNPIEL+KIRMQLQGE++A   K
Sbjct: 2   SDTKPQKKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQK 61

Query: 63  VYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEP 122
           VY+NPIQGM VIF+NEGI+GLQKGL AAYIYQIGLNGSRLGFYEPIR++LN  F+P++E 
Sbjct: 62  VYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEES 121

Query: 123 HKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182
           HK+Q V +NV               PLFLVKTR+QSYS+ IKIGEQTHY  VWNGL TI 
Sbjct: 122 HKIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIA 181

Query: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLG 242
           +TEG KGLFRGIDAAILRTGAGSSVQLPIYNTAKN L+KNDLMKDGP LHLTASTISGLG
Sbjct: 182 RTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLG 241

Query: 243 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMC 302
           VAVVMNPWDVILTRIYNQKG+LYKGP+DC VKTVR EG++ALYKGF AQ+ RIAPHTI+C
Sbjct: 242 VAVVMNPWDVILTRIYNQKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIIC 301

Query: 303 LTFMEQTMKLVYSIESR 319
           LTFMEQTMKLVYS+ES+
Sbjct: 302 LTFMEQTMKLVYSVESK 318

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/314 (77%), Positives = 277/314 (88%)

Query: 6   SKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYK 65
           +K + +I+K+AAQK+SKFGSF AGGLAACIAVTVTNPIE++KIRMQLQGE+ A+  ++Y 
Sbjct: 2   AKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYT 61

Query: 66  NPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV 125
           NP Q M V+F+NEGI+GLQKGL AAYIYQI LNGSRLGFYEPIR+ +N+ F+PDQE HKV
Sbjct: 62  NPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKV 121

Query: 126 QSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTE 185
           QSVG+NVF              PLFLVKTRLQSYS  IKIGEQTHYTGVWNGL TI+ TE
Sbjct: 122 QSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTE 181

Query: 186 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAV 245
           GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN L++ND+M+DGP+LHLTASTISGLGVAV
Sbjct: 182 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAV 241

Query: 246 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTF 305
           VMNPWDVILTRIYNQKGDLYKGPIDCLVKTV+IEG+TALYKGF AQVFRI PHTI+CLTF
Sbjct: 242 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTF 301

Query: 306 MEQTMKLVYSIESR 319
           +EQTMKLV++ ES+
Sbjct: 302 LEQTMKLVHAFESK 315

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 227/320 (70%), Positives = 270/320 (84%), Gaps = 1/320 (0%)

Query: 1   MSSDNSK-QDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSAS 59
           MSS+N     K+ EK+AAQK+SK GSF+AGGLAACIAVTVTNP EL+K RMQLQGEMSA+
Sbjct: 1   MSSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSAT 60

Query: 60  AAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPD 119
             ++Y+NP Q + VIFKNEG+KGLQ+GL +AY+YQIGLNGSRLGFYEPIR+ LN+ FFP+
Sbjct: 61  NQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPE 120

Query: 120 QEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLV 179
            +PHK+Q+V VNV               PLFLVKTR+QSYS  IKIGEQTHYT + NGL 
Sbjct: 121 SDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLA 180

Query: 180 TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTIS 239
           TIFK EGV GLFRG+DAAILRTGAGSSVQLPIYNT KN L++ND+MK+G ALHL +ST++
Sbjct: 181 TIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVT 240

Query: 240 GLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHT 299
           GLGV +VMNPWDV+LTR+YNQKG+ YKGPIDC+ KT++IEG+ ALYKGF AQ+FRIAPHT
Sbjct: 241 GLGVGIVMNPWDVVLTRVYNQKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHT 300

Query: 300 IMCLTFMEQTMKLVYSIESR 319
           I+CLTFMEQTMKLVY++ESR
Sbjct: 301 ILCLTFMEQTMKLVYAVESR 320

>Kwal_26.7653
          Length = 325

 Score =  488 bits (1257), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 224/316 (70%), Positives = 265/316 (83%)

Query: 4   DNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV 63
           D      + +K AAQK+SK GSF+AGG+AACIAVTVTNPIEL+K RMQLQGEMSA A ++
Sbjct: 6   DTKALAAEADKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI 65

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123
           YKNP+Q + VIFKNEGI+GLQKGL+ AYIYQIGLNGSRLGFYEPIRS LN+ F+P  +PH
Sbjct: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH 125

Query: 124 KVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK 183
           KVQ+V VNV               PLFL+KTR+QSYS  I+IG+QTHYT +WNGL +I++
Sbjct: 126 KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR 185

Query: 184 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGV 243
            EG KGL+RG+DAAILRTGAGSSVQLPIYNTAK+ L+K+DLMK+G  LHL AST+SG GV
Sbjct: 186 AEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGV 245

Query: 244 AVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCL 303
            VVMNPWDVILTR+YNQKG+LYKGP+DC VKTVRIEG+ ALYKGF AQ+FRIAPHTI+CL
Sbjct: 246 GVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCL 305

Query: 304 TFMEQTMKLVYSIESR 319
           TFMEQTMK+VY++E +
Sbjct: 306 TFMEQTMKVVYAVEKQ 321

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score =  469 bits (1208), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 215/313 (68%), Positives = 255/313 (81%)

Query: 7   KQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKN 66
           +++K  +KTAA K+SKFGSFVAGGLAACIAVTVTNP + +K RMQLQGE+ A+AAKVY N
Sbjct: 5   QEEKHNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTN 64

Query: 67  PIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ 126
           PIQ   VIFKNEGI GLQKGL +AY+YQI LNGSRLGFYEPIR  LN +F+P+ E HKVQ
Sbjct: 65  PIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQ 124

Query: 127 SVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG 186
            +G+NV               PLFLVKTR+QSYS  I IG+QTHYT  +NGL TIF++EG
Sbjct: 125 HIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEG 184

Query: 187 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVV 246
           +KGLFRG+DAA+LRTG GS+VQLPIYN  KN L+K+DLM DG  LHL +STI+G GV V 
Sbjct: 185 IKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVA 244

Query: 247 MNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
           MNPWDV+LTR+YNQKG+LY GPIDC +KTVR EG++ALYKGF AQ+ RI PHT++CLTFM
Sbjct: 245 MNPWDVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFM 304

Query: 307 EQTMKLVYSIESR 319
           EQT+KLVYS+ESR
Sbjct: 305 EQTLKLVYSVESR 317

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score =  273 bits (697), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 203/300 (67%), Gaps = 5/300 (1%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG 79
           +SK GSF A G AAC+AVT TNPIE +K R+QLQGE+ A  +++Y  P Q +++I++ EG
Sbjct: 9   VSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXX 139
           ++GLQ+GL  AY YQI LNGSRLG Y+P+R++L      D+  +   ++ VN        
Sbjct: 69  LRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAG 128

Query: 140 XXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199
                   PL LVKTR+Q+ +   ++       G    LV +FK  GV+GL++G+DAA+L
Sbjct: 129 MIGAALGSPLQLVKTRMQALAPR-RVPPLPGRMG--RRLVALFKDRGVRGLYQGVDAALL 185

Query: 200 RTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
           RTG GS+VQL +Y+ AK  L ++  + DG AL+  AS +S + V + MNP+DV +TR+Y+
Sbjct: 186 RTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYH 243

Query: 260 QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
            +G LY+GP+DCL KTVR EG +ALYKG  AQ+ RIAPHTI+CLT MEQ +++V  +E+R
Sbjct: 244 HRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENR 303

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score =  108 bits (269), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 141/290 (48%), Gaps = 21/290 (7%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
           +G F  GG+ AC+A   T+P++L K+R+Q     +A A K     ++  + I +NEG+ G
Sbjct: 14  YGGF--GGIVACVA---THPLDLAKVRLQ-----TAPAPK--PTLVRMASQILRNEGVPG 61

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXX 142
           L  GL AA + Q     +R G Y+ ++    + + P +    + S+   +          
Sbjct: 62  LYSGLTAAILRQCTYTTARFGVYDFVK----ERYIPKEY---LNSMLYLLPCSMFSGAVG 114

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG 202
                P  +V  R+Q+ S  +    + +Y    +GL  I   EGV  LF G    ++R  
Sbjct: 115 GLIGNPADVVNIRMQNDSS-LPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGI 173

Query: 203 AGSSVQLPIYNTAKNILVKN-DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK 261
             +S Q+  Y+ AKN LV+N  L KD  + H  +S ++GL    V +P DVI TR+ N  
Sbjct: 174 LMTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAH 233

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
              +   +  L+  V+ EG + +++G+     R+ P+TI+    +EQ  K
Sbjct: 234 KHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 97.4 bits (241), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 140/290 (48%), Gaps = 24/290 (8%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPI-QGMAVIFKNEGIKGLQKGL 87
           GG A   AV  T+P++L K+R+Q        AA + K  I Q +  I KNEGI GL  GL
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ--------AAPIPKPTIVQMLRSILKNEGIVGLYAGL 64

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP-DQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
           +A+ + Q     +R G Y+    +L +   P D+  +    +G ++              
Sbjct: 65  SASLLRQCTYTTARFGMYD----ALKEHVIPRDKLTNMWYLLGASMVSGALGGLAGNFAD 120

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF-RGIDAAILRTGAGS 205
               L+  R+Q+ S  + + ++ +Y    +G+V I+K EG K LF  G    ++R    +
Sbjct: 121 ----LINIRMQNDSA-LPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMT 175

Query: 206 SVQLPIYNTAKNILV-KNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN---QK 261
           + Q+  Y+  KN LV K ++     + HLT+S ++G     V +P DVI T + N   + 
Sbjct: 176 ASQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKP 235

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
           G  +      L++ +  EG + +++G+     R+AP T++    MEQ  K
Sbjct: 236 GHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKK 285

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 94.0 bits (232), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 139/287 (48%), Gaps = 22/287 (7%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPI-QGMAVIFKNEGIKGLQKGL 87
           GG A   A  VT+P++L K+R+Q        AA + K  + + +  I  NEG+ GL  GL
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQ--------AAPMPKPTLFRMLESILANEGVVGLYSGL 71

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP-DQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
           +AA + Q      R G Y+ ++ ++     P +Q  +    +  ++F             
Sbjct: 72  SAAVLRQCTYTTVRFGAYDLLKENV----IPREQLTNMAYLLPCSMFSGAIGGLAGNFAD 127

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG-VKGLFRGIDAAILRTGAGS 205
               +V  R+Q+ S  ++  ++ +Y    +G+  I++ EG +K LF G    ++R    +
Sbjct: 128 ----VVNIRMQNDSA-LEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMT 182

Query: 206 SVQLPIYNTAKNILV-KNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL 264
           + Q+  Y+  KN LV K D        HLTAS ++GL    V +P DV+ TRI N  GD 
Sbjct: 183 ASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGD- 241

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
           ++  +  L   VR EG + +++G+     R+ P T++    +EQ  K
Sbjct: 242 HQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKK 288

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 94.0 bits (232), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 126/283 (44%), Gaps = 28/283 (9%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F  G +A CI  TV  PI+L+K RMQ Q   S      YKN I   A IF  EGI+G+ 
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQ-----YKNSIDCFAKIFSREGIRGIY 575

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
            GL    I        +L   + +R  L        + H        +            
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRL-------MDKHANLKWYFEILSGACAGACQVV 628

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              PL +VK RLQ  SE+     ++  T +  G++   K  G+KGL++GI A ++R    
Sbjct: 629 FTNPLEVVKIRLQVRSEYAGDVLKSQVTAL--GVI---KQLGIKGLYKGIAACLMRDVPF 683

Query: 205 SSVQLPIYNTAKNILVKNDLMKDGPALH-------LTASTISGLGVAVVMNPWDVILTR- 256
           S++  P Y   K  + K D  KD    +       L A  ++G+  A +  P+DVI TR 
Sbjct: 684 SAIYFPTYAHLKKDVFKYD-PKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRL 742

Query: 257 -IYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
            I  +KG+  Y+G        ++ E   + +KG +A+V R +P
Sbjct: 743 QIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSP 785

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 86/197 (43%), Gaps = 16/197 (8%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A    V  TNP+E++KIR+Q++ E    A  V K+ +  + VI K  GIKGL KG
Sbjct: 617 LSGACAGACQVVFTNPLEVVKIRLQVRSEY---AGDVLKSQVTALGVI-KQLGIKGLYKG 672

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXX----XXX 142
           + A  +  +  +      Y P  + L +  F      K Q   +  +             
Sbjct: 673 IAACLMRDVPFSA----IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPA 728

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG 202
                P  ++KTRLQ      + GE T Y G+++   TI K E  K  F+G  A +LR+ 
Sbjct: 729 AYLTTPFDVIKTRLQIDP---RKGE-TRYEGIFHAARTILKEESFKSFFKGGSARVLRSS 784

Query: 203 AGSSVQLPIYNTAKNIL 219
                 L  Y   +N+ 
Sbjct: 785 PQFGFTLAAYEIFQNMF 801

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 69/159 (43%), Gaps = 19/159 (11%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+ LVKTR+Q+   F      + Y    +    IF  EG++G++ G+   ++      ++
Sbjct: 538 PIDLVKTRMQAQRSF------SQYKNSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAI 591

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGV----AVVMNPWDVILTRIY---NQ 260
           +L +     N  ++  LM     L      +SG        V  NP +V+  R+      
Sbjct: 592 KLTV-----NDYMRGRLMDKHANLKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEY 646

Query: 261 KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHT 299
            GD+ K  +  L   ++  G+  LYKG AA + R  P +
Sbjct: 647 AGDVLKSQVTAL-GVIKQLGIKGLYKGIAACLMRDVPFS 684

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVRIEGVTALYKGFAA 290
           + T  +I+G   A V+ P D++ TR+  Q+    YK  IDC  K    EG+  +Y G   
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 291 QVFRIAPHTIMCLT 304
           Q+  +AP   + LT
Sbjct: 581 QLIGVAPEKAIKLT 594

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 3/94 (3%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           +K    K+  +   VAGGLA   A  +T P ++IK R+Q+      +    Y+       
Sbjct: 705 DKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETR---YEGIFHAAR 761

Query: 73  VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYE 106
            I K E  K   KG +A  +      G  L  YE
Sbjct: 762 TILKEESFKSFFKGGSARVLRSSPQFGFTLAAYE 795

>Kwal_47.17321
          Length = 881

 Score = 90.9 bits (224), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 127/282 (45%), Gaps = 26/282 (9%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F+ G +A CI  T   PI+L+K RMQ Q   S      YKN I     IF  EGI+G+ 
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQ-----YKNSIDCFVKIFSREGIRGIY 557

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
            GL    +        +L   + +R  L        + +   ++ + +            
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLL-------MDENNRLTLPLEIISGAAAGACQVI 610

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              PL +VK RLQ  SE+     ++  T +  G+V   K+ G++GL++G+ A ++R    
Sbjct: 611 FTNPLEIVKIRLQVRSEYADSLPKSQLTAL--GVV---KSLGLRGLYKGLVACLMRDVPF 665

Query: 205 SSVQLPIYNTAKNILVKNDLMKDG--PALH----LTASTISGLGVAVVMNPWDVILTR-- 256
           S++  P Y   K  +   D         LH    LTA  ++G+  A +  P+DVI TR  
Sbjct: 666 SAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQ 725

Query: 257 IYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
           I  +KG+  Y G +      ++ E   + +KG  A+V R +P
Sbjct: 726 IDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSP 767

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 88/197 (44%), Gaps = 16/197 (8%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A    V  TNP+E++KIR+Q++ E + S  K   + +  + V+ K+ G++GL KG
Sbjct: 599 ISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPK---SQLTALGVV-KSLGLRGLYKG 654

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXX----XXX 142
           L A  +  +  +      Y P  + L +  F      K +   ++ +             
Sbjct: 655 LVACLMRDVPFSA----IYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPA 710

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG 202
                P  ++KTRLQ      + GE T YTG+ +   TI K E  K  F+G  A +LR+ 
Sbjct: 711 AYLTTPFDVIKTRLQIDP---RKGE-TRYTGILHAARTILKEERFKSFFKGGGARVLRSS 766

Query: 203 AGSSVQLPIYNTAKNIL 219
                 L  Y   +N+ 
Sbjct: 767 PQFGFTLAAYEIFQNMF 783

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 237 TISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
           +++G   A  + P D++ TR+  Q+    YK  IDC VK    EG+  +Y G   Q+  +
Sbjct: 508 SVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQLVGV 567

Query: 296 APHTIMCLTFMEQTMKLVYSIESR 319
           AP   + LT  +   KL+    +R
Sbjct: 568 APEKAIKLTVNDYVRKLLMDENNR 591

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 45/119 (37%), Gaps = 8/119 (6%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           +K    ++  +    AGGLA   A  +T P ++IK R+Q+      +    Y   +    
Sbjct: 687 DKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETR---YTGILHAAR 743

Query: 73  VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN 131
            I K E  K   KG  A  +      G  L  YE     + Q  FP Q     +S   N
Sbjct: 744 TILKEERFKSFFKGGGARVLRSSPQFGFTLAAYE-----IFQNMFPLQHSENNESRETN 797

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 89.4 bits (220), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 124/285 (43%), Gaps = 31/285 (10%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F  G +A CI  T+  PI+ +K RMQ Q  +S      YKN I     I   EGI+G+ 
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQ-----YKNSIDCFLKILSREGIRGVY 600

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGV--NVFXXXXXXXXX 142
            GL    I        +L   + +R+ L           K   +G+   +          
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKLKD---------KNGKLGLLSEIISGASAGACQ 651

Query: 143 XXXXXPLFLVKTRLQSYSEFI-KIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
                PL +VK RLQ   E++ +  E    T      + I K  G+ GL++G  A +LR 
Sbjct: 652 VIFTNPLEIVKIRLQVKGEYVAENAENAKLTA-----LQIIKRLGLPGLYKGAAACLLRD 706

Query: 202 GAGSSVQLPIYNTAKNILV------KNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT 255
              S++  P Y   K  L       KN   +      L+A  ++G+  A +  P+DVI T
Sbjct: 707 VPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKT 766

Query: 256 R--IYNQKGD-LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
           R  I  +KG+ +YKG I      +R E   + +KG AA+V R +P
Sbjct: 767 RLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

 Score = 60.1 bits (144), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 86/205 (41%), Gaps = 15/205 (7%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           K+      ++G  A    V  TNP+E++KIR+Q++GE  A  A+  K  +  + +I K  
Sbjct: 634 KLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAK--LTALQII-KRL 690

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXX 138
           G+ GL KG  A  +  +  +      Y P  + L +  F      K +   +N +     
Sbjct: 691 GLPGLYKGAAACLLRDVPFS----AIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSA 746

Query: 139 XXX----XXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        P  ++KTRLQ      K GE T Y G+ +   TI + E  K  F+G 
Sbjct: 747 GALAGMPAAYLTTPFDVIKTRLQIDP---KKGE-TIYKGIIHAARTILREESFKSFFKGG 802

Query: 195 DAAILRTGAGSSVQLPIYNTAKNIL 219
            A +LR+       L  Y    NI 
Sbjct: 803 AARVLRSSPQFGFTLAAYELFHNIF 827

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVRIEGVTALYKGFAA 290
           + +  +++G   A ++ P D + TR+  Q+    YK  IDC +K +  EG+  +Y G   
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGP 605

Query: 291 QVFRIAPHTIMCLT---FMEQTMK 311
           Q+  +AP   + LT   +M   +K
Sbjct: 606 QLIGVAPEKAIKLTVNDYMRNKLK 629

 Score = 36.6 bits (83), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           +K    +++ +    AG LA   A  +T P ++IK R+Q+  +   +   +YK  I    
Sbjct: 731 DKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGET---IYKGIIHAAR 787

Query: 73  VIFKNEGIKGLQKG 86
            I + E  K   KG
Sbjct: 788 TILREESFKSFFKG 801

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 122/283 (43%), Gaps = 25/283 (8%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F  G +A CI  TV  PI+ IK RMQ Q  ++      YKN I  +  I   EGIKGL 
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQ-----YKNSIDCLLKIISREGIKGLY 587

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
            GL    I        +L   + +R+ L        + +   S+   +            
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRL-------TDKNGKLSLFPEIISGASAGACQVI 640

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              PL +VK RLQ  S++  +GE             I K  G++GL+ G+ A ++R    
Sbjct: 641 FTNPLEIVKIRLQVQSDY--VGENIQQAN--ETATQIVKKLGLRGLYNGVAACLMRDVPF 696

Query: 205 SSVQLPIYNTAKNILVK---NDLMKDGPALH---LTASTISGLGVAVVMNPWDVILTR-- 256
           S++  P Y   K  L     ND  K         LTA  I+G+  A +  P+DVI TR  
Sbjct: 697 SAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQ 756

Query: 257 IYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
           I  +KG+  Y G    +   ++ E   + +KG  A+V R +P 
Sbjct: 757 IDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQ 799

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 15/202 (7%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           K+S F   ++G  A    V  TNP+E++KIR+Q+Q +      +  +   +    I K  
Sbjct: 621 KLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDY---VGENIQQANETATQIVKKL 677

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXX 138
           G++GL  G+ A  +  +  +      Y P  + L +  F      K +   +  +     
Sbjct: 678 GLRGLYNGVAACLMRDVPFS----AIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTA 733

Query: 139 XXX----XXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        P  ++KTRLQ      + GE T Y G+++ + TI K E  +  F+G 
Sbjct: 734 GAIAGMPAAFLTTPFDVIKTRLQIDP---RKGE-TKYNGIFHAIRTILKEESFRSFFKGG 789

Query: 195 DAAILRTGAGSSVQLPIYNTAK 216
            A +LR+       L  Y   K
Sbjct: 790 GARVLRSSPQFGFTLAAYELFK 811

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVRIEGVTALYKGFAA 290
           + +  +I+G   A V+ P D I TR+  Q+    YK  IDCL+K +  EG+  LY G   
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 291 QVFRIAPHTIMCLT 304
           Q+  +AP   + LT
Sbjct: 593 QLIGVAPEKAIKLT 606

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 3/74 (4%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           +KT   ++  +    AG +A   A  +T P ++IK R+Q+      +    Y      + 
Sbjct: 718 DKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETK---YNGIFHAIR 774

Query: 73  VIFKNEGIKGLQKG 86
            I K E  +   KG
Sbjct: 775 TILKEESFRSFFKG 788

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 126/287 (43%), Gaps = 36/287 (12%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F  G +A CI   V  PI+++K RMQ Q + S      YKN I  +  I   EG++GL 
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSK-----YKNSIDCLLKILSKEGVRGLY 581

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSL----NQLFFPDQEPHKVQSVGVNVFXXXXXXX 140
            GL    I        +L   + +R++L     +L  P             +        
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDGKLSLP-----------CEIISGATAGA 630

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
                  PL +VK RLQ  S+++    +     +     ++ K  G+ GL+RG  A +LR
Sbjct: 631 CQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAI-----SVIKNLGLIGLYRGAGACLLR 685

Query: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDGPALH-------LTASTISGLGVAVVMNPWDVI 253
               S++  P Y   K+ +   D  KD    +       L +  ++G+  A +  P+DVI
Sbjct: 686 DIPFSAIYFPTYAHIKSNVFNFD-PKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVI 744

Query: 254 LTR--IYNQKGD-LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
            TR  I  +KG+ +Y G  D     ++ EG+ + +KG  A+V R +P
Sbjct: 745 KTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSP 791

 Score = 76.6 bits (187), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 90/201 (44%), Gaps = 8/201 (3%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           K+S     ++G  A    V  TNP+E++KIR+Q++ +  A AA+   N +  ++VI KN 
Sbjct: 615 KLSLPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAAR---NSVNAISVI-KNL 670

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXX 138
           G+ GL +G  A  +  I  +      Y  I+S++      D +     +    +      
Sbjct: 671 GLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLA 730

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAI 198
                    P  ++KTRLQ      K GE   Y G+W+   TI K EG+K  F+G  A +
Sbjct: 731 GMPAAFLTTPFDVIKTRLQIDP---KKGESV-YNGIWDAARTILKEEGIKSFFKGGPARV 786

Query: 199 LRTGAGSSVQLPIYNTAKNIL 219
           LR+       L  Y    N+ 
Sbjct: 787 LRSSPQFGFTLAAYEIFHNLF 807

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVRIEGVTALYKGFAA 290
           + T  +++G   A+V+ P D++ TR+  Q+    YK  IDCL+K +  EGV  LY G   
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 291 QVFRIAPHTIMCLT 304
           Q+  +AP   + LT
Sbjct: 587 QLIGVAPEKAIKLT 600

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 52/134 (38%), Gaps = 31/134 (23%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
            K++ +   V+GGLA   A  +T P ++IK R+Q+  +   S   VY         I K 
Sbjct: 716 NKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGES---VYNGIWDAARTILKE 772

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYE------------------PIRSSLNQL---- 115
           EGIK   KG  A  +      G  L  YE                  P R  +  L    
Sbjct: 773 EGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHRPTREPVGALAPIN 832

Query: 116 -----FFPDQ-EPH 123
                FFPDQ EPH
Sbjct: 833 KTVSAFFPDQLEPH 846

>Scas_602.8
          Length = 885

 Score = 87.4 bits (215), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 128/286 (44%), Gaps = 31/286 (10%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F  G +A CI  T+  PI+ IK RMQ Q  ++      YKN I  +  IF  EGI+GL 
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTK-----YKNSIDCLVKIFGKEGIRGLY 555

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
            GL    I        +L   + +R SL      D++ +    +G  V            
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSL-----VDKKGN--LQLGAEVLSGATAGACQVV 608

Query: 145 XXXPLFLVKTRLQSYSEFIK-IGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
              PL +VK RLQ  SE+   +  ++  T        I K   + GL++G+ A +LR   
Sbjct: 609 FTNPLEIVKIRLQVKSEYTNAMIPKSQLTA-----FQIIKELKLIGLYKGVGACLLRDVP 663

Query: 204 GSSVQLPIY-NTAKNILV-------KNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT 255
            S++  P Y +  KN+         K D +K      LTA  ++G+  A +  P+DVI T
Sbjct: 664 FSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWEL--LTAGALAGVPAAFLTTPFDVIKT 721

Query: 256 RIYNQKG---DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
           R+  + G     Y G +  +   ++ E   + +KG AA+V R +P 
Sbjct: 722 RLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQ 767

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 9/194 (4%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A    V  TNP+E++KIR+Q++ E +   A + K+ +    +I K   + GL KG
Sbjct: 597 LSGATAGACQVVFTNPLEIVKIRLQVKSEYTN--AMIPKSQLTAFQII-KELKLIGLYKG 653

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
           + A  +  +  +      Y  ++ ++ Q    D++          +              
Sbjct: 654 VGACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLT 713

Query: 147 XPLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
            P  ++KTRLQ     I+ G  +T YTG+ + + TI K E  +  F+G  A ++R+    
Sbjct: 714 TPFDVIKTRLQ-----IEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQF 768

Query: 206 SVQLPIYNTAKNIL 219
              L  Y   KN+ 
Sbjct: 769 GFTLAAYELFKNMF 782

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQKG-DLYKGPIDCLVKTVRIEGVTALYKGFA 289
            + +  +++G   A ++ P D I TR+  Q+    YK  IDCLVK    EG+  LY G  
Sbjct: 500 FNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLG 559

Query: 290 AQVFRIAPHTIMCLT---FMEQTM 310
            Q+  +AP   + LT   FM +++
Sbjct: 560 PQLIGVAPEKAIKLTVNDFMRKSL 583

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 5/112 (4%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           +K    ++  +    AG LA   A  +T P ++IK R+Q++  +  +    Y   +  + 
Sbjct: 686 DKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGETR---YTGILHAVR 742

Query: 73  VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK 124
            I K E  +   KG  A  +      G  L  YE  ++  N     D++P K
Sbjct: 743 TILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFN--ISDDKQPTK 792

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 85.1 bits (209), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 118/279 (42%), Gaps = 9/279 (3%)

Query: 21  SKFG-SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVIFKN 77
           S FG  F+ GG++A IA T   PIE +K+ MQ Q EM    S    YK  +        +
Sbjct: 11  SHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATH 70

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EGI    +G  A  +           F + I+S L+   +  +     +    N+F    
Sbjct: 71  EGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLS---YDRERDGYAKWFAGNLFSGGA 127

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                      L   +TRL + +   K   Q  + G+ +      KT+G+ GL+RG   +
Sbjct: 128 AGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPS 187

Query: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           +L       +   +Y++ K +L+   L     A  L    I+ +G +    P D +  R+
Sbjct: 188 VLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVIT-MGASTASYPLDTVRRRM 246

Query: 258 YNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
               G    Y G +DCL K V+ EG  +L+KG  A +FR
Sbjct: 247 MMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 70/161 (43%), Gaps = 15/161 (9%)

Query: 148 PLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+  VK  +Q+  E +K G   T Y G+ +        EG+   +RG  A +LR     +
Sbjct: 33  PIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQA 92

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVA-----VVMNPWDVILTRIY-NQ 260
           +     +  K++L   D  +DG A     +  SG G A     + +   D   TR+  + 
Sbjct: 93  LNFAFKDKIKSLL-SYDRERDGYAKWFAGNLFSG-GAAGGLSLLFVYSLDYARTRLAADA 150

Query: 261 KGD------LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
           +G        + G +D   KT++ +G+  LY+GF   V  I
Sbjct: 151 RGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGI 191

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           YKG +DC  +T   EG+ + ++G  A V R  P   +   F ++   L+
Sbjct: 57  YKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLL 105

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 80/209 (38%), Gaps = 38/209 (18%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAK--------VYKNPIQGMAVIF 75
           G+  +GG A  +++     ++  + R+      S S ++        VYK  +       
Sbjct: 120 GNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTL------- 172

Query: 76  KNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGV 130
           K +G+ GL +G   + +  I   G   G Y+  +      +L   F        V ++G 
Sbjct: 173 KTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGA 232

Query: 131 NVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGL 190
           +                PL  V+ R+   S     G+   Y G  + L  I + EG   L
Sbjct: 233 ST------------ASYPLDTVRRRMMMTS-----GQTIKYDGALDCLRKIVQKEGAYSL 275

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           F+G  A I R  A + V + +Y+  + I+
Sbjct: 276 FKGCGANIFRGVAAAGV-ISLYDQLQLIM 303

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/299 (29%), Positives = 129/299 (43%), Gaps = 60/299 (20%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F  G +A CI  TV  PI+L+K RMQ Q       +  YKN I  +  IF+ +GI+GL 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRN-----SVQYKNSIDCVVKIFQTKGIRGLY 561

Query: 85  KGLNAA----------------YIYQIGLNGSR-LGFYEPIRSSLNQLFFPDQEPHKVQS 127
            GL                   ++ Q  +N SR + +Y+ I S               Q 
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEILSGAT--------AGACQV 613

Query: 128 VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGV 187
           V  N                PL +VK RLQ  S+++  GE         G V I +  G+
Sbjct: 614 VFTN----------------PLEIVKIRLQMRSDYV--GENARPQL---GAVGIIRQLGL 652

Query: 188 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNILV------KNDLMKDGPALHLTASTISGL 241
           +GL++G  A +LR    S++  P Y   K  +       KN   K      L A  I+G+
Sbjct: 653 RGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGM 712

Query: 242 GVAVVMNPWDVILTR--IYNQKGD-LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
             A +  P+DVI TR  I  +KG+  Y G I      ++ E + + +KG  A+V R +P
Sbjct: 713 PAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSP 771

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 81/193 (41%), Gaps = 8/193 (4%)

Query: 10  KQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQ 69
           +Q     ++ I  +   ++G  A    V  TNP+E++KIR+Q++ +     A+    P  
Sbjct: 586 RQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENAR----PQL 641

Query: 70  GMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVG 129
           G   I +  G++GL KG  A  +  +  +      Y  ++  +      D+         
Sbjct: 642 GAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTW 701

Query: 130 VNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189
             +               P  ++KTRLQ      + GE T YTGV +   TI K E +K 
Sbjct: 702 ELLLAGGIAGMPAAYLTTPFDVIKTRLQIDP---RKGETT-YTGVIHAARTILKEESIKS 757

Query: 190 LFRGIDAAILRTG 202
            F+G  A +LR+ 
Sbjct: 758 FFKGGPARVLRSS 770

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFAA 290
           + T  +I+G   A V+ P D++ TR+  Q+  + YK  IDC+VK  + +G+  LY G   
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 291 QVFRIAPHTIMCLT---FMEQ 308
           Q+  +AP   + LT   FM Q
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQ 587

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 21/178 (11%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+ LVKTR+Q+    ++      Y    + +V IF+T+G++GL+ G+   ++      ++
Sbjct: 524 PIDLVKTRMQAQRNSVQ------YKNSIDCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAI 577

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVA----VVMNPWDVILTRIYNQKGD 263
           +L +     N  ++   M     +      +SG        V  NP +++  R+  Q   
Sbjct: 578 KLTV-----NDFMRQYFMNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRL--QMRS 630

Query: 264 LYKG----PIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIE 317
            Y G    P    V  +R  G+  LYKG AA + R  P + +         K V++ +
Sbjct: 631 DYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFD 688

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 82.4 bits (202), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 120/277 (43%), Gaps = 17/277 (6%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVIFKNEGIKGL 83
           F+ GG++A +A T  +PIE +K+ +Q Q EM    S    YK  +       + EGI   
Sbjct: 15  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISF 74

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
            +G  A  I           F + I++      F  +E +     G N+           
Sbjct: 75  WRGNTANVIRYFPTQALNFAFKDQIKAMFG---FKKEEGYAKWFAG-NLASGGIAGGLSL 130

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK----TEGVKGLFRGIDAAIL 199
                L   +TRL + ++  K G +  +    NGLV ++K    ++GV GL+RG   +++
Sbjct: 131 MFVYSLDYARTRLAADAKSSKKGGERQF----NGLVDVYKKTIASDGVAGLYRGFLPSVI 186

Query: 200 RTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
                  +   +Y++ K +L+   L     A  L    ++  G +    P D +  R+  
Sbjct: 187 GIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVT-TGASTASYPLDTVRRRMMM 245

Query: 260 QKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
             G    YKG +DCL K V  EGV++L+KG  A + R
Sbjct: 246 TSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 84/205 (40%), Gaps = 30/205 (14%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK----NEG 79
           G+  +GG+A  +++     ++  + R+    +   S+ K  +    G+  ++K    ++G
Sbjct: 117 GNLASGGIAGGLSLMFVYSLDYARTRLAADAK---SSKKGGERQFNGLVDVYKKTIASDG 173

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFX 134
           + GL +G   + I  +   G   G Y+  +      SL   F        V + G +   
Sbjct: 174 VAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIASFLLGWVVTTGAST-- 231

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        PL  V+ R+   S     G+   Y G  + L  I   EGV  LF+G 
Sbjct: 232 ----------ASYPLDTVRRRMMMTS-----GQAVKYKGAMDCLQKIVAAEGVSSLFKGC 276

Query: 195 DAAILRTGAGSSVQLPIYNTAKNIL 219
            A ILR  AG+ V + +Y+  + IL
Sbjct: 277 GANILRGVAGAGV-ISLYDQLQMIL 300

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           YKG +DC  +T R EG+ + ++G  A V R  P   +   F +Q
Sbjct: 55  YKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQ 98

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 69/161 (42%), Gaps = 10/161 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTH-YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+  VK  +Q+  E IK G   H Y G+ +      + EG+   +RG  A ++R     +
Sbjct: 31  PIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQA 90

Query: 207 VQLPIYNTAKNIL--VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-----YN 259
           +     +  K +    K +      A +L +  I+G    + +   D   TR+      +
Sbjct: 91  LNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSS 150

Query: 260 QKGD--LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
           +KG    + G +D   KT+  +GV  LY+GF   V  I  +
Sbjct: 151 KKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVY 191

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 129/310 (41%), Gaps = 33/310 (10%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQG-MAVIFKNEGIKGL 83
           +F+AGGLA  ++ TV +P E +KI +Q+Q   +A     Y   I G +  +++ EG  GL
Sbjct: 25  AFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTA-----YNQGIVGAVRQVYREEGTPGL 79

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGV-NVFXXXX 137
            +G         GLN  R+  Y  ++     +     F  D    + Q      +F    
Sbjct: 80  FRG--------NGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGAL 131

Query: 138 XXXXXXXXXXPLFLVKTRLQ-SYSEFIKIGEQTHYT-----GVWNGLVTIFKTEG-VKGL 190
                     PL LV+TRL    +   K+ +   +      GVW+ L   +K EG +KGL
Sbjct: 132 CGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGL 191

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPW 250
           +RG+    L      ++   +Y   K  + +           L+   +SG     V  P+
Sbjct: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPF 251

Query: 251 DVILTRIY------NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLT 304
           D++  R        N+ G  YK  +D L+   + EG    YKG  A +F++ P T +   
Sbjct: 252 DLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWL 311

Query: 305 FMEQTMKLVY 314
             E    L++
Sbjct: 312 VYEVVCDLMH 321

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/97 (19%), Positives = 43/97 (44%), Gaps = 2/97 (2%)

Query: 223 DLMKDGPALHLTASTISGLGVAVVMNPWDV--ILTRIYNQKGDLYKGPIDCLVKTVRIEG 280
            ++K+   +   A  ++G     V++P++   IL ++ N      +G +  + +  R EG
Sbjct: 16  SILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEG 75

Query: 281 VTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIE 317
              L++G      RI P++ +     E   K  + ++
Sbjct: 76  TPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVD 112

>Scas_702.10
          Length = 302

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 134/290 (46%), Gaps = 27/290 (9%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQG--MAVIFKNEGIKGLQKG 86
           GG A   A  +T+P++L K+R+Q        AA + K P  G  +  I +NE + GL  G
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQ--------AAPLPK-PTLGRMLTTILRNENVMGLYSG 66

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK-VQSVGVNVFXXXXXXXXXXXX 145
           L+AA + Q      R G Y+ ++ +L     P    +  V  +  ++F            
Sbjct: 67  LSAAVLRQCTYTTVRFGAYDLMKENL----IPQGHINDMVYLLPCSMFSGAIGGLVGNFA 122

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG-VKGLFRGIDAAILRTGAG 204
                +V  R+Q+ S  +K   + +Y    +G+  I+  EG +K L  G    ++R    
Sbjct: 123 D----VVNIRMQNDSA-LKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLM 177

Query: 205 SSVQLPIYNTAKNILVKN---DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK 261
           ++ Q+  Y+  KN LV     D  K+  + HL+AS ++GL    + +P DVI TRI N  
Sbjct: 178 TASQVVTYDVFKNYLVTKLSFDPKKN--STHLSASLLAGLVATTICSPADVIKTRIMNAH 235

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
               +  I  L   ++ EG + +++G+     R+ P T++    +EQ  K
Sbjct: 236 KTESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKK 285

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 112/290 (38%), Gaps = 15/290 (5%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP--IQGMAVIFKNEGIKG 82
           + +AGG A        +P++ IK+RMQ+      SA +  K P  I+    I+  EG+  
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQI---YRRSALEGIKPPGFIKTGRNIYTEEGLLA 69

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXX 142
           L KGL A  I  I     R   YE  RS+L      D++   V +    +          
Sbjct: 70  LYKGLGAVVIGIIPKMAIRFSSYEFYRSAL-----ADKQTGSVSTGNTFLAGVGAGTTEA 124

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG 202
                P+ +VK RLQ+     +      Y         I K EG+  L+RG+     R  
Sbjct: 125 VLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQA 184

Query: 203 AGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA-STISGLGVAVVMNPWDVILTRIYNQK 261
                   +Y+  K  L ++      P+   +    ISG        P D I TR+   K
Sbjct: 185 TNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDK 244

Query: 262 GDLYKGPIDCLV----KTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
                     +V    + ++ EG  ALYKG   +V R+AP   +  T  E
Sbjct: 245 STANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 294

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 229 PALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG-PIDCLVKTVR----IEGVTA 283
           PA++L A   +GL  A+  +P D I  R+   +    +G      +KT R     EG+ A
Sbjct: 10  PAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLA 69

Query: 284 LYKGFAAQVFRIAP 297
           LYKG  A V  I P
Sbjct: 70  LYKGLGAVVIGIIP 83

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 77.8 bits (190), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 125/298 (41%), Gaps = 25/298 (8%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQG-EMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           ++G L+  ++  +  P ++ K R+Q QG +     ++ YK      A IFK+EG  GL K
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           GL    +  I         Y+  R     +F     PH       N              
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSVDIF-----PH--SPFLSNASSAITAGAISTVA 155

Query: 146 XXPLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
             P+++VKTRL   +    IG+  THY G  +    I + EG K L+ G+  A+L     
Sbjct: 156 TNPIWVVKTRLMLQT---GIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGM-LN 211

Query: 205 SSVQLPIYNTAK-------NILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
            ++Q P+Y   K       +  V  D+        + AS +S +  + V  P +++ TR+
Sbjct: 212 VAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRM 271

Query: 258 YNQKGDL---YKGPIDCLVK-TVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
              K DL    +  +  L+K T R EG    Y GFA  + R  P  ++ L   E + K
Sbjct: 272 -QLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKK 328

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 10/104 (9%)

Query: 222 NDLMKDG-PALHLTASTISGLGVAVVMNPWDVILTRIYNQ-------KGDLYKGPIDCLV 273
           N L K+  P +   +  +SG   A+++ P+DV  TR+  Q       +   YKG      
Sbjct: 30  NRLKKNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFA 89

Query: 274 KTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIE 317
              + EG   LYKG    V    P  ++  +  +   K  YS++
Sbjct: 90  TIFKDEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRK--YSVD 131

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 131/311 (42%), Gaps = 46/311 (14%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F+AGG+A  ++ TV +P E +KI +Q+Q   ++    ++ +  Q    ++  EG KGL 
Sbjct: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQ----VYHEEGTKGLF 80

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGV-NVFXXXXX 138
           +G         GLN  R+  Y  ++     +   +LF  +    + Q      +F     
Sbjct: 81  RG--------NGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALC 132

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFI------KIGEQTHYTGVWNGLVTIFKTEG-VKGLF 191
                    PL L+KTRL   +  +      K    +   G+W  L   ++ EG ++GL+
Sbjct: 133 GGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLY 192

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNILV---------KNDLMKDGPALHLTASTISGLG 242
           RG+    L      ++   +Y   +   V         K++L K      LT   ISG  
Sbjct: 193 RGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYK------LTIGAISGGV 246

Query: 243 VAVVMNPWDVILTRIY------NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
              +  P+D++  R        N+ G  Y    D LV   R EGV+  YKG AA +F++ 
Sbjct: 247 AQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVV 306

Query: 297 PHTIMCLTFME 307
           P T +     E
Sbjct: 307 PSTAVSWLVYE 317

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/96 (18%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 223 DLMKDGPALHLTASTISGLGVAVVMNPWDV--ILTRIYNQKGDLYKGPIDCLVKTVRIEG 280
           D +K    +   A  ++G     V++P++   IL ++ +      +G    + +    EG
Sbjct: 16  DFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEG 75

Query: 281 VTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
              L++G      RI P++ +     E   K ++ +
Sbjct: 76  TKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHV 111

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 77.4 bits (189), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 129/292 (44%), Gaps = 23/292 (7%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVY-KNPIQGMAVIFKNEGIKGLQK 85
           ++G LA  ++  V  P+++ K R+Q QG  + +   +Y +  I  M  I ++EG++GL K
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           GL    +            YE  + +L       +      S   + F            
Sbjct: 133 GLVPIIMGYFPTWMIYFSVYEFCKDNL-------RTNSSNWSFVSHSFSAITAGAVSTVV 185

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQT-HYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
             P+++VKTRL   +    IG  T HY G ++    I   EGVK L+ G+  ++L     
Sbjct: 186 TNPIWVVKTRLMLQTH---IGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGL-LH 241

Query: 205 SSVQLPIYNTAKNIL--VKNDLMKDGPALHLT----ASTISGLGVAVVMNPWDVILTRIY 258
            ++  P+Y   K      + D   +   ++L     AS++S +  +V+  P +++ TR+ 
Sbjct: 242 VAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRL- 300

Query: 259 NQKGDL--YKGPIDCLVKTVRI-EGVTALYKGFAAQVFRIAPHTIMCLTFME 307
             K DL  ++  +  L+K   I EG+   Y GF   +FR  P + + L   E
Sbjct: 301 QLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

>Scas_667.4
          Length = 308

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 117/287 (40%), Gaps = 10/287 (3%)

Query: 13  EKTAAQKISKFG-SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQ 69
            K   +K S F   F+ GG++A +A T  +PIE +K+ +Q Q EM    S    YK  I+
Sbjct: 3   SKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIE 62

Query: 70  GMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVG 129
                 K EGI    +G  A  I           F + I++      F  +E +     G
Sbjct: 63  CFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYGKWFAG 119

Query: 130 VNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189
            N+                L   +TRL + ++  K G    Y G+ +       T+G+ G
Sbjct: 120 -NLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAG 178

Query: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNP 249
           L+RG   +++       +   +Y++ K  ++   L     A  L    ++  G +    P
Sbjct: 179 LYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVT-TGASTASYP 237

Query: 250 WDVILTRIYNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
            D +  R+    G    Y G  DC  K V  EGV++L+KG  A + R
Sbjct: 238 LDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILR 284

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 80/202 (39%), Gaps = 24/202 (11%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA-SAAKVYKNPIQGMAVIFKNEGIKG 82
           G+  +GG A  +++     ++  + R+    + S    ++ YK  I         +G+ G
Sbjct: 119 GNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAG 178

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           L +G   + +  I   G   G Y+ ++      SL   F        + + G +      
Sbjct: 179 LYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFLLGWIVTTGAST----- 233

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     PL  V+ R+   S     G+   Y G ++    +   EGV  LF+G  A 
Sbjct: 234 -------ASYPLDTVRRRMMMTS-----GQAVKYDGAFDCFRKVVAAEGVSSLFKGCGAN 281

Query: 198 ILRTGAGSSVQLPIYNTAKNIL 219
           ILR  AG+ V + +Y+  + I+
Sbjct: 282 ILRGVAGAGV-ISMYDQLQMIM 302

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           YKG I+C  +T + EG+ A ++G  A V R  P   +   F ++
Sbjct: 57  YKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDK 100

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 74/186 (39%), Gaps = 10/186 (5%)

Query: 120 QEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGL 178
           +E  K  +  ++                P+  VK  +Q+  E IK G   + Y G+    
Sbjct: 5   EEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECF 64

Query: 179 VTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL--VKNDLMKDGPALHLTAS 236
               KTEG+   +RG  A ++R     ++     +  K +    K +      A +L + 
Sbjct: 65  QRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASG 124

Query: 237 TISGLGVAVVMNPWDVILTRI-----YNQKGD--LYKGPIDCLVKTVRIEGVTALYKGFA 289
             +G    + +   D   TR+      ++KG    YKG ID   +T+  +G+  LY+GF 
Sbjct: 125 GAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFL 184

Query: 290 AQVFRI 295
             V  I
Sbjct: 185 PSVVGI 190

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 125/294 (42%), Gaps = 22/294 (7%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           V+G LA  ++  +  P+++ K R+Q QG  + S  + Y+  +  ++ I ++EG+ GL KG
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQG--AGSGERYYRGIVGTLSAILRDEGVAGLYKG 146

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
           L    +            YE  +       +P   P    S   +               
Sbjct: 147 LAPIVLGYFPTWMLYFSVYEKCKQR-----YPSYLPGGFVSHAASALTAGAISTALTN-- 199

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
            P+++VKTRL   S+  +  + T+Y    +    ++++EG+K  + G+  ++       +
Sbjct: 200 -PIWVVKTRLMIQSDVSR--DSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL-FHVA 255

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALH---------LTASTISGLGVAVVMNPWDVILTRI 257
           +  P+Y   K  L +N    DG  L          + AS +S +  +V+  P +++ TR+
Sbjct: 256 IHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM 315

Query: 258 YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
             +   +    ++ L +    EG    Y GFA  + R  P +++ L   E   K
Sbjct: 316 QVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFEYFRK 369

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 121/291 (41%), Gaps = 24/291 (8%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA-----KVYKNPIQGMAVIFKNEGI 80
           F++G +A    +TV  P++++K R QL+     +AA     + Y   I  +  I K EG 
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 81  KGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXX 140
             L +G+++  + +     ++    +  +     LF  ++   K+     ++        
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI-----SIAAGASAGM 130

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
                  P  L+K R+Q          ++ Y G  + L    K EG+ GL++GI++ + R
Sbjct: 131 TEAAVIVPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWR 182

Query: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQ 260
               +     +    +N +             L A  I G    ++  P+DV+ +RI + 
Sbjct: 183 NALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSV 242

Query: 261 KG-----DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP-HTIMCLTF 305
                    Y   +  L+   R EG  ALYKGF  +V R+AP  ++M + F
Sbjct: 243 DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 78/195 (40%), Gaps = 15/195 (7%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S  AG  A      V  P ELIKIRMQ   ++ +S    Y  P+  +    KNEGI GL 
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQ---DVKSS----YLGPMDCLKKTIKNEGIMGLY 173

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           KG+ +        NG   G    +R+S+           K Q    ++            
Sbjct: 174 KGIESTMWRNALWNGGYFGVIYQVRNSM------PVAKTKGQKTRNDLIAGAIGGTVGTM 227

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P  +VK+R+QS        ++  Y      L+ I++ EG + L++G    + R   G
Sbjct: 228 LNTPFDVVKSRIQSVDAVSSAVKK--YNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPG 285

Query: 205 SSVQLPIYNTAKNIL 219
            S+ L ++    N  
Sbjct: 286 GSLMLVVFTGMMNFF 300

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRI-----------YNQKGDLYKGPIDCLVKTVRIEG 280
              +  ++G+    VM P DV+ TR              ++ + Y G IDCL K V+ EG
Sbjct: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74

Query: 281 VTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
            + LY+G ++ +   AP         +Q  K+
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 124/302 (41%), Gaps = 27/302 (8%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SA 58
           MSSD  +Q+               +F+ GG++A IA T  +PIE +KI +Q Q EM    
Sbjct: 1   MSSDAKQQETNFAI----------NFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQG 50

Query: 59  SAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP 118
           +  K Y   +       K EG+    +G  A  I           F + I+       F 
Sbjct: 51  TLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFG---FK 107

Query: 119 DQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGL 178
            +E +     G N+                L   +TRL + ++  K G    + G+ +  
Sbjct: 108 KEEGYGKWFAG-NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVY 166

Query: 179 VTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTI 238
               K++G+ GL+RG   +++       +   ++++ K +++   L  DG  L   AS +
Sbjct: 167 KKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSL--DGSFL---ASFL 221

Query: 239 SGL----GVAVVMNPWDVILTRIYNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQV 292
            G     G +    P D +  R+    G    Y G IDCL K V  EGV +L+KG  A +
Sbjct: 222 LGWVVTTGASTCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANI 281

Query: 293 FR 294
            R
Sbjct: 282 LR 283

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 83/202 (41%), Gaps = 24/202 (11%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA-SAAKVYKNPIQGMAVIFKNEGIKG 82
           G+  +GG A  +++     ++  + R+    + S    A+ +           K++GI G
Sbjct: 118 GNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAG 177

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           L +G   + +  +   G   G ++ ++      SL+  F        V + G +      
Sbjct: 178 LYRGFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGAST----- 232

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     PL  V+ R+   S     G+   Y G  + L  I  +EGV  LF+G  A 
Sbjct: 233 -------CSYPLDTVRRRMMMTS-----GQAVKYNGAIDCLKKIVASEGVGSLFKGCGAN 280

Query: 198 ILRTGAGSSVQLPIYNTAKNIL 219
           ILR+ AG+ V + +Y+  + IL
Sbjct: 281 ILRSVAGAGV-ISMYDQLQMIL 301

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIE 317
           Y G +DC  +T + EG+ + ++G  A V R  P   +   F ++ +KL++  +
Sbjct: 56  YSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDK-IKLMFGFK 107

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 68/161 (42%), Gaps = 10/161 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+  VK  +Q+  E IK G     Y+G+ +      K EG+   +RG  A ++R     +
Sbjct: 32  PIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQA 91

Query: 207 VQLPIYNTAKNIL--VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-----YN 259
           +     +  K +    K +      A +L +   +G    + +   D   TR+      +
Sbjct: 92  LNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSS 151

Query: 260 QKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
           +KG    + G  D   KT++ +G+  LY+GF   V  I  +
Sbjct: 152 KKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVY 192

>Scas_721.27
          Length = 374

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 143/344 (41%), Gaps = 50/344 (14%)

Query: 10  KQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQ---LQGEMSASAAKV--- 63
           K+I+  +   +  +  FVAGG+       VT P +L+K R+Q    Q    + AA V   
Sbjct: 40  KKIKPESHPNVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAA 99

Query: 64  ---------------YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPI 108
                          +K     +  ++K EG + L KGL    +  I         Y   
Sbjct: 100 HNSKIANSLVQAGTHFKETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTT 159

Query: 109 RSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQ 168
           +   ++ F   QE     +  +++               P++++KTR+Q      K G  
Sbjct: 160 KEIYSKAFNNGQE-----TPLIHLMSAATAGWATSTATNPIWMIKTRVQ----LDKAGTT 210

Query: 169 THYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG 228
             Y   W+ L T+ K+EG+ GL+RG+ A+ L +  G  +Q  +Y   K+++ +  + K G
Sbjct: 211 RKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEG-ILQWLLYEQMKHLIKQRSIEKFG 269

Query: 229 PALHLTASTISGL----------GVA-----VVMNPWDVILTRIYNQKGDLYKGPIDCLV 273
               LT S    +          GVA     +V  P +V+ TR+     +  K     LV
Sbjct: 270 HEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLV 329

Query: 274 KTVRI----EGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           ++ R+    EG+ ++Y G    + R  P++I+     E  ++L+
Sbjct: 330 QSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWELVIRLL 373

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 129/312 (41%), Gaps = 36/312 (11%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + +S + S +AG ++   A   T P++ +KIR QLQ          YK     +  I K 
Sbjct: 14  ETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQ----PVQEDKYKGIASTVRTIMKE 69

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG++ L KG   A    +     + G Y    +  +  F    +  +  +VG        
Sbjct: 70  EGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTVGA------L 123

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     PL L++TRL +          +H T V      ++  EGV+G F GI  A
Sbjct: 124 AGMTSSVVSYPLDLLRTRLIA-------NRTSHRTSVAEECRQMWLNEGVRGFFTGISTA 176

Query: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTAST--ISGLGVAVVMNPWDVILT 255
           +      +++    Y T  NI+ +N   K+  +  ++AS+  I+G     ++ P D +  
Sbjct: 177 MTTVTLSTAIMFLTYETV-NIVCENH-EKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRR 234

Query: 256 R--IYNQKGDL-------------YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTI 300
           R  + N K  +             YK     + K +R EGV+ALY+G    + +  P T 
Sbjct: 235 RMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTA 294

Query: 301 MCLTFMEQTMKL 312
           + L   E+TM L
Sbjct: 295 ISLFVYERTMDL 306

>Scas_640.25
          Length = 306

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 120/295 (40%), Gaps = 21/295 (7%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV--YKNPIQGMAVIFKNEGIKGL 83
           F+AG +A    + V  P++++K RMQLQ    A+ A    YK  I  ++ I K EG   +
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
            KG+++  + +      +    +        +F   Q   ++     +V           
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-----SVLSGASAGITEA 131

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               P  LVK RLQ  +        + + G    L  I K +G+KGL+ G+++ + R   
Sbjct: 132 LVIVPFELVKIRLQDVN--------SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183

Query: 204 GSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 263
            ++    +    + +L      ++     L A  + G    +   P+DV+ +RI +   +
Sbjct: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243

Query: 264 L------YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
           +      Y      ++K    EG  ALYKGF  +V R+ P   + L      M +
Sbjct: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 77/195 (39%), Gaps = 14/195 (7%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S ++G  A      V  P EL+KIR+Q            +K P++ +  I K +G+KGL 
Sbjct: 119 SVLSGASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLY 171

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
            G+ +        N    G    +R  L           K +    ++            
Sbjct: 172 SGVESTVWRNAVWNAGYFGVIFQVRELL------PVAKSKQEKTRNDLCAGFVGGTFGVM 225

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P  +VK+R+QS    I I     Y   W  ++ I+  EG + L++G    +LR G G
Sbjct: 226 FNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284

Query: 205 SSVQLPIYNTAKNIL 219
            +V L ++    N+ 
Sbjct: 285 GAVLLVVFTNVMNVF 299

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQ--------KGDLYKGPIDCLVKTVRIEGVTA 283
              A  I+G+   +VM P DV+ TR+  Q            YKG IDCL + V+ EG   
Sbjct: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 284 LYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
           +YKG ++ +   AP   +     ++ +KL  S+
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 125/308 (40%), Gaps = 36/308 (11%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F+AGG+A  I+ TV +P E +KI +Q+Q   +A      K     +  ++K E IKGL 
Sbjct: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYN----KGLFDAIGQVYKEENIKGLF 81

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQ-SVGVNVFXXXXX 138
           +G         GLN  R+  Y  ++          +F  D +    Q +    +F     
Sbjct: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYT------GVWNGLVTIFKTE-GVKGLF 191
                    PL LV+TRL   +  +    ++  +      GVW  L   +  E G+ GL+
Sbjct: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLY 193

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNILVK----NDLMKDGPALHLTASTISGLGVAVVM 247
           RG+    L      ++   +Y   K  +      N  M+D     L+   ISG     + 
Sbjct: 194 RGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDS-LYKLSMGAISGGVAQTIT 252

Query: 248 NPWDVILTRIY------NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIM 301
            P+D++  R        N+ G  Y    D LV   + EG    YKG  A +F++ P T +
Sbjct: 253 YPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAV 312

Query: 302 CLTFMEQT 309
                E T
Sbjct: 313 SWLVYELT 320

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 125/310 (40%), Gaps = 16/310 (5%)

Query: 11  QIEKTAAQK---ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP 67
           Q E T +     +  F SF+AG +A  I  ++T P E  K R+QL  +    A+K  +NP
Sbjct: 76  QCESTMSSNKPAVDPFHSFLAGSIAGAIEASITYPFEFAKTRLQLVDK----ASKASRNP 131

Query: 68  IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQS 127
           +  +    KN GI  +  G  A  +      G R   ++ I++ L      D++  ++  
Sbjct: 132 LVLIYNTGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLR-----DKKTGELSG 186

Query: 128 VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGV 187
               V               P   +KT L    +      Q +  G+ +    +   +G 
Sbjct: 187 FRGVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGF 246

Query: 188 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVK-NDLMKDGP---ALHLTASTISGLGV 243
            GL+RG+    +R  A  +V+L  YN  K ++    ++ KD P    L       SG+  
Sbjct: 247 SGLYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVT 306

Query: 244 AVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCL 303
                P D + TR+ +     Y   I+C     + EG+   +KG   ++ R+     +  
Sbjct: 307 VYTTMPIDTVKTRMQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVF 366

Query: 304 TFMEQTMKLV 313
           T  E+ + ++
Sbjct: 367 TIYEKVLTVL 376

>Scas_709.9
          Length = 365

 Score = 75.9 bits (185), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 128/296 (43%), Gaps = 30/296 (10%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G LA  ++  +  P+++ K R+Q QG  S      Y+  +  M+ I  +EG++GL KG
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENP-YYRGVLGTMSTIVVDEGVRGLYKG 127

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE--PHKVQSVGVNVFXXXXXXXXXXX 144
           L    +            YE     L     P+ +   H   ++                
Sbjct: 128 LIPIILGYFPTWMIYFSVYE-FAKDLYPRVLPNSDFISHSCSAITAGA--------ASTV 178

Query: 145 XXXPLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
              P+++VKTRL   +    +GE +THY G  +    I   EGV+ L+ G+  ++     
Sbjct: 179 LTNPIWVVKTRLMLQT---PLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-L 234

Query: 204 GSSVQLPIYNTAKNILVKNDLMKDGP-----ALHLT----ASTISGLGVAVVMNPWDVIL 254
             ++  P+Y   KN L   D +  G      +LHLT    AS+ S +  +++  P +++ 
Sbjct: 235 HVAIHFPVYEKLKNRL-HCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILR 293

Query: 255 TRIYNQKGDLYKGP---IDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
           TR+  +   L       +D + +T R EG+   Y GFA  + R  P + + L   E
Sbjct: 294 TRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 93/216 (43%), Gaps = 15/216 (6%)

Query: 21  SKFGSFVAGGLAACIAVTV-TNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG 79
           S F S     + A  A TV TNPI ++K R+ LQ  +  S    Y+  I     I   EG
Sbjct: 160 SDFISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTH-YRGTIDAFKKIITQEG 218

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGF--YEPIRSSLNQLFFPDQEPHKVQSVGVN--VFXX 135
           ++ L  GL  +     GL    + F  YE +++ L+          +  S+ +   +   
Sbjct: 219 VRTLYTGLVPS---MFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIAS 275

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       P  +++TR+Q  S+ + I +      + + +   ++ EG+ G + G  
Sbjct: 276 SASKMLASILTYPHEILRTRMQLKSDKLLISKHK----LLDLIKRTYRYEGLLGFYSGFA 331

Query: 196 AAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPAL 231
             +LRT   S++ L  +   +N L+K  + +D P+L
Sbjct: 332 TNLLRTVPASAITLVSFEYFRNALLK--INQDHPSL 365

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 5/75 (6%)

Query: 219 LVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQ-----KGDLYKGPIDCLV 273
           ++++ L    P +   +  ++G    +++ P DV  TR+  Q     +   Y+G +  + 
Sbjct: 54  VIQSKLHLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMS 113

Query: 274 KTVRIEGVTALYKGF 288
             V  EGV  LYKG 
Sbjct: 114 TIVVDEGVRGLYKGL 128

>Scas_718.24
          Length = 337

 Score = 74.7 bits (182), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 112/273 (41%), Gaps = 9/273 (3%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVIFKNEGIKGL 83
           F+ GG++A +A T  +PIE +K+ +Q Q EM    +    YK  +       + EGI   
Sbjct: 46  FLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISF 105

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
            +G  A  I           F + I+     +F   +E    +    N+           
Sbjct: 106 WRGNTANVIRYFPTQALNFAFKDKIK----LMFGFKKEDGYGKWFAGNLASGGAAGGLSL 161

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
                L   +TRL + S+  K G    + G+ +      K++GV GL+RG   +++    
Sbjct: 162 LFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIV 221

Query: 204 GSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 263
              +   +Y++ K +L+   L     A  L    ++  G +    P D +  ++    G 
Sbjct: 222 YRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVT-TGASTCSYPLDTVRRKMMMTSGQ 280

Query: 264 L--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
              YKG  DC  K V  EGV +L+KG  A + R
Sbjct: 281 AVKYKGAFDCFKKIVAAEGVASLFKGCGANILR 313

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 81/202 (40%), Gaps = 24/202 (11%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA-SAAKVYKNPIQGMAVIFKNEGIKG 82
           G+  +GG A  +++     ++  + R+    + S    ++ +   I       K++G+ G
Sbjct: 148 GNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAG 207

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           L +G   + +  I   G   G Y+ I+      SL   F        V + G +      
Sbjct: 208 LYRGFLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLLGWVVTTGAST----- 262

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     PL  V+ ++   S     G+   Y G ++    I   EGV  LF+G  A 
Sbjct: 263 -------CSYPLDTVRRKMMMTS-----GQAVKYKGAFDCFKKIVAAEGVASLFKGCGAN 310

Query: 198 ILRTGAGSSVQLPIYNTAKNIL 219
           ILR  AG+ V + +Y+  + IL
Sbjct: 311 ILRGVAGAGV-ISMYDQLQMIL 331

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIE 317
           YKG +DC  +T + EG+ + ++G  A V R  P   +   F ++ +KL++  +
Sbjct: 86  YKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDK-IKLMFGFK 137

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 10/158 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+  VK  +Q+ +E +K G   T Y G+ +      + EG+   +RG  A ++R     +
Sbjct: 62  PIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQA 121

Query: 207 VQLPIYNTAKNIL--VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-----YN 259
           +     +  K +    K D      A +L +   +G    + +   D   TR+      +
Sbjct: 122 LNFAFKDKIKLMFGFKKEDGYGKWFAGNLASGGAAGGLSLLFVYSLDFARTRLAADSKSS 181

Query: 260 QKGD--LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
           +KG    + G ID   KT++ +GV  LY+GF   V  I
Sbjct: 182 KKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGI 219

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 112/273 (41%), Gaps = 9/273 (3%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVIFKNEGIKGL 83
           F+ GG++A +A T  +PIE +K+ +Q Q EM    +  + Y   +         EG+   
Sbjct: 27  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISF 86

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
            +G  A  I           F + I++      F  +E +     G N+           
Sbjct: 87  WRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAG-NLASGGAAGALSL 142

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
                L   +TRL + S+  K G    + G+ +      K++GV GL+RG   +++    
Sbjct: 143 LFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVV 202

Query: 204 GSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 263
              +   +Y++ K +L+   L     A  L    ++  G +    P D +  R+    G 
Sbjct: 203 YRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVT-TGASTCSYPLDTVRRRMMMTSGQ 261

Query: 264 L--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
              Y G  DCL K V  EGV +L+KG  A + R
Sbjct: 262 AVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR 294

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 82/202 (40%), Gaps = 24/202 (11%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA-SAAKVYKNPIQGMAVIFKNEGIKG 82
           G+  +GG A  +++     ++  + R+    + S    A+ +   I       K++G+ G
Sbjct: 129 GNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAG 188

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           L +G   + +  +   G   G Y+ ++      SL   F        V + G +      
Sbjct: 189 LYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGAST----- 243

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     PL  V+ R+   S     G+   Y G ++ L  I   EGV  LF+G  A 
Sbjct: 244 -------CSYPLDTVRRRMMMTS-----GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGAN 291

Query: 198 ILRTGAGSSVQLPIYNTAKNIL 219
           ILR  AG+ V + +Y+  + IL
Sbjct: 292 ILRGVAGAGV-ISMYDQLQMIL 312

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 10/161 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGE-QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+  VK  +Q+  E +K G     Y G+ +        EGV   +RG  A ++R     +
Sbjct: 43  PIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQA 102

Query: 207 VQLPIYNTAKNIL--VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-----YN 259
           +     +  K +    K +      A +L +   +G    + +   D   TR+      +
Sbjct: 103 LNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSS 162

Query: 260 QKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
           +KG    + G ID   KT++ +GV  LY+GF   V  I  +
Sbjct: 163 KKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIVVY 203

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           Y G +DC  +T   EGV + ++G  A V R  P   +   F ++
Sbjct: 67  YAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDK 110

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 123/299 (41%), Gaps = 15/299 (5%)

Query: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76
           ++K+    SFVAG LA  +  ++T P E  K R+QL  + S    K  +NP+  +    K
Sbjct: 5   SKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSS----KASRNPLVLIYNTAK 60

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX 136
            +G+  +  G  A  +       +R   Y+ IR+ L      D++  ++      +    
Sbjct: 61  TQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLK-----DKKTGELSGPRGVLAGLG 115

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      P   +KT L    + ++   Q +   +    +++ K EG +GL+ G+  
Sbjct: 116 AGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLP 175

Query: 197 AILRTGAGSSVQLPIYNTAKNILVKN--DLMKDGP---ALHLTASTISGLGVAVVMNPWD 251
             +R  A  +V+L  YN  K +LV++     KD P    L       SG+       P D
Sbjct: 176 VSMRQAANQAVRLGCYNKIK-VLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPID 234

Query: 252 VILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTM 310
            + TR+ +     Y   ++C     + EG+   +KG   ++ R+     +  T  E  +
Sbjct: 235 TVKTRMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 80/197 (40%), Gaps = 22/197 (11%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA----VIFKNEGIKGL 83
           AG L + +AVT   P E IK  +    +   S    Y+N  + MA     + K+EG +GL
Sbjct: 116 AGLLESVVAVT---PFEAIKTVLI---DDKQSVRPKYQNNGRSMARNYISLVKDEGFRGL 169

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
             G+    + Q      RLG Y  I+  +    +      K  + G+             
Sbjct: 170 YGGVLPVSMRQAANQAVRLGCYNKIKVLVQD--YTGAPKDKPLTSGLTFIVGAFSGVVTV 227

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               P+  VKTR+QS +        + Y+   N   TI+K EG+K  ++G    + R   
Sbjct: 228 YATMPIDTVKTRMQSLTA-------SKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLIL 280

Query: 204 GSSVQLPIYNTAKNILV 220
              +   IY   +N+L+
Sbjct: 281 SGGIVFTIY---ENVLL 294

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 121/317 (38%), Gaps = 23/317 (7%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           MSS  +K D          +    SF+AG LA      +T P E  K R+QL  +    A
Sbjct: 1   MSSKATKSD----------VDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDK----A 46

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ 120
           +K  +NP+  +    K +GI  +  G  A  I      G R   ++ I+  L      D 
Sbjct: 47  SKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLR-----DS 101

Query: 121 EPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT 180
           E  ++      +               P   +KT L    +        +  GV     +
Sbjct: 102 ETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSS 161

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVK-NDLMKDGP---ALHLTAS 236
           + + +G  GL+RG+    +R  A  +V+L  YN  K ++    D  KD P    L     
Sbjct: 162 LVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVG 221

Query: 237 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
             SG+       P D + TR+ +     Y   ++C     + EG+   +KG   ++ R+ 
Sbjct: 222 AFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLV 281

Query: 297 PHTIMCLTFMEQTMKLV 313
               +  T  E+ + ++
Sbjct: 282 LSGGIVFTIYEKVLVML 298

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/347 (21%), Positives = 146/347 (42%), Gaps = 53/347 (15%)

Query: 3   SDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQL---------- 52
           +D+S+Q+        +++  +  FVAGG+       VT P +++K R+Q           
Sbjct: 40  ADSSQQN-------IKEVKPWVHFVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSH 92

Query: 53  -------QGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFY 105
                  Q  + A   + +K     ++ +++NEG + L KGL    +  I         Y
Sbjct: 93  AKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTY 152

Query: 106 EPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKI 165
              +   ++     QE     +V +++               P++LVKTRLQ      K 
Sbjct: 153 GTTKEIYSKTLNNGQE-----AVWIHLMAAATAGWATSTATNPIWLVKTRLQ----LDKA 203

Query: 166 GEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLM 225
           G    Y   W+ L  + + EG+ GL++G+ A+ L +  G  +Q  +Y   K+I+ +  + 
Sbjct: 204 GTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVEG-ILQWVLYEQMKHIIKQRSME 262

Query: 226 KDGPALHLTAST---------------ISGLGVAVVMNPWDVILTRIYN---QKGDL-YK 266
           K G    +  ST               ++    +++  P +V+ TR+     + G L Y 
Sbjct: 263 KFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYT 322

Query: 267 GPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           G +  +   ++ EG+ ++Y G    + R  P++I+     E  ++L+
Sbjct: 323 GLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVIRLL 369

>Scas_489.4
          Length = 297

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 121/299 (40%), Gaps = 17/299 (5%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + +    SF+AG LA  I  ++T P E  K R+QL  + S ++    +NP+  +    K 
Sbjct: 6   KPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTAS----RNPLVLIYNTAKT 61

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK--VQSVGVNVFXX 135
           +G   +  G  A  +      G R   ++ I++ L      +    +  V  +G  +   
Sbjct: 62  QGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPRGVVAGLGAGLLES 121

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       P   +KT L    + +K   Q +  G+     ++ + +G+ GL+RG+ 
Sbjct: 122 VVAVT-------PFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVL 174

Query: 196 AAILRTGAGSSVQLPIYNTAKNILVK-NDLMKDGP---ALHLTASTISGLGVAVVMNPWD 251
              +R  A  +V+L  YN  K ++    +  KD P    L       SG+       P D
Sbjct: 175 PVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPID 234

Query: 252 VILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTM 310
            + TR+ +     Y   ++C  K  + EG+   +KG   ++ R+     +  T  E  +
Sbjct: 235 TVKTRMQSLDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 83/197 (42%), Gaps = 22/197 (11%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM----AVIFKNEGIKGL 83
           AG L + +AVT   P E IK    L  +  A   K Y+N  +GM      + +++GI GL
Sbjct: 116 AGLLESVVAVT---PFEAIK--TALIDDKQALKPK-YQNNGRGMLRNYGSLVRDQGIMGL 169

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
            +G+    + Q      RLG Y  I++ +    + +    +  S G+             
Sbjct: 170 YRGVLPVSMRQAANQAVRLGCYNKIKTMVQD--YTNAPKDRPLSSGLTFIVGAFSGVVTV 227

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               P+  VKTR+QS        + T YT   N    IFK EG+K  ++G    + R   
Sbjct: 228 YTTMPIDTVKTRMQSL-------DATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLIL 280

Query: 204 GSSVQLPIYNTAKNILV 220
              +   IY   +N+LV
Sbjct: 281 SGGIVFTIY---ENVLV 294

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 127/311 (40%), Gaps = 23/311 (7%)

Query: 8   QDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP 67
           Q KQ++ +         SF+AG LA  +  +VT P E  K R+QL  +    A+K  +NP
Sbjct: 3   QSKQVDPSK--------SFIAGCLAGAVEASVTYPFEFAKTRLQLLDK----ASKASRNP 50

Query: 68  IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQS 127
           +  +    K +GI  +  G  A  +      G R   ++ I++ L      D +  ++  
Sbjct: 51  LVLIYNTAKTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLR-----DPKTGELSG 105

Query: 128 VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGV 187
               +               P   +KT L    +        +  G+      + + +G+
Sbjct: 106 PRGVIAGLGAGLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGL 165

Query: 188 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKN--DLMKDGP---ALHLTASTISGLG 242
            GL+RG+    +R  A  +V+L  YN  K ++V++  +  KD P    L       SG+ 
Sbjct: 166 SGLYRGVLPVSMRQAANQAVRLGCYNKIK-VMVQDYTNAPKDKPLSSGLTFVVGAFSGIV 224

Query: 243 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMC 302
                 P D + TR+ +     Y   I+C     + EG+ A +KG   ++ R+     + 
Sbjct: 225 TVYTTMPIDTVKTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIV 284

Query: 303 LTFMEQTMKLV 313
            T  E+ + ++
Sbjct: 285 FTVYEKVLTVL 295

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 72.4 bits (176), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 119/286 (41%), Gaps = 18/286 (6%)

Query: 18  QKISKFG-SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVI 74
           +K S F   F+ GG++A ++ T   PIE +K+ +Q Q EM    S  + Y   ++     
Sbjct: 5   KKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRT 64

Query: 75  FKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFX 134
             +EG+    +G  A  I           F + I++      F  +E +     G N+  
Sbjct: 65  AADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAG-NLAS 120

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK----TEGVKGL 190
                         L   +TRL + S+  K G +  +    NGLV ++K    ++GV GL
Sbjct: 121 GGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQF----NGLVDVYKKTLASDGVAGL 176

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPW 250
           +RG   +++       +   +Y++ K +L+   L     A  L    ++  G +    P 
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVT-TGASTASYPL 235

Query: 251 DVILTRIYNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
           D +  R+    G    Y G  D   K V  EG+ +L+KG  A + R
Sbjct: 236 DTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 74/180 (41%), Gaps = 28/180 (15%)

Query: 49  RMQLQGEMSASAAKVYKNPIQGMAVIFK----NEGIKGLQKGLNAAYIYQIGLNGSRLGF 104
           R +L  + S SA K  +    G+  ++K    ++G+ GL +G   + +  +   G   G 
Sbjct: 139 RTRLAAD-SKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGL 197

Query: 105 YEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSY 159
           Y+ ++      SL   F          + G +                PL  V+ R+   
Sbjct: 198 YDSLKPLLLTGSLENSFLASFLLGWAVTTGAST------------ASYPLDTVRRRMMMT 245

Query: 160 SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           S     G+   Y G ++    I   EG+K LF+G  A ILR  AG+ V + +Y+  + IL
Sbjct: 246 S-----GQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV-ISMYDQLQVIL 299

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 22/44 (50%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           Y G ++C  +T   EGV + ++G  A V R  P   +   F ++
Sbjct: 54  YTGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDK 97

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 4/75 (5%)

Query: 15  TAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI 74
           T + + S   SF+ G      A T + P++ ++ RM     M++  A  Y         I
Sbjct: 207 TGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMM----MTSGQAVKYDGAFDAFRKI 262

Query: 75  FKNEGIKGLQKGLNA 89
              EGIK L KG  A
Sbjct: 263 VAAEGIKSLFKGCGA 277

>Scas_589.10
          Length = 316

 Score = 72.0 bits (175), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 93/224 (41%), Gaps = 16/224 (7%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
            +S+   Q   ++K   ++++   + +AG  A      +  P EL+KIR+Q        A
Sbjct: 101 FASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQ-------DA 153

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPD- 119
              Y++PI+    I +N+G+ G+  G  +        N S  G    ++      F P  
Sbjct: 154 QSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRNTIWNASYFGLIFQVKK-----FIPRA 208

Query: 120 QEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLV 179
           +   K Q +  +                P  +VKTR+Q      K      Y   W  + 
Sbjct: 209 KSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSK---KTSSGMCYGWAWQSVF 265

Query: 180 TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKND 223
            I++TEG+KG+++GI   I R G G  + L ++N    +   +D
Sbjct: 266 LIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELFRMSD 309

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 79/155 (50%), Gaps = 9/155 (5%)

Query: 148 PLFLVKTRLQSY-------SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
           PL +VKTR Q         +  + + +Q  ++ + + L  I K EG K L++G+   +L 
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 201 TGAGSSVQLPIYNTAKNILVKNDLMKD-GPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
                +V+       + I++K   +K+    + L A T +G+  ++++ P++++  R+ +
Sbjct: 93  EVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQD 152

Query: 260 QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
            + D Y+ PI C    +  +G+  +Y GF + ++R
Sbjct: 153 AQSD-YRSPIRCTRTIIENQGLFGIYAGFESTIWR 186

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 109/286 (38%), Gaps = 27/286 (9%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQ---GEMSASAAKVYKNP-----IQGMAVIFKN 77
           F++G +A      +  P++++K R QLQ     ++ S+  V K P     +  ++ I K 
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG K L KG++   + ++     +    E       Q+     +  +V S  V +     
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNE----QFQQIMMKKFKLKEVTST-VTLLAGTF 131

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     P  LVK RLQ          Q+ Y        TI + +G+ G++ G ++ 
Sbjct: 132 AGITESLIVVPFELVKIRLQD--------AQSDYRSPIRCTRTIIENQGLFGIYAGFEST 183

Query: 198 ILRTGAGSSVQLPIYNTAKNIL--VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT 255
           I R    ++    +    K  +   K+     G         I+G     +  P+DV+ T
Sbjct: 184 IWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKT 243

Query: 256 RIYNQK----GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
           R+   K    G  Y      +    R EG+  +YKG    + R  P
Sbjct: 244 RMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 14/80 (17%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQ--------------KGDLYKGPIDCLVKTVR 277
              +  ++G+   ++M P DV+ TR   Q              K   +   + CL K ++
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 278 IEGVTALYKGFAAQVFRIAP 297
            EG   LYKG +  +    P
Sbjct: 76  EEGFKNLYKGMSPPLLMEVP 95

>Kwal_26.8669
          Length = 296

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 117/288 (40%), Gaps = 20/288 (6%)

Query: 15  TAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI 74
           T A+ +  F  F AG +A    + V  P++++K RMQLQ  +S      YK  +  +  I
Sbjct: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ--VSGGLGPQYKGVVDCIKQI 59

Query: 75  FKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFX 134
              EG   L KG+++  + +     ++    +  +    + F  ++         +++  
Sbjct: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS-----LSILS 114

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        P  LVK RLQ  S        + Y G  + +  I   EGV  ++ G+
Sbjct: 115 GASAGCCEAFVVVPFELVKIRLQDVS--------SSYKGPIDVVRKIIAQEGVLAMYNGL 166

Query: 195 DAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVIL 254
           ++ + R G  ++    I    + +L +           L A +I G   +++  P+DV+ 
Sbjct: 167 ESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVK 226

Query: 255 TRIYNQK-----GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
           +RI N          Y      +    + EG  ALYKGF  +V R+ P
Sbjct: 227 SRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 88/202 (43%), Gaps = 15/202 (7%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +K+++  S ++G  A C    V  P EL+KIR+Q   ++S+S    YK PI  +  I   
Sbjct: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ---DVSSS----YKGPIDVVRKIIAQ 156

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG+  +  GL +        N    G    +R+ L     P+ +  K Q    ++     
Sbjct: 157 EGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL-----PEAK-SKSQQTRNDLIAGSI 210

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     P  +VK+R+Q+ +  +  G    Y   W  + TI+K EG + L++G    
Sbjct: 211 GGTIGSLMSTPFDVVKSRIQNTA--VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268

Query: 198 ILRTGAGSSVQLPIYNTAKNIL 219
           +LR G G  + L ++    +  
Sbjct: 269 VLRLGPGGGILLVVFTGCMDFF 290

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 117/302 (38%), Gaps = 21/302 (6%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV--------YKNPIQGMAVIFKN 77
           F AG +A    + V  P++++K RMQLQ       A V        Y   +  +  I K 
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG   L KG+ +  + +      +    +  ++   ++F     P+   +  + ++    
Sbjct: 75  EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIF---PTPNGEMTQKIAIYSGAS 131

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     P  LVK RLQ  +   K   +     V  G        GV  LF G++A 
Sbjct: 132 AGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKG--------GVLSLFNGLEAT 183

Query: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           I R    ++    I    + +L       +     L A  I G    ++  P+DV+ +RI
Sbjct: 184 IWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRI 243

Query: 258 YNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315
               G L  Y   +  ++   R EG  ALYKGFA +V R+AP   + L      M     
Sbjct: 244 QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFRE 303

Query: 316 IE 317
           ++
Sbjct: 304 VK 305

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 79/214 (36%), Gaps = 26/214 (12%)

Query: 10  KQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQ 69
           K+I  T   ++++  +  +G  A  +   V  P EL+KIR+Q            +K PI+
Sbjct: 110 KKIFPTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQ-------DVNSQFKTPIE 162

Query: 70  GMAVIFKNEGIKG----LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV 125
               + KN  +KG    L  GL A     +  N    G    IR  L             
Sbjct: 163 ----VVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLL------PAAKTST 212

Query: 126 QSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTE 185
           +    ++               P  +VK+R+Q  S     G    Y      ++ +++ E
Sbjct: 213 EKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSS-----GPLRKYNWSLPSVLLVYREE 267

Query: 186 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           G K L++G    ++R   G  + L ++    +  
Sbjct: 268 GFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFF 301

>Scas_716.29
          Length = 316

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 142/331 (42%), Gaps = 43/331 (12%)

Query: 4   DNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV 63
           D       + K    K+S+  S VAG ++  +A TV  P++ +KIR+QL+   +  A   
Sbjct: 6   DGQHNTDHLRKGEDVKVSQ--SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSG 63

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123
               ++GM  I    G++   KG     +  +   G++   Y    S  N LF    + +
Sbjct: 64  LLKMMKGM--ILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY----SFYNNLFGETSDMN 117

Query: 124 -KVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182
            ++QS+ V                 P  +++TR  + ++ + +   +H      G   I+
Sbjct: 118 GQLQSLVVGAL----AGMTSSFVSYPTDVLRTRFIA-NQDVALSSLSH------GCKEIW 166

Query: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGP---ALHLTASTIS 239
             EG+ G FRG  A++      +S+    Y + K  +  ++  K+      L  +AS+IS
Sbjct: 167 NMEGIPGFFRGCTASMFTITLSASILFGTYESIK--IYCDEYSKESDYTNYLRYSASSIS 224

Query: 240 GLGVAVVMNPWDVILTRI---------YNQKGDL-------YKGP--IDCLVKTVRIEGV 281
           G+   +V  P D I  RI         +N +  +       YKG   I   +  +R EG+
Sbjct: 225 GVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGL 284

Query: 282 TALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
            +LY+G +  + +  P T++ L   E  M+L
Sbjct: 285 LSLYQGVSMSLCKTVPSTVVSLWAYETVMRL 315

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 112/293 (38%), Gaps = 17/293 (5%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           + +AGG A        +P++ IK+RMQ+   ++          I+    I++ EG   L 
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           KGL A  I  I     R   YE  R+ L      ++E   V +    V            
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLV-----NKESGIVSTGNTFVAGVGAGITEAVL 127

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQT---HYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
              P+ +VK RLQ+  + +   E      Y    +   TI K EGV  L+RG+     R 
Sbjct: 128 VVNPMEVVKIRLQA--QHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQ 185

Query: 202 GAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA-STISGLGVAVVMNPWDVILTRIYN- 259
                    +Y+  K  L     M   P+   +    ISG        P D I TR+   
Sbjct: 186 ATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKD 245

Query: 260 -----QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
                +K    K  I    + ++ EG  ALYKG   +V R+AP   +  T  E
Sbjct: 246 KSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 91/220 (41%), Gaps = 17/220 (7%)

Query: 20  ISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQLQG--EMSASAAKVYKNPIQGMAVIFK 76
           +S   +FVAG G     AV V NP+E++KIR+Q Q       +A   Y N I     I K
Sbjct: 108 VSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVK 167

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH-KVQSVGVNVFXX 135
            EG+  L +G++     Q    G+    Y  ++  L      D  P  +   +G+     
Sbjct: 168 EEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGL----- 222

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       PL  +KTRLQ   + I + +Q+    +      + K EG + L++GI 
Sbjct: 223 -ISGAIGPFSNAPLDTIKTRLQK-DKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGIT 280

Query: 196 AAILRTGAGSSVQLPIYNTAKN------ILVKNDLMKDGP 229
             ++R   G +V   +Y   +       I  KND  K  P
Sbjct: 281 PRVMRVAPGQAVTFTVYEYVREHLENLGIFKKNDTPKPKP 320

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 43/96 (44%), Gaps = 6/96 (6%)

Query: 229 PALHLTASTISGLGVAVVMNPWDVILTR--IYNQKGDLYKGPIDCLVKTVRI----EGVT 282
           PA++L A   +GL  A+  +P D I  R  IY +   +        +KT R     EG  
Sbjct: 10  PAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFL 69

Query: 283 ALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIES 318
           ALYKG  A V  I P   +  +  E    L+ + ES
Sbjct: 70  ALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKES 105

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 141/303 (46%), Gaps = 39/303 (12%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG---- 82
           ++G  A  +   V +P++L+K+R+QL    + SA K +  P   +  I ++    G    
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLS---ATSAQKAHYGPFMVIKEIIRSSANSGRSVT 70

Query: 83  --LQKGLNAAYIYQIGLNGSRLGFY----EPIRSSLNQLFFPDQ-------EPHKVQSVG 129
             L +GL+          G   G Y    E I  S+ +   P +         HK+ S+ 
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAK---PGETQLKGVGNDHKMNSL- 126

Query: 130 VNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189
           + +               P++++KTR+ S S+    G Q  YT ++NG+  + +T+G +G
Sbjct: 127 IYLSAGASSGLMTAILTNPIWVIKTRIMSTSK----GAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLT---ASTISGLGVAV- 245
           L++G+  A+     G ++   +Y+T K   ++    ++G  +HLT      I+ LG  V 
Sbjct: 183 LWKGLVPALFGVSQG-ALYFAVYDTLKQRKLRRK-RENGLDIHLTNLETIEITSLGKMVS 240

Query: 246 --VMNPWDVILTRIYNQKGDLYKGPIDCLVK-TVRIEGVTALYKGFAAQVFRIAPHTIMC 302
             ++ P+ ++ + + + + +  K  +  L+K  +  +G   LYKG +A + R  P T  C
Sbjct: 241 VTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPST--C 298

Query: 303 LTF 305
           +TF
Sbjct: 299 ITF 301

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 31  LAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAA 90
           L   ++VT+  P +L+K  +Q      A+  K    P+  + +I  N+G  GL KGL+A 
Sbjct: 235 LGKMVSVTLVYPFQLLKSNLQ---SFRANEQKFRLFPL--IKLIIANDGFVGLYKGLSAN 289

Query: 91  YIYQIGLNGSRLGFYEPIRSSL 112
            +  I         YE ++  L
Sbjct: 290 LVRAIPSTCITFCVYENLKHRL 311

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 119/299 (39%), Gaps = 20/299 (6%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           F+AG +A    + V  P++++K  MQLQ  +S  +   YK     +  I   EG   L K
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G+++  + +     ++    +  +     LF  ++    +     ++             
Sbjct: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPL-----SILSGASAGICESFV 125

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P  LVK RLQ  S        + +T     +  I + EG+  ++ G+++ + R G  +
Sbjct: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177

Query: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK---- 261
           +    I    + +L K     +     L A T+ G   +++  P+DV+ +R+ N      
Sbjct: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237

Query: 262 -GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
               Y      L    + EG  ALYKGF  +V R+ P   + L      M    ++  +
Sbjct: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHEK 296

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 15/197 (7%)

Query: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76
           A+K+++  S ++G  A      V  P EL+KIR+Q         +  + +PI  +  I +
Sbjct: 103 AEKLTQPLSILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVE 155

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX 136
            EGI  +  GL +        N    G    +R+ L       +   K +    ++    
Sbjct: 156 KEGILAMYNGLESTMWRHGIWNAGYFGIIFQVRALL------PKASTKSEQTRNDLLAGT 209

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      P  +VK+R+Q+ +  +  G    Y   W  L TI+K EG K L++G   
Sbjct: 210 VGGTLSSLLSTPFDVVKSRVQNTA--VIPGVPRKYNWSWPALATIYKEEGFKALYKGFVP 267

Query: 197 AILRTGAGSSVQLPIYN 213
            +LR G G  + L ++ 
Sbjct: 268 KVLRLGPGGGILLVVFT 284

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 69.7 bits (169), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 133/319 (41%), Gaps = 51/319 (15%)

Query: 39  VTNPIELIKIRMQL---------QGE-------------MSASAAKVYKNPIQGMAVIFK 76
           VT P +L+K R+Q          Q E             ++  AA  +K  +  +  +++
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX 136
            EG + L KGL    +  I         Y   +   ++ F   QE     +  +++    
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQE-----APWIHLMAAA 187

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      P+++VKTR+Q      K G+   Y   ++ L +I + EG+ GL+RG+ A
Sbjct: 188 TAGWATATATNPIWMVKTRVQ----LDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSA 243

Query: 197 AILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTIS----------GLGVA-- 244
           + L +  G  +Q  +Y   K+++ K  + K G     T +T            G G+A  
Sbjct: 244 SYLGSVEG-ILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKF 302

Query: 245 ---VVMNPWDVILTRIYN---QKGDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
              +V  P +V+ TR+     + G + Y G +      ++ EG+ ++Y G    + R  P
Sbjct: 303 MASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVP 362

Query: 298 HTIMCLTFMEQTMKLVYSI 316
           ++I+     E  +KL+  I
Sbjct: 363 NSIIMFGTWEVVIKLLSDI 381

>Kwal_27.12481
          Length = 304

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 118/287 (41%), Gaps = 18/287 (6%)

Query: 17  AQKISKFG-SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAV 73
           ++K S F   F+ GG++A ++ T   PIE +K+ +Q Q EM    S  + Y    +    
Sbjct: 4   SKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKR 63

Query: 74  IFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVF 133
              NEGI    +G  A  I           F + I++      F  +E +     G N+ 
Sbjct: 64  TAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FKKEEGYAKWFAG-NLA 119

Query: 134 XXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK----TEGVKG 189
                          L   +TRL + S+  K G +  +    NGLV ++K    ++G+ G
Sbjct: 120 SGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQF----NGLVDVYKKTLASDGIAG 175

Query: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNP 249
           L+RG   +++       +    Y++ K +L+   L     A  L    ++  G +    P
Sbjct: 176 LYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVT-TGASTASYP 234

Query: 250 WDVILTRIYNQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
            D +  R+    G    Y G  D   K V  EG+ +L+KG  A + R
Sbjct: 235 LDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 83/205 (40%), Gaps = 30/205 (14%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK----NEG 79
           G+  +GG A  +++     ++  + R+      S  A K  +    G+  ++K    ++G
Sbjct: 116 GNLASGGAAGGLSLMFVYSLDYARTRLAAD---SKGAKKGGERQFNGLVDVYKKTLASDG 172

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVNVFX 134
           I GL +G   + +  +   G   G Y+ ++      SL   F          + G +   
Sbjct: 173 IAGLYRGFLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAVTTGAST-- 230

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        PL  V+ R+   S     G+   Y G ++    I   EG+K LF+G 
Sbjct: 231 ----------ASYPLDTVRRRMMMTS-----GQAVKYNGAFDAFRKIVAAEGIKSLFKGC 275

Query: 195 DAAILRTGAGSSVQLPIYNTAKNIL 219
            A ILR  AG+ V + +Y+  + IL
Sbjct: 276 GANILRGVAGAGV-ISMYDQLQMIL 299

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 4/75 (5%)

Query: 15  TAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI 74
           T + + S   SF+ G      A T + P++ ++ RM     M++  A  Y         I
Sbjct: 207 TGSLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMM----MTSGQAVKYNGAFDAFRKI 262

Query: 75  FKNEGIKGLQKGLNA 89
              EGIK L KG  A
Sbjct: 263 VAAEGIKSLFKGCGA 277

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 90/208 (43%), Gaps = 15/208 (7%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA---SAAKVYKNPIQGMAVIFKNEG 79
           F    AG L   I+  V  P E++K R+QLQG  +     +   YKN    +  I + EG
Sbjct: 151 FSHLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREG 210

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF--PDQEPHKVQSVGVNVFXXXX 137
              L  G  A     +  +G +  FYE  R    QL F   ++   +  S+   +     
Sbjct: 211 WPTLFFGYKATLSRDLPFSGLQFAFYEKFR----QLAFAVENKTFDEDLSLSNEIITGAA 266

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFI------KIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
                     PL +VKTR+Q+    I       + +QT    +  G++T++KTEG+ GLF
Sbjct: 267 AGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLF 326

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNIL 219
            G+    + T   SS+ L +Y  A   L
Sbjct: 327 SGVGPRFIWTSIQSSIMLLLYQVALKTL 354

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 93/238 (39%), Gaps = 37/238 (15%)

Query: 43  IELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRL 102
           ++ +K R Q      A +   YKN I     I   EG   L+KGL   Y      +G+ L
Sbjct: 76  LDTVKTRQQ-----GAPSTVKYKNMIGAYRTIILEEG---LRKGLYGGY------SGAML 121

Query: 103 GFYEPIRSSLNQLFFPDQEPHKVQSVG--------VNVFXXXXXXXXXXXXXXPLFLVKT 154
           G +         +FF   E  K + +G         ++               P  ++KT
Sbjct: 122 GSFPSA-----AIFFATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKT 176

Query: 155 RLQ---SYSE-FIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLP 210
           RLQ    Y+  F + G   +Y  + + + TI + EG   LF G  A + R    S +Q  
Sbjct: 177 RLQLQGRYNNPFFRSGY--NYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFA 234

Query: 211 IYNTAKNIL--VKNDLMKDGPAL--HLTASTISGLGVAVVMNPWDVILTRIYNQKGDL 264
            Y   + +   V+N    +  +L   +     +G    ++  P DV+ TRI  Q  D+
Sbjct: 235 FYEKFRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDI 292

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 122/311 (39%), Gaps = 38/311 (12%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + +S   + VAG ++  +A +VT P++ +KIR QLQ    AS  K Y   +     + + 
Sbjct: 20  EAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQ---LASEHK-YHGILHTFRTVARE 75

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG++ L KG   A    +     + G Y  + ++      P Q      S+ V       
Sbjct: 76  EGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQ----AHSLAVGAL---- 127

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     PL L++TRL +           H+  +      I+ TEG  G FRG   A
Sbjct: 128 AGLVSSLLTYPLDLLRTRLVA-------NRSAHFFSLRRQARVIWDTEGPAGFFRGGAWA 180

Query: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           I  T   + +   IY T         L    P L   AS  +GL     + P D +  R+
Sbjct: 181 IAATTLTTGLIFGIYETCTIAADTYGL----PWLAAAASPTAGLVSKAAVFPLDTVRRRL 236

Query: 258 ----------YNQKGDLYKGP-----IDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMC 302
                     + +    Y        +   V  VR EG+ +LYKG    + +  P T++ 
Sbjct: 237 QIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVIT 296

Query: 303 LTFMEQTMKLV 313
           L   ++ ++L+
Sbjct: 297 LWVYQRCLRLL 307

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 68.6 bits (166), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 124/293 (42%), Gaps = 30/293 (10%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
           F +FVAGG+   ++ TV +P+E +KI +Q+Q   +A    +    +  +  ++K EG+KG
Sbjct: 17  FIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGL----VHAVKQVYKEEGVKG 72

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSL-----NQLFFPDQEPHKVQSVGVNVFXXXX 137
           L +G         G+N  R+  Y  ++ ++      ++F   Q  H+       +     
Sbjct: 73  LFRG--------NGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGAL 124

Query: 138 XXXXXXXXXXPLFLVKTRLQ-SYSEFIKIGEQTHYT-----GVWNGLVTIFKTE-GVKGL 190
                     PL LV+TRL    +   K+     +      G+   L  IF+ E G++G 
Sbjct: 125 GGGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGW 184

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPW 250
           +RG+    L      ++   +Y   K ++  +       A  L    +SG     V+ P+
Sbjct: 185 YRGVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPF 244

Query: 251 DV------ILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
           D+      +LT   ++ G  Y    D L    R EG+   YKG  A + ++ P
Sbjct: 245 DLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/186 (19%), Positives = 81/186 (43%), Gaps = 21/186 (11%)

Query: 39  VTNPIELIKIRMQLQ----GEMSASAAKVYKNP---IQGMAVIFKNEG-IKGLQKGLNAA 90
           VT P++L++ R+ +Q     ++  S A   + P   ++ +  IF+ EG ++G  +G+   
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 91  YIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLF 150
            +  +         YE +++ +      D +   V +  + +               P  
Sbjct: 192 SLGVVPFVALNFALYERLKALIPH----DYDAGSVAAAKLAI--GAVSGGIAQTVVYPFD 245

Query: 151 LVKTRLQSYSEFIKIGEQT---HYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           L++ R Q     + +G+      Y  V + L TI + EG++G ++G+ A +++     +V
Sbjct: 246 LLRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301

Query: 208 QLPIYN 213
           Q  +Y 
Sbjct: 302 QWFVYE 307

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88
           G ++  IA TV  P +L++ R Q+     +     Y +    +  I + EG++G  KGL 
Sbjct: 230 GAVSGGIAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLT 289

Query: 89  AAYIYQIGLNGSRLGFYEPIRSSLNQL 115
           A  +  +     +   YE I  +++ L
Sbjct: 290 ANLVKVVPAMAVQWFVYELISENMHGL 316

>Scas_691.4
          Length = 334

 Score = 68.6 bits (166), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 113/309 (36%), Gaps = 27/309 (8%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +K S   + VAGG A        +P++ IK+RMQ+           +   I     I+ +
Sbjct: 9   KKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGF---ITTGRNIYSH 65

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG   L KGL A  I  I     R   YE  R++L      D+E   + +    +     
Sbjct: 66  EGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALT-----DKETRTITTGNTFLAGVGA 120

Query: 138 XXXXXXXXXXPLFLVKTRLQ--------------SYSEFIKIGEQTHYTGVWNGLVTIFK 183
                     P+ +VK RLQ              S +       +  Y    +   TI K
Sbjct: 121 GITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVK 180

Query: 184 TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA-STISGLG 242
            EG   L+RG+     R          +Y+  K+ L K    +  P+   +    ISG  
Sbjct: 181 EEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAI 240

Query: 243 VAVVMNPWDVILTRIYNQKG----DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
                 P D I TR+   K       +K       + ++ EG  ALYKG   +V R+AP 
Sbjct: 241 GPFSNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPG 300

Query: 299 TIMCLTFME 307
             +  T  E
Sbjct: 301 QAVTFTVYE 309

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 114/278 (41%), Gaps = 16/278 (5%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM--SASAAKVYKNPIQGMAVIFKNEGIKG 82
           +F+ GG++A ++ T   PIE +K+ +Q Q EM    S  + Y   +        +EG+  
Sbjct: 12  NFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVIS 71

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXX 142
             +G  A  I           F + I++      F  +     +    N+          
Sbjct: 72  FWRGNTANVIRYFPTQALNFAFKDKIKAMFG---FRKEVDGYAKWFAGNLASGGAAGGLS 128

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK----TEGVKGLFRGIDAAI 198
                 L   +TRL + S+  K G +  +    NGLV ++K    ++G+ GL+RG   ++
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQF----NGLVDVYKKTLASDGIAGLYRGFLPSV 184

Query: 199 LRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIY 258
           +       +   +Y++ K +L+  +L     A  L    ++  G +    P D +  R+ 
Sbjct: 185 VGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVT-TGASTASYPLDTVRRRMM 243

Query: 259 NQKGDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
              G    Y G  D   K V  EGV +L+KG  A + R
Sbjct: 244 MTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILR 281

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 84/201 (41%), Gaps = 22/201 (10%)

Query: 24  GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK----NEG 79
           G+  +GG A  +++     ++  + R+      S SA K  +    G+  ++K    ++G
Sbjct: 116 GNLASGGAAGGLSLLFVYSLDYARTRLAAD---SKSAKKGGERQFNGLVDVYKKTLASDG 172

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX-XX 138
           I GL +G   + +  +   G   G Y+ ++        P      ++S  +  F      
Sbjct: 173 IAGLYRGFLPSVVGIVVYRGLYFGMYDSLK--------PLLLTGNLESSFIASFLLGWAV 224

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAI 198
                    PL  V+ R+   S     G+   Y G ++    I   EGVK LF+G  A I
Sbjct: 225 TTGASTASYPLDTVRRRMMMTS-----GQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANI 279

Query: 199 LRTGAGSSVQLPIYNTAKNIL 219
           LR  AG+ V + +Y+  + +L
Sbjct: 280 LRGVAGAGV-ISLYDQLQLVL 299

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 265 YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           Y G +DC  +T   EGV + ++G  A V R  P   +   F ++
Sbjct: 53  YNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDK 96

>Kwal_26.7967
          Length = 297

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/299 (21%), Positives = 118/299 (39%), Gaps = 17/299 (5%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +++    SF+AG LA  +  ++T P E  K R+QL  + S ++    +NP+  +    K 
Sbjct: 5   KQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTAS----RNPLTLIYRTAKV 60

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN--VFXX 135
           +G+  +  G  A  +      G R   ++ I++ L       ++P   +  G    V   
Sbjct: 61  QGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNIL-------RDPTTGELSGPRGIVAGL 113

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       P   +KT L    +        +  G+     ++   +G  GL+RG+ 
Sbjct: 114 GAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVL 173

Query: 196 AAILRTGAGSSVQLPIYNTAKNILVK-NDLMKDGP---ALHLTASTISGLGVAVVMNPWD 251
              +R  A  +V+L  YN  K ++    +  KD P    +       SG+       P D
Sbjct: 174 PVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPID 233

Query: 252 VILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTM 310
            + TR+ +     Y   I+C     R EG+   +KG   ++ R+     +  T  E+ +
Sbjct: 234 TVKTRMQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVL 292

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 86/203 (42%), Gaps = 13/203 (6%)

Query: 20  ISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           +S   +F+AG G     AV V NP+E++KIR+Q Q    A+  + Y+N IQ   +I K E
Sbjct: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGV--NVFXXX 136
           GI  L +G++     Q    G+    Y  +   L       QE H  Q++          
Sbjct: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERL-------QEYHGSQNLPSWETSLIGL 265

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      PL  +KTRLQ       +      T +   LV   + EG + L++GI  
Sbjct: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLV---QEEGFRALYKGITP 322

Query: 197 AILRTGAGSSVQLPIYNTAKNIL 219
            ++R   G +V   +Y   +  L
Sbjct: 323 RVMRVAPGQAVTFTVYEFVRRHL 345

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 110/296 (37%), Gaps = 29/296 (9%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP--IQGMAVIFKNEGIKG 82
           + VAGG A        +P++ IK+RMQ+       A +  K P  ++  A I+  EG+  
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIY----RRANEGTKPPGFLRTGANIYSGEGLLA 115

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXX 142
             KGL A  I  I     R   YE  R+ L      D++   V +    +          
Sbjct: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-----DRQTGVVSTGNTFLAGVGAGVTEA 170

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG 202
                P+ +VK RLQ+        EQ  Y         I K EG+  L+RG+     R  
Sbjct: 171 VLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQA 229

Query: 203 AGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMN-PWDVILTRIYNQK 261
                   +Y+     L +    ++ P+   +   +    +    N P D I TR+   K
Sbjct: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK 289

Query: 262 GDLYKGPIDCLVKTVRI----------EGVTALYKGFAAQVFRIAPHTIMCLTFME 307
                     L   VRI          EG  ALYKG   +V R+AP   +  T  E
Sbjct: 290 ST------RNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 229 PALHLTASTISGLGVAVVMNPWDVILTR--IYNQKGDLYKGP--IDCLVKTVRIEGVTAL 284
           PA++L A   +GL  A+  +P D I  R  IY +  +  K P  +         EG+ A 
Sbjct: 57  PAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAF 116

Query: 285 YKGFAAQVFRIAP 297
           YKG  A V  I P
Sbjct: 117 YKGLGAVVIGIIP 129

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 118/288 (40%), Gaps = 42/288 (14%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           F AG +A    + V  P++++K RMQLQ  +   A   Y   +  +  I   EG+  L K
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQ--VQGGAGPHYTGVVDCLKKIVAGEGVGRLYK 72

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G+++  + +     ++    +  +    Q F  ++      S  +++             
Sbjct: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK-----LSQPLSMLAGASAGCVEAFV 127

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P  LVK RLQ  S        + Y G  + +  I   EGV  ++ G+++ + R    +
Sbjct: 128 VVPFELVKIRLQDAS--------SSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWN 179

Query: 206 SVQLPIYNTAKNIL---------VKNDLMKD--GPALHLTASTISGLGVAVVMNPWDVIL 254
                I   A+ +L         + NDL+ D  G ++    ST           P+DV+ 
Sbjct: 180 GGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-----------PFDVVK 228

Query: 255 TRIYNQK---GDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
           +RI N     G +  Y   +  L+   R EG  ALYKGF  +V R+ P
Sbjct: 229 SRIQNTAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 84/196 (42%), Gaps = 15/196 (7%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +K+S+  S +AG  A C+   V  P EL+KIR+Q        A+  YK P+  +  I   
Sbjct: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAR 158

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG+  +  GL +        NG   G     R+ L          +K Q +  ++     
Sbjct: 159 EGVLAMYNGLESTLWRHALWNGGYFGIIFQARALL------PAAHNKTQCITNDLISDSI 212

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     P  +VK+R+Q+ +  +  G    Y      L+TI++ EG + L++G    
Sbjct: 213 GCSIGCMLSTPFDVVKSRIQNTA--VIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPK 270

Query: 198 ILRTGAGSSVQLPIYN 213
           +LR G G  + L ++ 
Sbjct: 271 VLRLGPGGGILLVVFT 286

>Kwal_14.2210
          Length = 315

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 120/299 (40%), Gaps = 28/299 (9%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F AGG+A  ++ TV +P E +KI +Q+Q    A    +++   Q    ++  EG+ GL 
Sbjct: 20  AFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQ----VYLEEGVPGLL 75

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLF---FPDQEPHKVQSVGVNVFXXXXXXXX 141
           +G         GLN  R+  Y  ++  + +     +  Q P  V      +         
Sbjct: 76  RG--------NGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGC 127

Query: 142 XXXXXXPLFLVKTRLQ-SYSEFIKIGEQTHYT-----GVWNGLVTIFKTE-GVKGLFRGI 194
                 PL LV+TRL    +   ++ +    +     GVW  L   +  E G+ GL+RG+
Sbjct: 128 SVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGV 187

Query: 195 DAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVIL 254
               +      ++   +Y   +  +  +          L+   ISG     +  P+D++ 
Sbjct: 188 WPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLR 247

Query: 255 TRI------YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
            R        ++ G  YK   D L+   R EG    YKG  A +F++ P T +     E
Sbjct: 248 RRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 88/208 (42%), Gaps = 27/208 (12%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQ------GMAVIFKNE- 78
            V+G L    +V  T P++L++ R+ +Q   +A+ A+++K          G+  + +   
Sbjct: 118 LVSGALCGGCSVLATYPLDLVRTRLSIQ---TANLARLHKAKAASAAKPPGVWELLRKTY 174

Query: 79  ----GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFX 134
               GI GL +G+    I  +         YE +R  +   F P        S+G     
Sbjct: 175 TQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGA---- 230

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQT---HYTGVWNGLVTIFKTEGVKGLF 191
                        P  L++ R Q     + +G+     HY  V + L+TI +TEG KG +
Sbjct: 231 --ISGGVAQTITYPFDLLRRRFQ----VLAMGQSELGFHYKSVPDALITIGRTEGFKGYY 284

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           +G+ A + +    ++V   +Y T ++ +
Sbjct: 285 KGLTANLFKVVPSTAVSWVVYETVRDYM 312

>Kwal_23.3965
          Length = 307

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 129/315 (40%), Gaps = 41/315 (13%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           Q++  F S VAG L+   A  VT P++ +KIR+QLQ    A     Y   +     + + 
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQ----YGGILVTFKRLVRQ 65

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG++ L KG   A    I    ++   Y    + LN+L    Q P ++ +  V       
Sbjct: 66  EGVRALWKGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHTGMVGAL---- 117

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     P  +++TR      FI        + + +    I++ EG +G F+G+ ++
Sbjct: 118 SGTCSAIASYPCDVLRTR------FIA-NHSRELSTMLSTAQEIWRHEGFRGFFKGVSSS 170

Query: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHL---TASTISGLGVAVVMNPWDVIL 254
           I+     +S  L  Y + K I  +    +D   + L   +AS I+G+    ++ P D + 
Sbjct: 171 IVSIAVATSSILATYESVK-IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVR 229

Query: 255 TRI----YNQKGD------LYKGP--------IDCLVKTVRIEGVTALYKGFAAQVFRIA 296
            R     + Q G        YK          +   +  V  EG+ ALY G+   + +  
Sbjct: 230 KRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSV 289

Query: 297 PHTIMCLTFMEQTMK 311
           P T++ L   E  ++
Sbjct: 290 PSTVVSLGVYEWCLR 304

>Kwal_55.20868
          Length = 380

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 123/302 (40%), Gaps = 37/302 (12%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G +A  +A     P+++ K R+Q QG + ++ +  YK  +  +  I ++EG +GL KG
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQG-LHSNPSNYYKGILGTLTTIIRDEGARGLYKG 138

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSS-LNQLFFP--DQEPHKVQSVGVNVFXXXXXXXXXX 143
           L    +            YE  RS  L    FP  D   H   ++               
Sbjct: 139 LVPIIMGYFPTWMIYFSVYE--RSKKLYPRIFPSFDFISHSASALTAGT--------VST 188

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               P+++VKTRL   +   K    THYT  ++    ++ TEG++  + G+  ++L    
Sbjct: 189 ILTNPVWVVKTRLMLQTHVNK--NSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-F 245

Query: 204 GSSVQLPIYNTAKNILVKNDLMKDGPALHLT------ASTISGLGVAVVMNPWDVILTRI 257
             ++  PIY   K  L     M      +L       AS+ S +  + +  P +++ TR+
Sbjct: 246 HVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRM 305

Query: 258 YNQKGDLYKGPIDCLVKTVR------------IEGVTALYKGFAAQVFRIAPHTIMCLTF 305
             Q       P+  L KT R             EG+   Y GF A + R  P + + L  
Sbjct: 306 --QLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVS 363

Query: 306 ME 307
            E
Sbjct: 364 FE 365

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI----FKNEGIKG 82
           +A   +  +A T+T P E+++ RMQL+   +   A + K    G+  +    +K+EG++G
Sbjct: 282 IASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRG 341

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQL 115
              G  A     +  +   L  +E  R  L +L
Sbjct: 342 FYSGFTANLARTLPASAITLVSFEYFRKYLTKL 374

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 238 ISGLGVAVVMNPWDVILTRI-----YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQV 292
           ++G    V + P DV  TR+     ++   + YKG +  L   +R EG   LYKG    +
Sbjct: 84  MAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPII 143

Query: 293 FRIAPHTIMCLTFMEQTMKL 312
               P  ++  +  E++ KL
Sbjct: 144 MGYFPTWMIYFSVYERSKKL 163

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 76/163 (46%), Gaps = 20/163 (12%)

Query: 148 PLFLVKTRLQS---YSEFIKIGEQT--------------HYTGVWNGLVTIFKTEGVKGL 190
           P  +VKTRLQS    +++     Q               H+   +  +  +++ EG + L
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILVKN-DLMKDGPALHLTASTISGLGVAVVMNP 249
           F+G+   ++      S+    Y T K+I  +  +  ++ P +HL A+  +G   + V NP
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTVTNP 189

Query: 250 WDVILTRIYNQKG--DLYKGPIDCLVKTVRIEGVTALYKGFAA 290
             ++ TR+   K     YK  +DC+   V+ EGV  LYKG +A
Sbjct: 190 IWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSA 232

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 141/340 (41%), Gaps = 50/340 (14%)

Query: 12  IEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQ------------LQGEMSAS 59
           I+  +   +  +  FVAGG+       VT P +++K R+Q            +Q   S++
Sbjct: 40  IKDDSQPAVKPWVHFVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSST 99

Query: 60  AAKV------YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLN 113
              V      +K     +  +++ EG + L KGL    +  I         Y   +   +
Sbjct: 100 LHFVSRSLLHFKETFGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYS 159

Query: 114 QLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTG 173
           +     QE     +  +++               P++LVKTRLQ      K G +T Y  
Sbjct: 160 RTLNNGQE-----APWIHLLAAATAGWATSTVTNPIWLVKTRLQ----LDKAGTKT-YKN 209

Query: 174 VWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHL 233
             + + ++ K EGV GL++G+ A+ L +  G  +Q  +Y   K I+ +  + K G  +H 
Sbjct: 210 SLDCIKSVVKNEGVLGLYKGLSASYLGSVEGI-LQWILYEQMKRIIKERSIEKFG-HIHE 267

Query: 234 TASTIS-------------GLG---VAVVMNPWDVILTRIY---NQKGDL-YKGPIDCLV 273
            A + S             GL     ++V  P +V+ TR+     + G L Y G +    
Sbjct: 268 DAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFR 327

Query: 274 KTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
             ++ EG+ ++Y G    + R  P++I+     E  +KL+
Sbjct: 328 VIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGTWELVIKLL 367

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 115/319 (36%), Gaps = 43/319 (13%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA------------------------SA 60
           + VAGG A        +P++ IK+RMQ+    +A                         A
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 61  AKVYKNP--IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP 118
               K P  I+    I+  EG   L KGL A  I  I     R   YE  R+ L      
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL-----A 128

Query: 119 DQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGE---QTHYTGVW 175
           D++   V +    +               P+ +VK RLQ+  + +       +  YT   
Sbjct: 129 DKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQA--QHLNPNHDLAKPKYTNAV 186

Query: 176 NGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA 235
               TI K EG+  L+RG+     R          +Y+  +  L +    +  P+   + 
Sbjct: 187 QAGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSC 246

Query: 236 -STISGLGVAVVMNPWDVILTRIYNQKGDLYKGP------IDCLVKTVRIEGVTALYKGF 288
              ISG        P D I TR+   K   +KG            + ++ EG  ALYKG 
Sbjct: 247 IGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGI 306

Query: 289 AAQVFRIAPHTIMCLTFME 307
             +V R+AP   +  T  E
Sbjct: 307 TPRVMRVAPGQAVTFTVYE 325

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 84/208 (40%), Gaps = 19/208 (9%)

Query: 20  ISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQLQ--GEMSASAAKVYKNPIQGMAVIFK 76
           +S   +F+AG G     AV V NP+E++KIR+Q Q        A   Y N +Q    I K
Sbjct: 135 VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIK 194

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH-KVQSVGVNVFXX 135
            EGI  L +G++     Q    G+    Y  +R  L +    +  P  +   +G+     
Sbjct: 195 EEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGL----- 249

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTI----FKTEGVKGLF 191
                       PL  +KTRLQ        GE       W  +  I     K EG + L+
Sbjct: 250 -ISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESG-----WKRIAHIGTQLLKEEGFRALY 303

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           +GI   ++R   G +V   +Y   +  L
Sbjct: 304 KGITPRVMRVAPGQAVTFTVYEFVRRHL 331

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 121/289 (41%), Gaps = 19/289 (6%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A  ++     P+++ K R+Q QG  +      Y+  +  ++ I ++EG +GL KG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
           L    +            YE  +   + +F   Q     QS                   
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFHGIF--PQFDFVAQSCAA-----ITAGAASTTLT 194

Query: 147 XPLFLVKTRLQSYSEFIKIGEQ-THYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
            P+++VKTRL   S    +GE  THY G ++    +F  EG K L+ G+  ++L      
Sbjct: 195 NPIWVVKTRLMLQS---NLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-FHV 250

Query: 206 SVQLPIYNTAKNILVKNDLMKDGPALHL----TASTISGLGVAVVMNPWDVILTRIYNQK 261
           ++  PIY   K          +  +++L     AS++S +  + V  P +++ TR+  + 
Sbjct: 251 AIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKS 310

Query: 262 G--DLYKGPIDCLVK-TVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
              D  +  +  L+K T   EG+   Y GF   + R  P + + L   E
Sbjct: 311 DIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 80/200 (40%), Gaps = 16/200 (8%)

Query: 26  FVAGGLAACIA----VTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIK 81
           FVA   AA  A     T+TNPI ++K R+ LQ  +       YK        +F  EG K
Sbjct: 176 FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTH-YKGTFDAFRKLFYQEGFK 234

Query: 82  GLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN--VFXXXXXX 139
            L  GL  +    +GL    + F  PI   L   F      +   S+ +   +       
Sbjct: 235 ALYAGLVPSL---LGLFHVAIHF--PIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSK 289

Query: 140 XXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199
                   P  +++TR+Q  S+     ++     ++  +   +  EG+KG + G    ++
Sbjct: 290 MIASAVTYPHEILRTRMQLKSDIPDSIQRR----LFPLIKATYAQEGLKGFYSGFTTNLV 345

Query: 200 RTGAGSSVQLPIYNTAKNIL 219
           RT   S++ L  +   +N L
Sbjct: 346 RTIPASAITLVSFEYFRNRL 365

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 3/89 (3%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           +A  ++  IA  VT P E+++ RMQL+ ++  S   + +     +   +  EG+KG   G
Sbjct: 283 MASSVSKMIASAVTYPHEILRTRMQLKSDIPDS---IQRRLFPLIKATYAQEGLKGFYSG 339

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQL 115
                +  I  +   L  +E  R+ L  +
Sbjct: 340 FTTNLVRTIPASAITLVSFEYFRNRLENI 368

 Score = 31.6 bits (70), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 35/81 (43%), Gaps = 8/81 (9%)

Query: 242 GVAVVMNPWDVILTRIYNQ------KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
           GVAV   P DV  TR+  Q      +   Y+G +  L   VR EG   LYKG    V   
Sbjct: 92  GVAVC--PLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGY 149

Query: 296 APHTIMCLTFMEQTMKLVYSI 316
            P  ++  +  E + K  + I
Sbjct: 150 FPTWMIYFSVYEFSKKFFHGI 170

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 108/288 (37%), Gaps = 12/288 (4%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           + +AGG A  +     +P++ IK+RMQ+      S  K     I+    I++NEG     
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA-PGFIKTGGEIYRNEGFLAFY 71

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           KGL A  I        R   YE  R+ L      D+E  KV +    +            
Sbjct: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLL-----ADKETGKVSTGNTFIAGVGAGITEAVV 126

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P+ +VK RLQ+      +     Y        TI K EG   L+RG+     R    
Sbjct: 127 VVNPMEVVKIRLQA-QHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATN 185

Query: 205 SSVQLPIYNTAKNILVKNDLMKDGPALHLTA-STISGLGVAVVMNPWDVILTRIYNQKGD 263
                 +Y+  K  L      +  P+   +    ISG        P D I TR+   K  
Sbjct: 186 QGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKST 245

Query: 264 LYKGPIDCLV----KTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
                +  +     + ++ EG  ALYKG   +V R+AP   +  T  E
Sbjct: 246 KNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAYE 293

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 89/217 (41%), Gaps = 26/217 (11%)

Query: 19  KISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           K+S   +F+AG G     AV V NP+E++KIR+Q Q       A  YKN +Q    I K 
Sbjct: 106 KVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE 165

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL----NQLFFPDQEPHKVQ--SVGVN 131
           EG   L +G++     Q    G+    Y  ++  L    NQ   P  E   +   S  + 
Sbjct: 166 EGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIG 225

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
            F              PL  +KTRLQ       +      T +   L+   + EG + L+
Sbjct: 226 PF-----------SNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALY 271

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG 228
           +GI   ++R   G +V    Y       ++ +L K G
Sbjct: 272 KGITPRVMRVAPGQAVTFTAYE-----FIRKELEKTG 303

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 229 PALHLTASTISGLGVAVVMNPWDVILTR--IY-NQKGDLYKGP--IDCLVKTVRIEGVTA 283
           PA++L A   +GL   +  +P D I  R  IY N  G   K P  I    +  R EG  A
Sbjct: 10  PAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLA 69

Query: 284 LYKGFAAQVFRIAP 297
            YKG  A V  I P
Sbjct: 70  FYKGLGAVVIGITP 83

>Kwal_47.18216
          Length = 333

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 91/237 (38%), Gaps = 54/237 (22%)

Query: 20  ISKFGSFVAG-GLAACIAVTVTNPIELIKIRMQ--------LQGEMSAS----------- 59
           +S   +FVAG G     AV V NP+E++KIR+Q        L+ +++ S           
Sbjct: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSA 166

Query: 60  --------AAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSS 111
                   A   Y+N IQ   VI K EG + L +G++     Q    G+    Y  ++S 
Sbjct: 167 TTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226

Query: 112 LNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQS---------YSEF 162
           L +    D  P    S                    PL  +KTRLQ          +S  
Sbjct: 227 LQEYHQTDMLPSWETS-----LIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRI 281

Query: 163 IKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           + IG Q            + + EG + L++GI   ++R   G +V   +Y   +  L
Sbjct: 282 LAIGRQ------------LIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 109/314 (34%), Gaps = 37/314 (11%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           + VAGG A        +P++ IK+RMQ+         +  +  I     I   EG   L 
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALY 71

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           KGL A  I  I     R   YE  R+        D++   V +    V            
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRT-----LLADRQTGVVSTGNTFVAGVGAGITEAVM 126

Query: 145 XXXPLFLVKTRLQS-YSEFIKIGEQ-------------------------THYTGVWNGL 178
              P+ +VK RLQ+ +  ++ +  Q                           Y       
Sbjct: 127 VVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAA 186

Query: 179 VTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA-ST 237
             I K EG + L+RG+     R          +Y+T K+ L +       P+   +    
Sbjct: 187 YVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGL 246

Query: 238 ISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLV----KTVRIEGVTALYKGFAAQVF 293
           ISG        P D I TR+   K          ++    + +R EG  ALYKG   +V 
Sbjct: 247 ISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVM 306

Query: 294 RIAPHTIMCLTFME 307
           R+AP   +  T  E
Sbjct: 307 RVAPGQAVTFTVYE 320

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 229 PALHLTASTISGLGVAVVMNPWDVILTR--IYN---QKGDLYKGPIDCLVKTVRIEGVTA 283
           PA++L A   +GL  A+  +P D I  R  IY+   ++G   +G I         EG  A
Sbjct: 10  PAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLA 69

Query: 284 LYKGFAAQVFRIAPHTIMCLTFME 307
           LYKG  A V  I P   +  T  E
Sbjct: 70  LYKGLGAVVIGIIPKMAIRFTSYE 93

>Kwal_27.12081
          Length = 369

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 140/346 (40%), Gaps = 50/346 (14%)

Query: 7   KQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQ------------- 53
           K  KQ+   +A+ +  +  FVAGG        VT P +++K R+Q               
Sbjct: 38  KGSKQVSSVSAE-VKPWVHFVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNK 96

Query: 54  -GEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL 112
              + +S  + ++     ++ ++K EG + L KGL    +  I         Y   +   
Sbjct: 97  SSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIY 156

Query: 113 NQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYT 172
           ++ F   +E     +  +++               P++L+KTRLQ      K G    Y 
Sbjct: 157 SRAFNNGEE-----APWIHLISAATAGWATSTATNPIWLIKTRLQ----LDKAGHTRQYK 207

Query: 173 GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALH 232
             W+ L  I + EG  GL++G+ A+ L +  G  +Q  +Y   K ++    + K G   H
Sbjct: 208 NSWDCLKHIIQKEGFFGLYKGLSASYLGSVEGI-LQWLLYEQMKQMIKMRSIEKFG---H 263

Query: 233 LTA---------------STISGLG---VAVVMNPWDVILTRIYN---QKGDL-YKGPID 270
           ++                S  +GL     ++V  P +V+ TR+     +   L Y G I 
Sbjct: 264 ISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQ 323

Query: 271 CLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
                ++ EG+ ++Y G    + R  P++I+     E  +KL+  +
Sbjct: 324 SFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGTWELVIKLLSDV 369

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 135/319 (42%), Gaps = 42/319 (13%)

Query: 7   KQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKN 66
           K++  + K   Q ++ + + +AG ++  +A ++T P++ IKIR+QL     A+  K + +
Sbjct: 3   KEEDSLRK--GQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGS 57

Query: 67  PIQGMA-VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV 125
            +  +A  + KNEGI+   KG     +  +    ++   Y    S  N+   P     ++
Sbjct: 58  QVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNRYLTPFGLEARL 113

Query: 126 QSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTE 185
            S+ V  F              P  +++TRL +         Q H   +   +  I+K E
Sbjct: 114 HSLVVGAF----AGITSSIVSYPFDVLRTRLVA-------NNQMHSMSITREVRDIWKLE 162

Query: 186 GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG------PALHLTASTIS 239
           G+ G F+G  A++      +S+    Y T +    +N+             L+ +A TI 
Sbjct: 163 GLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222

Query: 240 GLGVAVVMNPWDVILTRI----------YNQKGDLY-----KGPIDCLVKTVRIEGVTAL 284
           G+   ++  P + I  R+          +++   +Y      G     ++ ++ EGV++L
Sbjct: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282

Query: 285 YKGFAAQVFRIAPHTIMCL 303
           Y+G    + +  P T +  
Sbjct: 283 YRGILVALSKTIPTTFVSF 301

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 84/209 (40%), Gaps = 18/209 (8%)

Query: 21  SKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEM-SASAAKVYKNPIQGMAVIFKNEG 79
           ++  S V G  A   +  V+ P ++++ R+    +M S S  +  ++       I+K EG
Sbjct: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRD-------IWKLEG 163

Query: 80  IKGLQKGLNAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXX 138
           + G  KG + A +  I L  S   G YE IR   ++         K +   +N       
Sbjct: 164 LPGFFKG-SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIG 222

Query: 139 XXXXXXXXXPLFLVKTRLQ--SYSEFIKIGEQTHYTGVWNGL------VTIFKTEGVKGL 190
                    PL  ++ R+Q  +     K    +   G + G       + I K EGV  L
Sbjct: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           +RGI  A+ +T   + V    Y TA + L
Sbjct: 283 YRGILVALSKTIPTTFVSFWGYETAIHYL 311

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 114/277 (41%), Gaps = 30/277 (10%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQKGL 87
           G +A  I   +  P + +K+R+Q Q       A +Y      +   + +EGI KG  +G+
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ------PAHLYPTTWSCIRSTYTDEGIWKGFYQGI 67

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXX 147
            A+ ++   L  + L        S NQ      E  +++ +   ++              
Sbjct: 68  -ASPLFGAALENAVLFV------SFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASFILT 120

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+ LVK +LQ  +    + + T +T VW  + ++ K +G+ GL++G  +  +R   G +V
Sbjct: 121 PVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAV 180

Query: 208 QLPIYNTAKNILVKNDLMKDGPAL---HLTASTISGLGVAVVMN----PWDVILTRIYNQ 260
               Y      ++K       PA    H     +SG    V+ N    P D + +    +
Sbjct: 181 WFTTYE-----IMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTE 235

Query: 261 KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
              +    ++ L K +R  G+T  Y+G    + R AP
Sbjct: 236 HVSI----VNALKKVLRTHGITGFYRGLGITLIRAAP 268

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 76/199 (38%), Gaps = 28/199 (14%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQG-EMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           +G  A   A  +  P+EL+K ++Q+     S S    + +    +  + K +G+ GL +G
Sbjct: 107 SGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQG 166

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ------SVGVNVFXXXXXXX 140
             + ++ +          YE ++     L   ++E H  +      S GV          
Sbjct: 167 QLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGV---------- 216

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
                   +F   T        +K   QT +  + N L  + +T G+ G +RG+   ++R
Sbjct: 217 ---LFNASVFPADT--------VKSVCQTEHVSIVNALKKVLRTHGITGFYRGLGITLIR 265

Query: 201 TGAGSSVQLPIYNTAKNIL 219
               ++     Y T K + 
Sbjct: 266 AAPANATVFYTYETLKKMF 284

>Kwal_23.4731
          Length = 314

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 133/298 (44%), Gaps = 30/298 (10%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG--IKGLQ 84
           +AG  A  +    T+P++L+K+R+QL    + S    YK  I+ +    K +    +   
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHG--YKEVIKTIIRDSKADSNVFREAY 75

Query: 85  KGLNAAYIYQIGLNGSRLGFYE-----PIRSSLNQLFFPDQEP-HKVQSVGVNVFXXXXX 138
           +GL    I      G   G Y        R  + Q+  P Q    K +++G +++     
Sbjct: 76  RGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAA 135

Query: 139 XX--XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      P++++KTR+ S S          Y   W+G+  ++  EG  G +RG+  
Sbjct: 136 LSGLGTAILTNPIWVIKTRIMSTSS----QASERYKTTWDGIRKVYAHEGFSGFWRGLVP 191

Query: 197 AILRTGAGSSVQLPIYNTAKN-ILVKNDLMKD---GPALHLTASTISGLGVAVVMNPWDV 252
           ++     G ++   IY++ ++    +  + +D   G   ++  +++S +     + P+ +
Sbjct: 192 SLFGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPFQL 250

Query: 253 ILTRIYN----QKGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTF 305
           + + + +    +K D Y+     LVK++ + EG+  LYKG +A + R  P T  C+TF
Sbjct: 251 LKSNLQSFAAVEKRDSYR--FWNLVKSIHQKEGLQGLYKGLSANLLRAIPST--CITF 304

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 19/193 (9%)

Query: 30  GLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNA 89
           GL   I   +TNPI +IK R+      S+ A++ YK    G+  ++ +EG  G  +GL  
Sbjct: 138 GLGTAI---LTNPIWVIKTRIM---STSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVP 191

Query: 90  AYIYQIGLNGSRLG-FYEPIRSSLNQLFFPDQEPHKVQSVG--VNVFXXXXXXXXXXXXX 146
           +      L G   G  Y  I  SL   +F  +   + + +G   N+              
Sbjct: 192 S------LFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAV 245

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
            P  L+K+ LQS++      E+      WN + +I + EG++GL++G+ A +LR    + 
Sbjct: 246 YPFQLLKSNLQSFAAV----EKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTC 301

Query: 207 VQLPIYNTAKNIL 219
           +   IY   ++ L
Sbjct: 302 ITFCIYENLRHWL 314

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 129/326 (39%), Gaps = 40/326 (12%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQ---LQGEMSASAAKVYKNPIQGMAV--- 73
           ++ +  FVAGG+       +T P +++K R+Q     G     A        QG+     
Sbjct: 47  VAPWVHFVAGGIGGMAGAIITCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRE 106

Query: 74  -------IFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ 126
                  ++  EG + L KGL    +  I         Y   + + ++L    QE     
Sbjct: 107 TVGIIQNVYTQEGFRSLFKGLGPNLVGVIPARSINFFTYGVTKDTASRLLNDGQE----- 161

Query: 127 SVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG 186
           +  ++                P++LVKTRLQ   +    G    Y   W+ L  + + EG
Sbjct: 162 APWIHFLAGATAGWATSTATNPIWLVKTRLQL--DKAADGRSRRYKNSWDCLKGVMRNEG 219

Query: 187 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTI-------- 238
           + GL++G+ A+ L +   S +Q  +Y   K+I+ +  + + G       +T         
Sbjct: 220 ILGLYKGLSASYLGS-VESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQ 278

Query: 239 -------SGLGVAVVMNPWDVILTRIYN---QKGDL-YKGPIDCLVKTVRIEGVTALYKG 287
                  + L  +++  P +V+ TR+     + G L Y G        ++ EG  ++Y G
Sbjct: 279 RSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSG 338

Query: 288 FAAQVFRIAPHTIMCLTFMEQTMKLV 313
               + R  P++I+     E  +KL+
Sbjct: 339 LTPHLMRTVPNSIIMFGTWELVIKLL 364

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           +F+AGG+A  ++ TV +P E +KI +Q+Q   SA    +    I  +  ++K EG+ GL 
Sbjct: 14  AFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLF 69

Query: 85  K--GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXX-XXXXXX 141
           +  GLN   I+    +  +   YE  +     +F  D    K Q +              
Sbjct: 70  RGNGLNCVRIFP--YSAVQFVVYEWCK---KHIFHVDGTVGKEQLLNWQRLSAGALCGGM 124

Query: 142 XXXXXXPLFLVKTRLQSYSEFI------KIGEQTHYTGVWNGLVTIFKTE-GVKGLFRGI 194
                 PL LV+TRL   +  +      K  +     GVW  LV  FK E G++GL+RGI
Sbjct: 125 SVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 58/133 (43%), Gaps = 18/133 (13%)

Query: 173 GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPAL- 231
           G+ N +  ++K EGV GLFRG     +R    S+VQ  +Y   K  +   D       L 
Sbjct: 51  GIINAVGQVYKEEGVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLL 110

Query: 232 ---HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK-------------GPIDCLVKT 275
               L+A  + G    +   P D++ TR+  Q  +L K             G  + LVKT
Sbjct: 111 NWQRLSAGALCGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKT 170

Query: 276 VRIE-GVTALYKG 287
            + E G+  LY+G
Sbjct: 171 FKEEGGIRGLYRG 183

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 223 DLMKDGPALHLTASTISGLGVAVVMNPWDV--ILTRIYNQKGDLYKGPIDCLVKTVRIEG 280
            L K   ++   A  ++G     V++P++   IL ++ +       G I+ + +  + EG
Sbjct: 5   QLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG 64

Query: 281 VTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIE 317
           V  L++G      RI P++ +     E   K ++ ++
Sbjct: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVD 101

>Scas_669.6
          Length = 373

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 87/212 (41%), Gaps = 21/212 (9%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSA---SAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           AG L   ++  V  P E++K R+QLQG ++     +   Y++    + +I   EG+K L 
Sbjct: 152 AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALF 211

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
            G  A     +  +  + GFYE  R +  +L   D   H + S+   +F           
Sbjct: 212 FGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNL-SIPNEIFTGAIAGGLAGI 270

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHY-----------------TGVWNGLVTIFKTEGV 187
              P+ ++KTRLQ+    I     T                     ++  L  ++++EGV
Sbjct: 271 ITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGV 330

Query: 188 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
            G F G+    + T   SS+ L +Y     +L
Sbjct: 331 IGFFSGVGPRFVWTSVQSSIMLLLYQMTLRLL 362

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 92/233 (39%), Gaps = 26/233 (11%)

Query: 43  IELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQKGLNAAYIYQIGLNGSR 101
           ++ +K R Q      A     YKN       IF  EGI +GL  G  AA +         
Sbjct: 72  LDTVKTRQQ-----GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIF 126

Query: 102 LGFYEPI-RSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQ--- 157
            G YE   R  +  L F D   H   S G+                 P  ++KTRLQ   
Sbjct: 127 FGTYEWCKRKMIGDLGFNDTVSH--LSAGL------LGDFVSSFVYVPSEVLKTRLQLQG 178

Query: 158 -SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 216
              + F + G   +Y  +   +  I  TEGVK LF G  A + R    S++Q   Y   +
Sbjct: 179 RVNNPFFQSGY--NYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFR 236

Query: 217 NI---LVKNDLMKDGPAL--HLTASTISGLGVAVVMNPWDVILTRIYNQKGDL 264
                L K D+ K   ++   +    I+G    ++  P DVI TR+  Q+ D+
Sbjct: 237 QTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADI 289

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 69/150 (46%), Gaps = 11/150 (7%)

Query: 180 TIFKTEGV-KGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTI 238
           TIF  EG+ +GL+ G  AA+L +   +++    Y   K  ++  DL  +    HL+A  +
Sbjct: 97  TIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMI-GDLGFNDTVSHLSAGLL 155

Query: 239 SGLGVAVVMNPWDVILTRI---------YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFA 289
                + V  P +V+ TR+         + Q G  Y+     +   V  EGV AL+ G+ 
Sbjct: 156 GDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYK 215

Query: 290 AQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
           A + R  P + +   F E+  +  + +E +
Sbjct: 216 ATLARDLPFSALQFGFYEKFRQTAFKLEKK 245

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 69/138 (50%), Gaps = 4/138 (2%)

Query: 159 YSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNI 218
           Y +F+   E+   T ++  +  + +T G    F+G    I R    S+V+   Y T K +
Sbjct: 179 YEKFLYY-EKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQM 237

Query: 219 LVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQ-KGDLYKGPIDCLVKTVR 277
           +  N  + +  A  +     S   V  +  P DV+ TR+ ++    LY+  ++C+ +T  
Sbjct: 238 ISPNKPLSEYYAFGI--GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFI 295

Query: 278 IEGVTALYKGFAAQVFRI 295
            EG+T+L+KG+  ++F++
Sbjct: 296 EEGLTSLWKGWVPRLFKV 313

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + +S++ +F  G  ++C  V +T PI+++K RMQ     S     +Y+N +  +   F  
Sbjct: 242 KPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQ-----SKYTWSLYRNSLNCVYRTFIE 296

Query: 78  EGIKGLQKGLNAAYIYQIGLNG 99
           EG+  L KG     ++++GL+G
Sbjct: 297 EGLTSLWKGW-VPRLFKVGLSG 317

>Kwal_47.19228
          Length = 281

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 59/116 (50%), Gaps = 3/116 (2%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG 240
           I+++ G++G  +G    I+R  + S+V+   Y + K ++  N  + +  A  L    IS 
Sbjct: 138 IYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL--GFISS 195

Query: 241 LGVAVVMNPWDVILTRIYNQ-KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
             V  V  P DVI TR+ ++     YK  ++C  +    EG T  +KG+A ++ ++
Sbjct: 196 CAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKV 251

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG 79
           ++++ +F  G +++C  V VT PI++IK RMQ +   S      YKN +     IF  EG
Sbjct: 182 LNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSN-----YKNSLNCAYRIFVEEG 236

Query: 80  IKGLQKGLNAAYIYQIGLNG 99
                KG  A  + ++GL+G
Sbjct: 237 FTKFWKGW-APRLMKVGLSG 255

>Scas_328.1
          Length = 227

 Score = 56.6 bits (135), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 73/155 (47%), Gaps = 17/155 (10%)

Query: 149 LFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQ 208
           L L K  + S ++ IK G    + G+ +       T+GV GL+RG   +++       + 
Sbjct: 57  LRLCKNEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLY 116

Query: 209 LPIYNTAKNILV----KNDLMKD---GPALHLTASTISGLGVAVVMNPWDVILTRIYNQK 261
             +Y++ K +L+    +N  +     G A+ ++AST S         P D +  R+    
Sbjct: 117 FGLYDSLKPVLLTGSFENAFLPSFLLGWAVTISASTTS--------YPLDTVRRRMMMTS 168

Query: 262 GDL--YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
           G    YKG IDC  + V  EGV +L+KG  A +FR
Sbjct: 169 GQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           SF+ G      A T + P++ ++ RM     M++  A  YK  I     I   EG+  L 
Sbjct: 139 SFLLGWAVTISASTTSYPLDTVRRRMM----MTSGQAVKYKGAIDCFQQIVSQEGVYSLF 194

Query: 85  KGLNA 89
           KG  A
Sbjct: 195 KGCGA 199

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL  V+ R+   S     G+   Y G  +    I   EGV  LF+G  A I R  A + V
Sbjct: 156 PLDTVRRRMMMTS-----GQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGV 210

Query: 208 QLPIYNTAKNIL 219
            + +Y+  + +L
Sbjct: 211 -ISLYDQLQLLL 221

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 110/293 (37%), Gaps = 28/293 (9%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           FV+G  A    + V  P++++K RMQLQ      +   Y   I  +  I K EG   L K
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G+++  + +     ++    +  +     L+  D+   +     +++             
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQ-----ISILSGSLAGVTEACV 126

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P  LVK RLQ  +        + + G    +    +  G+  L+ G+++ + R    +
Sbjct: 127 IVPFELVKIRLQDVN--------SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWN 178

Query: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-LGVAVVMNPWDVILTRIYNQKGDL 264
                +    + +L K     +     L A TI G    +       V+ +RI  Q G  
Sbjct: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRI--QSGAT 236

Query: 265 -----------YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP-HTIMCLTF 305
                      Y      L K    EG TALYKGF  ++ R+ P   IM + F
Sbjct: 237 TTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVF 289

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 85/215 (39%), Gaps = 16/215 (7%)

Query: 2   SSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA 61
           + ++S Q    +     K+++  S ++G LA      V  P EL+KIR+Q          
Sbjct: 89  ACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQ-------DVN 141

Query: 62  KVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE 121
             +  P++ +    +  GI  L  GL +        NG   G    IR+ L     P  +
Sbjct: 142 SKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIFQIRALL-----PKAK 196

Query: 122 PHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQT---HYTGVWNGL 178
            +  ++    +                L +VK+R+QS +    + + T    Y   W  L
Sbjct: 197 TNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGAT-TTLADGTVVPKYNWTWPSL 255

Query: 179 VTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYN 213
             I+  EG   L++G    ILR G G  + L ++N
Sbjct: 256 FKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFN 290

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 152 VKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVK-GLFRGIDAAILRTGAGSSVQLP 210
           VKTR Q     +K      Y  + +   T+   EGV+ GL+ G  AA+L +   ++V   
Sbjct: 77  VKTRQQGAPGEVK------YRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFG 130

Query: 211 IYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-----YN----QK 261
            Y   K  ++ N+        HL A  +  L  +VV  P +V+ TR+     YN    Q 
Sbjct: 131 TYEWVKRQMI-NEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQS 189

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
           G  Y+G  D +   VR EGV+AL+ G+ A + R  P + +   F E+  K  + +E +
Sbjct: 190 GYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERK 247

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 79/209 (37%), Gaps = 12/209 (5%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQG---EMSASAAKVYKNPIQGMAVIFKNEG 79
           +    AG L    +  V  P E++K R+QLQG        +   Y+     +  I + EG
Sbjct: 149 YSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEG 208

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ-SVGVNVFXXXXX 138
           +  L  G  A     +  +  +  FYE  R      F  +++P     S    V      
Sbjct: 209 VSALFFGYKATLSRDLPFSALQFAFYERFR---KWAFLLERKPVDGHLSFTAEVVTGASA 265

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNG-----LVTIFKTEGVKGLFRG 193
                    PL +VKTR+Q+                 NG     L+ + + EG+ G F G
Sbjct: 266 GGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSG 325

Query: 194 IDAAILRTGAGSSVQLPIYNTAKNILVKN 222
           +    + T   SS+ L +Y TA   L ++
Sbjct: 326 VGPRFIWTSIQSSIMLLLYQTALRTLARS 354

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 122/316 (38%), Gaps = 46/316 (14%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +++S   S VAG L+   A T   P++ +KI++Q+        A V  N       I K 
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPH--NKNANVLIN-------ILKR 61

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EGI+G  KG     I  I   G++ G Y  I S L      +  P        +      
Sbjct: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLY-----SCLVGSL 116

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSE--FIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                     P  +++TR  + S+   IK+ ++         ++ I+  EG+ G F G  
Sbjct: 117 AGMTSSLASYPFDVLRTRFAANSQGQLIKLRDE---------IMAIWSHEGLMGFFSGCG 167

Query: 196 AAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG----PALHLTASTISGLGVAVVMNPWD 251
           ++++  G  +++   +Y + K    +   + D       L+  A  ISG    +   P D
Sbjct: 168 SSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLD 227

Query: 252 VILTRIYNQKG------------DLYKGP-----IDCLVKTVRIEGVTALYKGFAAQVFR 294
            +  RI  +              D+YK       +   +  V+ EG  +LY+G    + +
Sbjct: 228 TVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIK 287

Query: 295 IAPHTIMCLTFMEQTM 310
             P T + L   E  M
Sbjct: 288 SVPSTAISLWSYELFM 303

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/318 (22%), Positives = 130/318 (40%), Gaps = 50/318 (15%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQ------------GEMSASAAKVYKNPIQG-MAV 73
           ++G LA  +A  +  P+++ K R+Q Q            G ++ +    Y + I G +  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 74  IFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE--PHKVQSVGVN 131
           I ++E I+GL KG+    +            YE  + S  + +F + E   H + ++   
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPR-YFNNSEFLSHSMSALTAG 226

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
                           P+++VKTRL   S    I   THY    +  + I+K EG+K  +
Sbjct: 227 AI--------STTLTNPIWVVKTRLMLQSG-KNIKGMTHYKNTLDAFIKIYKVEGIKSFY 277

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNILV--------KNDLMKDGPA-LHLTASTISGLG 242
            G+  ++       ++  P+Y   K +L         +  +  +G +    T ST   LG
Sbjct: 278 SGLIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLG 336

Query: 243 VAVVMN------------PWDVILTRIYNQKGDLYKGPIDCLVKTVRI-EGVTALYKGFA 289
             +V +            P +++ TR+   K D+ K  I  +++T    EG+   Y GF 
Sbjct: 337 RLIVASCGSKMIASTLTYPHEILRTRL-QLKSDM-KPSIKSIIRTTYAKEGIRGFYSGFL 394

Query: 290 AQVFRIAPHTIMCLTFME 307
             +FR  P + + L   E
Sbjct: 395 TNMFRTVPASAITLVSFE 412

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 82/191 (42%), Gaps = 24/191 (12%)

Query: 148 PLFLVKTRLQSY-------------SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
           PL + KTRLQ+              S     G + +Y+G+W  L TI + E ++GL++GI
Sbjct: 123 PLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGK-YYSGIWGTLTTIVRDESIRGLYKGI 181

Query: 195 DAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVM-NPWDVI 253
              +L       +   +Y   K  L       +   L  + S ++   ++  + NP  V+
Sbjct: 182 VPIVLGYFPTWMIYFSVYERCK--LSYPRYFNNSEFLSHSMSALTAGAISTTLTNPIWVV 239

Query: 254 LTRIYNQKGD------LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
            TR+  Q G        YK  +D  +K  ++EG+ + Y G    +F +  H  +     E
Sbjct: 240 KTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLFGLL-HVAIHFPVYE 298

Query: 308 QTMKLVYSIES 318
           +  K+++   S
Sbjct: 299 KLKKVLHCYPS 309

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 77/166 (46%), Gaps = 9/166 (5%)

Query: 154 TRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYN 213
           TR +S +  I+ G  TH+      +  ++K EG + LF+G+   ++      S+    Y 
Sbjct: 101 TRPKSINYVIQAG--THFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYG 158

Query: 214 TAKNILVKN-DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKG-----DLYKG 267
           T K++  K  +  ++ P +HL A+  +G   A   NP  +I TR+   K        YK 
Sbjct: 159 TTKDMYAKAFNNGQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKN 218

Query: 268 PIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
             DCL   +R EG T LYKG +A         +  L + EQ  +L+
Sbjct: 219 SWDCLKSVIRNEGFTGLYKGLSASYLGSVEGILQWLLY-EQMKRLI 263

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 73/347 (21%), Positives = 136/347 (39%), Gaps = 53/347 (15%)

Query: 10  KQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA----------- 58
           KQ E      +  +  FVAGG+       VT P +L+K R+Q    + A           
Sbjct: 40  KQSEIENHPTVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKG 99

Query: 59  -----------SAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEP 107
                       A   +K  +  +  ++K EG + L KGL    +  I         Y  
Sbjct: 100 STRPKSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGT 159

Query: 108 IRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGE 167
            +    + F   QE     +  +++               P++L+KTR+Q      K G+
Sbjct: 160 TKDMYAKAFNNGQE-----TPMIHLMAAATAGWATATATNPIWLIKTRVQ----LDKAGK 210

Query: 168 QT--HYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLM 225
            +   Y   W+ L ++ + EG  GL++G+ A+ L +  G  +Q  +Y   K ++ +  + 
Sbjct: 211 TSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEG-ILQWLLYEQMKRLIKERSIE 269

Query: 226 KDGPALHLTAST---------------ISGLGVAVVMNPWDVILTRIYNQKGDLYKGPID 270
           K G     T ST               ++    ++   P +V+ TR+     +  K    
Sbjct: 270 KFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYT 329

Query: 271 CLVKTVRI----EGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
            LV++ ++    EG+ ++Y G    + R  P++I+     E  ++L+
Sbjct: 330 GLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWEIVIRLL 376

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 91/204 (44%), Gaps = 11/204 (5%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           ++++     +A  ++      +TNPI +IK R+      S   ++ Y++ + G+  +++ 
Sbjct: 116 KEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRIM---STSFVDSRSYRSTVDGIKKLYRI 172

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVG--VNVFXX 135
           EG+ G  +GL  +         S+   Y  +  +L   +F  +   K + +     +   
Sbjct: 173 EGLAGFWRGLVPSL-----FGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITIT 227

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       PL L+K+ LQS+     I  +T +  VW  + TI+  +GV GL++G+ 
Sbjct: 228 SLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHR-VWKLITTIYVRDGVTGLYKGLL 286

Query: 196 AAILRTGAGSSVQLPIYNTAKNIL 219
           A ++R    + +   +Y   ++ L
Sbjct: 287 ANLIRAVPSTCITFCVYENFRHWL 310

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 129/319 (40%), Gaps = 71/319 (22%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQL-------QGEMSASAAKVYKNPIQGMAVIFKNEG 79
           ++G  A  I    T+P++L+K+R+QL       QG       ++ K+  Q     F  E 
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDV-VKRIVKDSKQHS---FFRET 68

Query: 80  IKGLQKGL---NAAYIYQIGL-NGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXX 135
            +GL   L   + A+    GL   S+   ++   + + + F       K  +  + +   
Sbjct: 69  YRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKR-FNNTMNNDKEMTSLMYLLAA 127

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       P++++KTR+ S + F+   +   Y    +G+  +++ EG+ G +RG+ 
Sbjct: 128 AMSGVATSVLTNPIWVIKTRIMS-TSFV---DSRSYRSTVDGIKKLYRIEGLAGFWRGLV 183

Query: 196 AAILRTGAGSSVQLPIYNT-------AKNILVKNDL-------------MKDGPA---LH 232
            ++     G+ +   +Y+T       AK++  K  L             M    A   L 
Sbjct: 184 PSLFGVSQGA-IYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQ 242

Query: 233 LTASTISGLGVAVVMNP------WDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYK 286
           L  S +    V+ V+NP      W +I T IY                 VR +GVT LYK
Sbjct: 243 LLKSNLQSFEVSTVINPKTSHRVWKLI-TTIY-----------------VR-DGVTGLYK 283

Query: 287 GFAAQVFRIAPHTIMCLTF 305
           G  A + R  P T  C+TF
Sbjct: 284 GLLANLIRAVPST--CITF 300

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 2/103 (1%)

Query: 10  KQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQ 69
           K ++K   +K+S         L+  ++VT   P++L+K  +Q     +    K      +
Sbjct: 210 KHVDK--KKKLSNLEYITITSLSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWK 267

Query: 70  GMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL 112
            +  I+  +G+ GL KGL A  I  +         YE  R  L
Sbjct: 268 LITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVYENFRHWL 310

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 111/291 (38%), Gaps = 33/291 (11%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +  S+   FVAG  +      V +P + IK+R+Q     ++     +K P+  +   F+N
Sbjct: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQNETRFKGPLDCVYKTFRN 73

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           +GI+G   G     +  I ++   LG     R  +++  +P+ E   +      +     
Sbjct: 74  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGC---IISGVL 130

Query: 138 XXXXXXXXXXPLFLVKTRLQ-SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG-ID 195
                     P+ L K +LQ  Y +       T Y G  + +  I+  +G++GL++G I 
Sbjct: 131 AGWSVSFIAPPIELAKAKLQVQYDK-----TTTRYKGPLDVIKKIYSAQGIRGLYKGLIS 185

Query: 196 AAILRT----GAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-LGVAVVMNPW 250
             I RT      GS      Y        +N  M +  A++  A   S   G      P 
Sbjct: 186 TLIFRTHFVYWWGS------YELLTRWFRENTKMSEA-AINFWAGGFSASFGFWTTAYPS 238

Query: 251 DVILTRIYNQKGDLYKGPIDCLVKTVR----IEGVTALYKGFAAQVFRIAP 297
           DV+   +     D Y G        V+     +G+   +KGF     R  P
Sbjct: 239 DVVKQVVLCN--DKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 217 NILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKT 275
           N L+ N+       +   A   SG+    V +P+D I  R+   + +  +KGP+DC+ KT
Sbjct: 13  NSLISNETYSR--IMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKT 70

Query: 276 VRIEGVTALYKGF 288
            R +G+   Y GF
Sbjct: 71  FRNQGIRGFYLGF 83

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 99/246 (40%), Gaps = 26/246 (10%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIK-GLQ 84
           F+AGG+   I  +  + ++ +K R Q      A     YK+ +Q    +F  EG + GL 
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQ-----GAPNVHKYKHMLQAYRTMFIEEGFRRGLY 111

Query: 85  KGLNAAYIYQIGLNGSRLGFYE-PIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXX 143
            G  AA +            YE   R+ +N     D   H       + F          
Sbjct: 112 GGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDFFSSFVYV---- 167

Query: 144 XXXXPLFLVKTRLQ---SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
               P  ++KTRLQ    Y+         +Y  + N + TI++TEGV  LF G  A + R
Sbjct: 168 ----PSEVLKTRLQLQGCYNN-PHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLAR 222

Query: 201 TGAGSSVQLPIYNTAKN---ILVKNDLMKDGPALH---LTASTISGLGVAVVMNPWDVIL 254
               S++Q   Y   +    +L   D+ K   ++    +T +   GL   ++  P DV+ 
Sbjct: 223 DLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLA-GILTTPLDVVK 281

Query: 255 TRIYNQ 260
           TR+  Q
Sbjct: 282 TRVQTQ 287

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 77/178 (43%), Gaps = 17/178 (9%)

Query: 152 VKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVK-GLFRGIDAAILRTGAGSSVQLP 210
           VKTR Q      K      Y  +     T+F  EG + GL+ G  AA+L +   +++   
Sbjct: 77  VKTRQQGAPNVHK------YKHMLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAIFFS 130

Query: 211 IYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-----YNQ----K 261
            Y   K  ++ ND   +    HLTA  +     + V  P +V+ TR+     YN      
Sbjct: 131 TYEFTKRTMI-NDYHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNS 189

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
           G  YK   + +    R EGV AL+ G+ A + R  P + +   F E+  +  + +E +
Sbjct: 190 GYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGK 247

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 87/218 (39%), Gaps = 15/218 (6%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA---SAAKVYKNPIQGMAVIFKNEG 79
           F    AG L    +  V  P E++K R+QLQG  +    ++   YK+    +A I++ EG
Sbjct: 149 FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEG 208

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXX 139
           +  L  G  A     +  +  +  FYE  R     L   D   H + S+   +       
Sbjct: 209 VAALFFGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDL-SISNEIVTGACAG 267

Query: 140 XXXXXXXXPLFLVKTRLQS-YSEFIKIGEQTHYTGV----------WNGLVTIFKTEGVK 188
                   PL +VKTR+Q+     I I   T    V          +  L T++ +EG  
Sbjct: 268 GLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFF 327

Query: 189 GLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMK 226
           G F G+    + T   SS+ L +Y  A  +L   +  K
Sbjct: 328 GFFSGVGPRFVWTSVQSSIMLLLYQMALRVLSNRESEK 365

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 115/294 (39%), Gaps = 23/294 (7%)

Query: 16  AAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIF 75
           + +  S+   FVAG  +     TV +P + +K+R+Q   ++ + A   +K P+  +    
Sbjct: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTL 61

Query: 76  KNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXX 135
           KN+GI+GL  G        I ++ + LG     R  L++  +P+ +   +      +   
Sbjct: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISG 118

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKT--------EGV 187
                       P+ L K +LQ   +     + T YTG  + +  +FK          GV
Sbjct: 119 VMAGWTVSFIAAPVELAKAKLQVQYD----AKTTKYTGPIDVVQKVFKQGMATNGILGGV 174

Query: 188 KGLFRG-IDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-LGVAV 245
           + L++G I   I R+          Y        KN  +   PA++  A  +S   G   
Sbjct: 175 RSLYKGLISTLIFRSNF--VFWWGSYELITQWFQKNTNL-SAPAINFWAGGLSASFGFWT 231

Query: 246 VMNPWDVILTRIY-NQKGD-LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
              P DV+   +  N K D  +K     +    R  G+   +KGF     R  P
Sbjct: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/309 (25%), Positives = 117/309 (37%), Gaps = 57/309 (18%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK---NEGIKGL 83
            AGG+A    V V  P +  K+R+Q               P   M V+ K   NEG +G 
Sbjct: 33  TAGGIAQ---VLVGQPFDTTKVRLQ-----------TSSTPTTAMEVVRKLLANEGPRGF 78

Query: 84  QKG-------LNAAYIYQIGLNGSRLGFYEPIRSSLNQ-LFFPDQEPHKVQSVGVNVFXX 135
            KG       + A    Q G+N +   F+    + ++  L  P      V    VN F  
Sbjct: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA 138

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                       P+  V+ RLQ+ +     G    + G    L  I K    K L RG+ 
Sbjct: 139 S-----------PIEHVRIRLQTQT---GSGTNAEFKGP---LECIKKLRHNKALLRGLT 181

Query: 196 AAILRTGAGSSVQLPIYNTAKNILVKNDL-------MKDGPALHLTA-STISGLGVAVVM 247
             ILR G G      +Y      L+ N +        KD PA  L     +SG  + +++
Sbjct: 182 PTILREGHGCGTYFLVYEA----LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMV 237

Query: 248 NPWDVI--LTRIYNQKGDLYKGPIDCLVKTVRIEG-VTALYKGFAAQVFRIAPHTIMCLT 304
            P DVI  + +  N +   +   I  + KT+   G + A +KGF   + R AP       
Sbjct: 238 YPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFA 297

Query: 305 FMEQTMKLV 313
             E  M+L+
Sbjct: 298 TFELAMRLL 306

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL LVK RLQ       +  Q + + + +G  TI ++EG+  +F G+ A  +      + 
Sbjct: 35  PLDLVKCRLQ-------VNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGAC 86

Query: 208 QLPIYN----TAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 263
           +   Y     T  N+L      +   A++L AS  +     +++ PW+ I  +       
Sbjct: 87  KYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPP 146

Query: 264 LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315
             K  ++   K    EG++ LYKG      R  P+T+   T  E+ ++++Y+
Sbjct: 147 FCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 74/192 (38%), Gaps = 15/192 (7%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
             A   A  +A  +  P E IK++ Q       +     KN ++G + I   EG+ GL K
Sbjct: 116 LCASASAEFLADILLCPWEAIKVKQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYK 169

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           G+   +  QI     +   +E I   +  +L    QE    Q +GV+             
Sbjct: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAV 229

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P  ++ +++ +     K GE      +      I+   G  GL+ G+   I   G  
Sbjct: 230 VSHPADVMVSKVNADR---KQGES-----MVEASKRIYSRIGFGGLWNGLPVRIFMIGTL 281

Query: 205 SSVQLPIYNTAK 216
           +S Q  IY++ K
Sbjct: 282 TSFQWLIYDSFK 293

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 113/297 (38%), Gaps = 41/297 (13%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S ++G  A      V  PI+ +K R+Q +G                    F+N G +G+ 
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG------------------FFRNGGYRGVY 49

Query: 85  KGLNAAYIYQIGLNGSRLGF--YEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXX 142
           +GL +A +      G+ L F  Y+  ++     F        V  V  ++F         
Sbjct: 50  RGLGSAVVASA--PGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAA 107

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG----LFRGIDAAI 198
                P  +VK R Q+++        +H +  W  L  I K E  +G    L+RG    I
Sbjct: 108 CMVRVPAEVVKQRSQTHA--------SHSS--WETLREILKNENGEGVRRNLYRGWSTTI 157

Query: 199 LRTGAGSSVQLPIYNTAKNILVKNDLM-KDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           +R    + +Q P+Y   K +  + D   +  P       +I+G   A    P D + TR+
Sbjct: 158 MREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRL 217

Query: 258 YNQKGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
              K  +   P+  LV T+ + EG    + G   +   I+    + L   E    L+
Sbjct: 218 MLCKKSI---PLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLL 271

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 79/199 (39%), Gaps = 32/199 (16%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG----LQ 84
           G +AAC+   V  P E++K R Q     S+          + +  I KNE  +G    L 
Sbjct: 103 GEIAACM---VRVPAEVVKQRSQTHASHSS---------WETLREILKNENGEGVRRNLY 150

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ-EPHKVQSVGVNVFXXXXXXXXXX 143
           +G +   + +I     +   YE ++    +L   D+ EP K    G              
Sbjct: 151 RGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCG------SIAGGIAA 204

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               PL  +KTRL    + I +G           + TI+K EG K  F G+    +   A
Sbjct: 205 ATTTPLDFLKTRLMLCKKSIPLGTL---------VSTIYKEEGFKVFFSGVGPRTMWISA 255

Query: 204 GSSVQLPIYNTAKNILVKN 222
           G ++ L IY T  ++L  N
Sbjct: 256 GGAIFLGIYETVHSLLSTN 274

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 79/177 (44%), Gaps = 31/177 (17%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTRLQ+   F                   F+  G +G++RG+ +A++ +  G+S+
Sbjct: 25  PIDTLKTRLQAKGGF-------------------FRNGGYRGVYRGLGSAVVASAPGASL 65

Query: 208 QLPIYNTAK-------NILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQ 260
               Y+T K         L+ +  + D    H+ +S++  +   +V  P +V+  R    
Sbjct: 66  FFITYDTCKAETRGFFRGLLPSSNVAD-VVTHMFSSSMGEIAACMVRVPAEVVKQRSQTH 124

Query: 261 KGDLYKGPIDCLVKTVRIEGVTA-LYKGFAAQVFRIAPHTIMCLTF-MEQTMKLVYS 315
                   +  ++K    EGV   LY+G++  + R  P T  C+ F + + MK V++
Sbjct: 125 ASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFT--CIQFPLYEYMKKVWA 179

>Kwal_55.21335
          Length = 317

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 110/272 (40%), Gaps = 24/272 (8%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG-IKGLQKGL 87
           G +A      +  P++ IK+R+Q Q       A V+      +   ++ EG +KG  +G+
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQ------PAHVFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXX 147
            A+ +    L  + L  +     + N L    Q+   V  +   V               
Sbjct: 106 -ASPLVGAALENAVL--FVTFNRAQNFL----QQYESVSPLSQTVLSGAFAGACTSYVLT 158

Query: 148 PLFLVKTRLQ-SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+ L+K  LQ S  E    G  T ++ +W  +  I + +G+ GL++G  +  +R  AG +
Sbjct: 159 PVELIKCTLQVSNLE----GATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGA 214

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALHLTASTIS-GLGVAVVMNPWDVILTRIYNQKGDLY 265
           V    Y + K+ L +     +     L AS  S G+     + P D I +    Q    +
Sbjct: 215 VWFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQ----H 270

Query: 266 KGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
            G +D   + +   G   LY+G    + R AP
Sbjct: 271 LGIVDATKRILARSGPAGLYRGLGITLIRAAP 302

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 74/192 (38%), Gaps = 18/192 (9%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A      V  P+ELIK  +Q+     A+       P   +  I +++GI GL +G
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPT--VKHIVQHKGIGGLWQG 201

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
            ++ +I +          YE ++S L +    D E H  + +                  
Sbjct: 202 QSSTFIRECAGGAVWFTTYESLKSYLARRR-NDTENHTWELLASGA-------SAGVAFN 253

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
             +F   T        IK   QT + G+ +    I    G  GL+RG+   ++R    ++
Sbjct: 254 ASIFPADT--------IKSTAQTQHLGIVDATKRILARSGPAGLYRGLGITLIRAAPANA 305

Query: 207 VQLPIYNTAKNI 218
           +    Y T  N+
Sbjct: 306 IVFYTYETLSNL 317

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 105/273 (38%), Gaps = 39/273 (14%)

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123
           +   ++    I   EGI  L +G++   +  I  N      YE IR         D  P 
Sbjct: 102 FNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIR---------DVSPI 152

Query: 124 KVQSVGVN-VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVW---NGLV 179
                 +N +F              PL LVKT+LQS      I   +  T  W     L+
Sbjct: 153 ASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQS------IPRSSKSTKTWMMVKDLL 206

Query: 180 TIFKTE-----GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLM---KDGPAL 231
              + E       + LF+G++  + R    S++    Y   K  L  +      KD   +
Sbjct: 207 NETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWV 266

Query: 232 HLTAS----TISGLGVAVVMNPWDVILTR----IYNQK----GDLYKGPIDCLVKTVRIE 279
           H   S     ISG+  A+  +P+DV  TR    + N      G+  +     L    R E
Sbjct: 267 HFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTE 326

Query: 280 GVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
           G+ ALY G AA+V +I P   + ++  E + K+
Sbjct: 327 GLAALYTGLAARVIKIRPSCAIMISSYEISKKV 359

>Scas_667.22
          Length = 306

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 117/306 (38%), Gaps = 52/306 (16%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI---FKNEGIKGL 83
            AGG+A    V V  P +  K+R+Q               P   M VI    KNEG KG 
Sbjct: 33  TAGGIAQ---VLVGQPFDTTKVRLQTS-----------STPTTAMEVIRKLLKNEGPKGF 78

Query: 84  QKG-------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX 136
            KG       + A    Q G+N +   F+     S N    PD    ++ S+        
Sbjct: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFH----SRN----PDST-SQILSLPQYYICGL 129

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      P+  V+ RLQ+ +     G    + G    L  I K     G  RG+  
Sbjct: 130 TGGITNSFLASPIEHVRIRLQTQT---GSGPNVEFKGP---LDCIRKLRAQGGFMRGLTP 183

Query: 197 AILRTGAGSSVQLPIYNTAKNILVKNDLMK-----DGPALHLTA-STISGLGVAVVMNPW 250
            +LR G G      +Y      +V N++ K     + PA  L     +SG  + +++ P 
Sbjct: 184 TMLREGHGCGTYFLVYEA----MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPL 239

Query: 251 DVI--LTRIYNQKGDLYKGPIDCLVKTVRIEG-VTALYKGFAAQVFRIAPHTIMCLTFME 307
           DVI  + +  N K   Y   I  + KT+  +G + A +KGF   + R AP         E
Sbjct: 240 DVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFE 299

Query: 308 QTMKLV 313
             M+L+
Sbjct: 300 LAMRLL 305

>Scas_662.12
          Length = 308

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 80/182 (43%), Gaps = 14/182 (7%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG--------VKGLFRGIDAAIL 199
           PL L+K RLQ  +       Q  YT + N L+   K  G        +K  +RG+   +L
Sbjct: 27  PLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIYNLIKESYRGLPINLL 86

Query: 200 RTGAGSSVQLPIYNTAKNILVKND-LMKDGPALHLTASTISGLGVAVVMNPWDVILTRIY 258
                 S+   IYN+ K+ + +N+ L  +   + LT+  ISG+   ++ NP  VI TRI 
Sbjct: 87  GNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLTSGLISGISTTLLTNPLWVIKTRIM 146

Query: 259 N---QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315
           +      D YK         +  EG  A++ G    +  ++   I  + +    +KL ++
Sbjct: 147 STSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLLGVSQGAIYFMIY--DNLKLHFN 204

Query: 316 IE 317
           + 
Sbjct: 205 VN 206

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 125/303 (41%), Gaps = 40/303 (13%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A  +   + +P++LIK+R+QL    +    +      +G   +  NE I   +K 
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQ------KGYTYLI-NELINNSKKM 64

Query: 87  LNAAYIYQI------GLNGSRLG------FYEPIRSSLNQLFFPDQEPHKVQSVGVNVFX 134
            +   IY +      GL  + LG       Y  I +S     F +   H   +  + +  
Sbjct: 65  GSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHN-NNTTIFLTS 123

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        PL+++KTR+ S S       +  Y  + +G  ++   EG K ++ G+
Sbjct: 124 GLISGISTTLLTNPLWVIKTRIMSTSRH----HKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

Query: 195 DAAILRTGAGSSVQLPIYNTAK---NILVKNDLMKDGPALHLTASTISGLG-VAVVMN-- 248
             ++L    G+ +   IY+  K   N+ + N   KD    +L    IS L  +  VM+  
Sbjct: 180 LPSLLGVSQGA-IYFMIYDNLKLHFNVNL-NKSKKDNANANLKIVLISSLSKMLSVMSVY 237

Query: 249 PWDVILTRIYNQKGDLYKGP------IDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMC 302
           P+ ++ + +   +      P      I  + K  R  G+  LYKG +A + R  P T  C
Sbjct: 238 PFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPST--C 295

Query: 303 LTF 305
           +TF
Sbjct: 296 ITF 298

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 80/198 (40%), Gaps = 13/198 (6%)

Query: 26  FVAGGLAACIAVTV-TNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           F+  GL + I+ T+ TNP+ +IK R+      S      YK+   G   +   EG K + 
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIM---STSRHHKDSYKSIRHGFKSLLTKEGPKAIW 176

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN---VFXXXXXXXX 141
            GL  +      L  S+   Y  I  +L   F  +    K  +   N   V         
Sbjct: 177 MGLLPSL-----LGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKML 231

Query: 142 XXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
                 P  L+K+ LQ++        Q  Y  +   +  I++  G+KGL++G+ A +LR 
Sbjct: 232 SVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFI-TLIRKIYRDNGIKGLYKGLSANLLRA 290

Query: 202 GAGSSVQLPIYNTAKNIL 219
              + +   IY   K+ L
Sbjct: 291 IPSTCITFCIYENFKSKL 308

>Kwal_23.3529
          Length = 395

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 11/149 (7%)

Query: 181 IFKTEGVK-GLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTIS 239
           IF  EG++ GL+ G  AA+L +   +++    Y   K  L+ +D   +    HLTA    
Sbjct: 132 IFMEEGIRRGLYGGYTAAMLGSFPSAAIFFGTYELTKRKLI-DDWGVNETLSHLTAGLSG 190

Query: 240 GLGVAVVMNPWDVILTRI-----YN----QKGDLYKGPIDCLVKTVRIEGVTALYKGFAA 290
            L  +VV  P +V+ TR+     YN      G  Y+   D +   VR+EG   L+ G+ A
Sbjct: 191 DLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKA 250

Query: 291 QVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
            + R  P +     F E+  +  +++E +
Sbjct: 251 TLCRDLPFSAFQFAFYEKFRQWAFTLEGK 279

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 81/196 (41%), Gaps = 10/196 (5%)

Query: 25  SFVAGGLAACIAVTVTN-PIELIKIRMQLQGEMSA---SAAKVYKNPIQGMAVIFKNEGI 80
           S +  GL+  +  +V   P E++K R+QLQG  +     +   Y+N    +  I + EG 
Sbjct: 182 SHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGW 241

Query: 81  KGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXX 140
           + L  G  A     +  +  +  FYE  R     L    + P +  S+   +        
Sbjct: 242 QTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTL--EGKTPSQDLSLLNELLTGAAAGG 299

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWN----GLVTIFKTEGVKGLFRGIDA 196
                  P+ ++KTR+Q+        + T    + N    GL  ++++EG  G F G+  
Sbjct: 300 LAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGP 359

Query: 197 AILRTGAGSSVQLPIY 212
             + T   SS+ L +Y
Sbjct: 360 RFIWTSIQSSIMLLLY 375

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 96/265 (36%), Gaps = 35/265 (13%)

Query: 38  TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQKGLNAAYIYQIG 96
           +V + ++ +K R Q      A  A  Y+N I     IF  EGI +GL  G  AA +    
Sbjct: 101 SVMHSLDTVKTRQQ-----GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFP 155

Query: 97  LNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN-----VFXXXXXXXXXXXXXXPLFL 151
                 G YE  +  L            +   GVN     +               P  +
Sbjct: 156 SAAIFFGTYELTKRKL------------IDDWGVNETLSHLTAGLSGDLVSSVVYVPSEV 203

Query: 152 VKTRLQSYSEF--IKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQL 209
           +KTRLQ    +         +Y  + + +  I + EG + LF G  A + R    S+ Q 
Sbjct: 204 LKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQF 263

Query: 210 PIYNTAKNILVKNDLMKDGPALHLT------ASTISGLGVAVVMNPWDVILTRIYNQKGD 263
             Y   +       L    P+  L+          +G    ++  P DVI TRI  Q   
Sbjct: 264 AFYEKFRQWAFT--LEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPS 321

Query: 264 LYKGPIDCLVKTVR--IEGVTALYK 286
                   LV+     I+G+TA+Y+
Sbjct: 322 TVASDSTRLVRIENSLIKGLTAVYR 346

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 5/111 (4%)

Query: 14  KTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQ-----GEMSASAAKVYKNPI 68
           KT +Q +S     + G  A  +A  +T P+++IK R+Q Q        S    ++  + I
Sbjct: 279 KTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLI 338

Query: 69  QGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPD 119
           +G+  ++++EG  G   G+   +I+    +   L  Y+    SL++   P+
Sbjct: 339 KGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSLDRFASPN 389

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 3/116 (2%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG 240
           I+ T G++G  +G    I R    S+V+   Y + K ++  N  + +  A  L    IS 
Sbjct: 277 IYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNEYYAFVL--GFISS 334

Query: 241 LGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
             V  V  P DVI TR+ ++     YK  ++C  +    EG+   +KG+A ++ ++
Sbjct: 335 CAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKV 390

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + ++++ +FV G +++C  V VT PI++IK RMQ     S  A   YKN +     IF  
Sbjct: 319 KPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQ-----SKYAWANYKNSLNCAYRIFVE 373

Query: 78  EGIKGLQKGLNAAYIYQIGLNG 99
           EGI    KG  A  + ++GL+G
Sbjct: 374 EGIPKFWKGW-APRLMKVGLSG 394

>Kwal_33.14050
          Length = 314

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 106/294 (36%), Gaps = 28/294 (9%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSAS---AAKVYKNPIQGMAVIFKNEGIKG 82
             AG  A  +  ++  PI+ IK RMQ       S   AAK+  N +Q +A I   EG   
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFXXXXXXXX 141
           L KG+ +  +     +      YE  +S L +   F   +P K  + G+           
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGI------AATVA 133

Query: 142 XXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
                 P   +K R+Q    F K         +W+    I++ EG+   F      I   
Sbjct: 134 ADLLMNPFDTIKQRMQ-LRTFSK-------DRMWSVASRIYRNEGLAAFFYSYPTTIAMN 185

Query: 202 GAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK 261
              ++    IY +A      N      P +H     ISG   A +  P D I T +  + 
Sbjct: 186 IPFAAFNFAIYESATKFF--NPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRG 243

Query: 262 GDLYKGPI----DCLVKTV----RIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
            +    P+    D   +      ++ G +  ++G   ++    P T +  T  E
Sbjct: 244 SESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 114/300 (38%), Gaps = 41/300 (13%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
            AGG+A    V +  P +  K+R+Q   ++  SAA+V KN       + KNEG KG  KG
Sbjct: 33  TAGGIAQ---VLIGQPFDTTKVRLQTS-KVPTSAAEVVKN-------LLKNEGPKGFYKG 81

Query: 87  -------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ-SVGVNVFXXXXX 138
                  + A    Q G+N            ++ + F      H    S+          
Sbjct: 82  TLTPLVGVGACVSIQFGVN-----------EAMKRFFHARNVDHNATLSLSQYYLCGLTG 130

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAI 198
                    P+  V+ RLQ+ +     G Q  + G  +    I K    KGL RG+   +
Sbjct: 131 GMTNSFLASPIEHVRIRLQTQT---GSGAQAEFKGPID---CIKKLRSQKGLMRGLIPTM 184

Query: 199 LRTGAGSSVQLPIYNTAKNILVKNDLMK-DGPALHLTA-STISGLGVAVVMNPWDVILTR 256
           LR G G      +Y    +  +   L + + P   L     +SG  + +++ P DV+ + 
Sbjct: 185 LREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSV 244

Query: 257 IYNQ---KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +      K    K  I         EG+ A +KGF   + R AP         E  M+L+
Sbjct: 245 MQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 131/300 (43%), Gaps = 40/300 (13%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQG-EMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           ++G  A  I   VT+P++LIK+R+QL   ++  S+   Y N +Q    I K+    G Q+
Sbjct: 17  ISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSS---YYNQVQR---IIKDGS--GTQQ 68

Query: 86  GLNAAY----IYQIGLNGSRLGFYEPI-RSSLNQLFFPDQEP--------HKVQSVGVNV 132
            L  AY    I  IG N    G Y  + R S + ++    EP         +  +  + +
Sbjct: 69  LLKEAYRGLGINIIG-NAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYL 127

Query: 133 FXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFR 192
                          P++++KTR+ S            YT + N +  I+  EG+K  +R
Sbjct: 128 VSAGASGLATALLTNPMWVIKTRIMS------TKSSQGYTSILNAITRIYTEEGLKTFWR 181

Query: 193 GIDAAILRTGAGSSVQLPIYNT--AKNILVKNDLMKDGPALHLTASTIS---GLGVAVVM 247
           G+  ++     G ++   IY+T   K +  +ND+ +       T   IS    + V+ V 
Sbjct: 182 GLVPSLFGVTQG-ALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVY 240

Query: 248 NPWDVILTRIYNQKGDLYKGP-IDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTF 305
            P  ++ T +   + +  +   ++ L++++    G+   YKG  A + R  P T  C+TF
Sbjct: 241 -PLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPST--CITF 297

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 100/225 (44%), Gaps = 30/225 (13%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           +SS+ + Q+K +     +K++     V+ G +      +TNP+ +IK R+     MS  +
Sbjct: 105 LSSEPALQNKFMND---RKMTSSMYLVSAGASGLATALLTNPMWVIKTRI-----MSTKS 156

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLG-FYEPIRSSLNQLFFPD 119
           ++ Y + +  +  I+  EG+K   +GL  +      L G   G  Y  I  +L   +  D
Sbjct: 157 SQGYTSILNAITRIYTEEGLKTFWRGLVPS------LFGVTQGALYFAIYDTLKLKYLHD 210

Query: 120 QEP------HKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTG 173
           +        + V+++G+                 PL L+KT LQ++       E    + 
Sbjct: 211 RNDIQERRLNAVETIGI----ISLSKMISVSSVYPLQLLKTNLQTFRT-----EHNENSK 261

Query: 174 VWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNI 218
           + + + +I+ T G+ G ++G+ A ++R    + +   +Y   K+I
Sbjct: 262 MNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYEHFKHI 306

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 84/191 (43%), Gaps = 28/191 (14%)

Query: 20  ISKFGSFVAGGLAACIA--------VTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           +S FGS + GG+   +A         T    +E+ K +    G +  S+   +K      
Sbjct: 105 LSNFGSGIMGGVTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKE----- 159

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFY----EPIRSSLNQLFFPDQEPHKVQS 127
             I+K +GIKG+ KG+NA  I Q+   GSR GF     E IR++  +   PD +   ++ 
Sbjct: 160 --IYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKT-NPDDKLTALEK 216

Query: 128 VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGV 187
           +  +                P+ +++  +QS  E      +     V +    I+++ G+
Sbjct: 217 IAASAI-----GGGLSAWNQPIEVIRVEMQSKKE---DPNRPKNLTVSSAFKYIYQSSGI 268

Query: 188 KGLFRGIDAAI 198
           KGL+RG+   I
Sbjct: 269 KGLYRGVAPRI 279

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 64/148 (43%), Gaps = 10/148 (6%)

Query: 175 WNGLVTIFKTEGVKGLFRGIDAAILR--TGAGSSVQLP--IYNTAKNILVKNDLMKDGPA 230
           W     I+K +G+KG+ +G++A  +R  T  GS       +    +N   K +      A
Sbjct: 154 WGAFKEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTA 213

Query: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV-----RIEGVTALY 285
           L   A++  G G++    P +VI   + ++K D  + P +  V +      +  G+  LY
Sbjct: 214 LEKIAASAIGGGLSAWNQPIEVIRVEMQSKKEDPNR-PKNLTVSSAFKYIYQSSGIKGLY 272

Query: 286 KGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +G A ++      T+  + F +     V
Sbjct: 273 RGVAPRIGLGVWQTVFMVGFGDMARDFV 300

>Scas_718.5
          Length = 324

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 69/329 (20%), Positives = 124/329 (37%), Gaps = 39/329 (11%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           M+S+ +  +      A          +AG       V V  P +  K+RMQ   + S  A
Sbjct: 18  MASNGNDNNGSSHSMAKDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAK-SVGA 76

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKG-------LNAAYIYQIGLNGSRLGFYEPIRSSLN 113
             + +        + KNEG+    KG       + A    Q G+N +   F+    +S  
Sbjct: 77  LDIIRK-------LVKNEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRG 129

Query: 114 QLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTG 173
                 Q       +G                  P+  V+ RLQ+ +     G +  + G
Sbjct: 130 T-----QHRDGTLQLGQYYICGLTGGVVNSFLASPIEHVRIRLQTQT---GNGNEREFKG 181

Query: 174 VWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHL 233
             + +  + K    K L RG+   +LR G G    L  Y      L+ N++ K      +
Sbjct: 182 PLDCIRKLVKE---KSLMRGLRPMMLRAGHG----LGCYFLTYEALIANEIKKGKDRSEI 234

Query: 234 TA------STISGLGVAVVMNPWDVILTRIYNQ--KGDLYKGPIDCLVKTV-RIEGVTAL 284
            +       ++SG+ + + + P DV+ + I     +   +K  +  ++  + R +G++A 
Sbjct: 235 ASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAF 294

Query: 285 YKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +KGFA  + R AP         E  M+L+
Sbjct: 295 FKGFAPTMLRAAPVNGATFVTFELVMRLL 323

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 110/294 (37%), Gaps = 18/294 (6%)

Query: 7   KQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKN 66
           K D Q +   ++  S+   FV+G  +      V +P + IK+R+Q     ++  +  +K 
Sbjct: 46  KSDIQ-QPPPSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ-----TSQDSTRFKG 99

Query: 67  PIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ 126
           P+  +   F  +GI+G   G     +  I ++   LG     R  L +  + ++E   + 
Sbjct: 100 PLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLS 159

Query: 127 SVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG 186
                +               P+ L K +LQ   +     + T YTG  + +  ++ + G
Sbjct: 160 GC---IISGVMAGWSVSFIAAPVELAKAKLQVQYD----AKTTKYTGPVDVIKKVYSSNG 212

Query: 187 VKGLFRGIDAA-ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAV 245
           V+GL++G+ +  I RT          Y        ++  M D      +    +  G   
Sbjct: 213 VRGLYKGLTSTLIFRTNF--VFWWGSYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWT 270

Query: 246 VMNPWDVILTRIY-NQKGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAP 297
              P DVI   +  N K D          K + R  G    +KGF     R  P
Sbjct: 271 TAYPSDVIKQVVLCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 119/322 (36%), Gaps = 54/322 (16%)

Query: 3   SDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQL-QGEMSASAA 61
           SD   +   +E           + VAGG+    AV   +P +LIK+R Q  Q + +  A 
Sbjct: 2   SDTPAETNILEHKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAV 61

Query: 62  KVYKNPIQGMAVI---------FKNEGIKGLQKG-----LNAAYIYQIGLNGSRLGFYEP 107
            +     + ++ +         FKN  +KG  KG     +    I+ +   G  +G    
Sbjct: 62  SIILKEARSLSTVNGSLTTSLFFKNS-VKGFYKGVIPPLIGVTPIFAVSFWGYDIG---- 116

Query: 108 IRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEF----I 163
                 +L    Q      +                    P   +K  LQ+ SEF    I
Sbjct: 117 -----KRLVTWKQASDAPLTTAQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFI 171

Query: 164 KIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKND 223
           K  +             I  T GVK LF G  A + R G GS++    Y  +K  L K+ 
Sbjct: 172 KAAKH------------IVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSV 219

Query: 224 LMKDGPALHLT----ASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCL--VKTVR 277
             KD   ++L     A  I+G+ + +V+ P D I TR+      +   PI  +   K + 
Sbjct: 220 AKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRL-----QVATTPISMVQATKDIY 274

Query: 278 IE--GVTALYKGFAAQVFRIAP 297
           I+  G+   + G    + R  P
Sbjct: 275 IQRGGIKGFFPGLGPALLRSFP 296

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 89/226 (39%), Gaps = 33/226 (14%)

Query: 8   QDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA---SAAKVY 64
           +D QI  T            AG L   I+  V  P E++K R+QLQG  +     +   Y
Sbjct: 141 EDWQINDTITH-------LSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNY 193

Query: 65  KNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK 124
            N    +  + K EG + L  G  A     +  +  +  FYE  R    QL F  ++   
Sbjct: 194 SNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFR----QLAFKIEQKDG 249

Query: 125 VQ---SVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSY---SEFIKIGEQTHYTGVWNG- 177
                S+   +               P+ +VKTR+Q+    S+  K    TH   V NG 
Sbjct: 250 RDGELSIPNEILTGACAGGLAGIITTPMDVVKTRVQTQQPPSQSNKSYSVTH-PHVTNGR 308

Query: 178 -----------LVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIY 212
                      L T++++EGV G F G+    + T   SS+ L +Y
Sbjct: 309 PAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLY 354

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 169 THYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG 228
           +H+ G    ++ I++T GV+G  +G    I R    S V+   Y      L  +  + + 
Sbjct: 193 SHFAGT---VLEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEY 249

Query: 229 PALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL-YKGPIDCLVKTVRIEGVTALYKG 287
            A    A  +S   V  +  P DVI TR+ ++     YK  ++C  +    EG   ++KG
Sbjct: 250 QA--FAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKG 307

Query: 288 FAAQVFRIA 296
           +  ++F+++
Sbjct: 308 WVPRLFKVS 316

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + + ++ +F AG L++   V +T PI++IK RMQ     S +A   YK+ +     IF  
Sbjct: 244 KALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQ-----SKTAWFTYKSSLNCAYRIFVE 298

Query: 78  EGIKGLQKGLNAAYIYQIGLNG 99
           EG + + KG     ++++ L+G
Sbjct: 299 EGFRYMWKGW-VPRLFKVSLSG 319

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 29/147 (19%), Positives = 55/147 (37%), Gaps = 14/147 (9%)

Query: 74  IFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVF 133
           I++  G++G  +G       Q+G +  R   Y  I  SL+        PHK         
Sbjct: 202 IYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLS--------PHKALDEYQAFA 253

Query: 134 XXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG 193
                         P+ ++KTR+QS + +        Y    N    IF  EG + +++G
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFT------YKSSLNCAYRIFVEEGFRYMWKG 307

Query: 194 IDAAILRTGAGSSVQLPIYNTAKNILV 220
               + +      +   +Y   +N+++
Sbjct: 308 WVPRLFKVSLSGGISFGVYQYVENLVL 334

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 29/65 (44%)

Query: 5  NSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVY 64
          +  QD       A++     S +AG  AA    T+++P E +K   QL   +  +AA   
Sbjct: 3  DGTQDGTEASLVAERHGVRSSVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAAFNM 62

Query: 65 KNPIQ 69
           +P +
Sbjct: 63 LHPFK 67

>Scas_632.9
          Length = 292

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/306 (19%), Positives = 115/306 (37%), Gaps = 21/306 (6%)

Query: 9   DKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPI 68
           D  IEK++ Q  +     V G +A      +  P + +K+R+Q QG      + ++    
Sbjct: 6   DHPIEKSSVQ--NALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQG------SHIFPTTW 57

Query: 69  QGMAVIFKNEGI-KGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQS 127
             +   + NEG+ +G  +G+ +  ++   L  + L        S NQ     ++   V  
Sbjct: 58  SCIKYTYHNEGVWRGFFQGIGSP-LFGAALENATLFV------SYNQCSNVLEKFTNVSP 110

Query: 128 VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGV 187
           +   +               P+ L+K +LQ  +    +  Q  +T +   L+ + + +G+
Sbjct: 111 LSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGI 170

Query: 188 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTIS-GLGVAVV 246
            GL++G  +  +R   G       Y   K  L       +     L  S  S GL     
Sbjct: 171 LGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNAS 230

Query: 247 MNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
           + P D + + +  +   L    I+ + K +   G+T  Y+G    + R  P         
Sbjct: 231 IFPADTVKSMMQTEHITL----INAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMY 286

Query: 307 EQTMKL 312
           E   K+
Sbjct: 287 ETLSKM 292

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 115/273 (42%), Gaps = 34/273 (12%)

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIR--SSLNQLFFPDQE 121
           +   ++    I K EG+  L +G++   +  I  N      YE +R  S LN L+ P   
Sbjct: 110 FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNGLY-PTIN 168

Query: 122 PHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSY-SEFIKIGEQTHYTGVWNGLVT 180
           P         +               PL L+KT+LQS  S  +K G    Y  ++N + +
Sbjct: 169 P---------LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKS 219

Query: 181 IFKTEGV-KGLFRGIDAAILRTGAGSSV---QLPIYNTAKNILVKNDLMKDGPA-LHLTA 235
                GV + +F+G++  + R    S++       Y T    L  +   K+     H T 
Sbjct: 220 EIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTN 279

Query: 236 ST----ISGLGVAVVMNPWDVILTR-----IYNQK---GDLYKGPIDCLVKTV----RIE 279
           S     ISG   A+  +P+DV  TR     + ++K    +L  G  + +   +    + E
Sbjct: 280 SFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTE 339

Query: 280 GVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
           G+ ALY G A +V +IAP   + ++  E T +L
Sbjct: 340 GIGALYTGLAPRVAKIAPSCAIMISSYELTKRL 372

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/58 (22%), Positives = 26/58 (44%)

Query: 250 WDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
           W+    +  N +   + G ++   K  + EGVT L++G +  +    P  ++  T  E
Sbjct: 95  WESTCFQNLNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYE 152

>Scas_687.15*
          Length = 328

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG 240
           I+ T G++G  +G    + R  + S+V+   Y T K ++     + +  A  +     S 
Sbjct: 187 IYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEVYAFGI--GLFSS 244

Query: 241 LGVAVVMNPWDVILTRIYNQKGD-LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
             V  +  P DV+ TR+ ++     YK  ++C  +    EG+ +L+KG+  ++F++
Sbjct: 245 CAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVEEGMVSLWKGWLPRLFKV 300

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 15  TAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI 74
           +  Q +++  +F  G  ++C  V +T PI+++K RMQ     S +A   YKN +     +
Sbjct: 226 SPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQ-----SKTAHYFYKNSLNCAYRV 280

Query: 75  FKNEGIKGLQKGLNAAYIYQIGLNG 99
           F  EG+  L KG     ++++GL+G
Sbjct: 281 FVEEGMVSLWKGW-LPRLFKVGLSG 304

>Scas_562.12
          Length = 300

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 69/163 (42%), Gaps = 6/163 (3%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G V I K EG+  L+RG      R   GS         AK 
Sbjct: 140 DVLKIKRQTNPEAFKG--RGFVKILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKE 197

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D  +   + +  +S +      +V  P DVI TRI N+  D  +  +  +  T 
Sbjct: 198 YILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRSFDNPETGLTIVKNTF 257

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
           + EG+TA +KG   ++    P  +      +  +    S+ S+
Sbjct: 258 KNEGITAFFKGLTPKLLTTGPKLVFSFALAQSLIPKFDSLLSK 300

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 12/66 (18%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI---FKNEGIK 81
           +F++  + A  ++ V+ P+++IK R+Q          + + NP  G+ ++   FKNEGI 
Sbjct: 213 NFISSIVGASCSLIVSAPLDVIKTRIQ---------NRSFDNPETGLTIVKNTFKNEGIT 263

Query: 82  GLQKGL 87
              KGL
Sbjct: 264 AFFKGL 269

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 65/151 (43%), Gaps = 6/151 (3%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G + I + EG+  L+RG      R   GS         AK 
Sbjct: 140 DVLKIKRQTNPESFKG--RGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKE 197

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D  +   + +  +S +      +V  P DVI TRI N+  D  +  +  +  T+
Sbjct: 198 YILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTL 257

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
           + EGVTA +KG   ++    P  +      +
Sbjct: 258 KNEGVTAFFKGLTPKLLTTGPKLVFSFALAQ 288

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 12/66 (18%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI---FKNEGIK 81
           +F++  + AC ++ V+ P+++IK R+Q          + + NP  G+ ++    KNEG+ 
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTRIQ---------NRNFDNPESGLRIVKNTLKNEGVT 263

Query: 82  GLQKGL 87
              KGL
Sbjct: 264 AFFKGL 269

>Scas_558.2
          Length = 289

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 113/306 (36%), Gaps = 45/306 (14%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S ++G  A      V  PI+ +K R+Q +G                    F+N G  G+ 
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGF------------------FQNGGYHGIY 50

Query: 85  KGLNAAYIYQIGLNGSRLGFYEP----IRSSLNQLFFPD--QEPHKVQSVGVNVFXXXXX 138
           +GL +A +            Y+     +R  + ++      + PH V ++ V++      
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTI-VHMIASSMG 109

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEG----VKGLFRGI 194
                    P  ++K R Q +S              W    TI K E     ++ L+RG 
Sbjct: 110 ELAACLVRVPAEVIKQRTQVHST----------NSSWQTFRTILKNENQEGIIRNLYRGW 159

Query: 195 DAAILRTGAGSSVQLPIYNTAKN--ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDV 252
              I+R    + +Q P+Y   K    L  N++    P       +I+G   A    P D 
Sbjct: 160 STTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDF 219

Query: 253 ILTRIYNQKGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
           + TR+   K  +   PI  L++ + + EG    + G   +   I+    + L   E    
Sbjct: 220 LKTRLMLNKDSI---PIKSLIRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVYETMHF 276

Query: 312 LVYSIE 317
           ++ S+E
Sbjct: 277 MLQSLE 282

>Kwal_23.3042
          Length = 542

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 139/333 (41%), Gaps = 53/333 (15%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAK-----VYKNP------- 67
           I  FG F+AGG++  ++ T T P + IK+ +  + ++S++  K     + KNP       
Sbjct: 222 IRGFGFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKI 281

Query: 68  ----IQGMAVIFKNEGIKGLQ--KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE 121
               ++    +++  GI+      GLNA  ++    +  + G +E  +  + QL      
Sbjct: 282 KSPLVKAATTLYRQGGIRAFYVGNGLNAMKVFP--ESAIKFGSFELAKRLMAQL------ 333

Query: 122 PHKVQ-SVGVNVFXXXXXX----XXXXXXXXPLFLVKTRLQSYSEFIKI-GEQTHYTGVW 175
              VQ + G++ F                  P+  +K R+Q      +  G Q   +   
Sbjct: 334 -EGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAK 392

Query: 176 NGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG-PALHLT 234
           +    ++K  G++  +RGI   I+     +++ L  ++  K   +       G P   +T
Sbjct: 393 D----MYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVT 448

Query: 235 ASTI--------SGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVRIEGVT 282
            S +        SG   A  + P +++ TR+  Q        Y G  D L+KTV+ EG  
Sbjct: 449 MSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQ 508

Query: 283 ALYKGFAAQVFRIAPH---TIMCLTFMEQTMKL 312
            L+KG    + ++ P    + +C   +++ MKL
Sbjct: 509 GLFKGLVPNLAKVCPAVSISYLCYENLKRGMKL 541

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 123/309 (39%), Gaps = 46/309 (14%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA------KVYKNPIQGMAVIFKNE 78
           SFVAGG+    AV   +P +LIK+R Q  G+ +++        K  K  ++G   +F N 
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQ-NGQANSTVHAITNIIKEAKTQVKG--TLFTNS 94

Query: 79  GIKGLQKG-----LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVF 133
            +KG  KG     L    I+ +   G  +G           + F +++       G N  
Sbjct: 95  -VKGFYKGVIPPLLGVTPIFAVSFWGYDVG--------KKLVTFNNKQG------GSNEL 139

Query: 134 XXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVW-NGLVTIFKTEGVKGLFR 192
                         P  LV     + +E +K+  QT   G +     TI K  G+  LF+
Sbjct: 140 TMGQMAAAGFISAIPTTLV----TAPTERVKVVLQTSSKGSFIQAAKTIVKEGGIASLFK 195

Query: 193 GIDAAILRTGAGSSVQLPIYNTAKNIL----VKNDLMKDGPALHLT---ASTISGLGVAV 245
           G  A + R G GS++    Y  +KN L     + D  KD P   L    A  I+G+ + +
Sbjct: 196 GSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWL 255

Query: 246 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIE--GVTALYKGFAAQVFRIAPHTIMCL 303
            + P D I T++   +    +  +    K + ++  G+   + G    + R  P      
Sbjct: 256 AVFPIDTIKTKL---QASSTRQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATF 312

Query: 304 TFMEQTMKL 312
             +E T  L
Sbjct: 313 LGVEMTHSL 321

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 83/201 (41%), Gaps = 30/201 (14%)

Query: 5   NSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVY 64
           N+KQ    E T  Q  +      AG ++A     VT P E +K+ +Q   + S       
Sbjct: 130 NNKQGGSNELTMGQMAA------AGFISAIPTTLVTAPTERVKVVLQTSSKGSF------ 177

Query: 65  KNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGF--YEPIRSSLNQLFFPDQEP 122
              IQ    I K  GI  L KG + A + + G  GS L F  YE  ++ LN    P Q+ 
Sbjct: 178 ---IQAAKTIVKEGGIASLFKG-SLATLARDG-PGSALYFASYEISKNYLNSRQ-PRQDA 231

Query: 123 HKVQSVGV-NV-FXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT 180
            K + V + NV                P+  +KT+LQ+ S    +   T    +  G   
Sbjct: 232 GKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRG--- 288

Query: 181 IFKTEGVKGLFRGIDAAILRT 201
                G+KG F G+  A+LR+
Sbjct: 289 -----GIKGFFPGLGPALLRS 304

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 4/166 (2%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTR+Q+ S           + +   +  I  TEG   L++G+ + +L  G   +V
Sbjct: 37  PIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAV 96

Query: 208 QLPIYNTAKNILVK-NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK 266
               Y   K+ L+   D     P     + T++ +    +MNP+D I  R+     D   
Sbjct: 97  YFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSD--- 153

Query: 267 GPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
               C V+  + EG+ A +  +   +    P   +     E + K+
Sbjct: 154 SMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAALNFVIYESSTKI 199

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/302 (20%), Positives = 106/302 (35%), Gaps = 32/302 (10%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA-KVYKNPIQGMAVIFKNEGIKGLQ 84
             AG  A  +  ++  PI+ IK RMQ      +SAA ++  N +  +A I   EG   L 
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           KG+ +  +     +      YE  +S L      D E  +                    
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMCKSRLI-----DPEDRQTHQPLKTALSGTLATVAADA 135

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P   +K RLQ +              +    V +++ EG+   F      I      
Sbjct: 136 LMNPFDTIKQRLQLHPS----------DSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPF 185

Query: 205 SSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT--------R 256
           +++   IY ++  I   N      P +H     ISG   A +  P D + T         
Sbjct: 186 AALNFVIYESSTKIF--NPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADS 243

Query: 257 IYNQ---KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           + +Q   + D ++     + KT    G +  ++G   ++    P T +  T  E    L+
Sbjct: 244 VQSQLFKEADTFRKAASAIHKTY---GWSGFFRGLKPRIISNMPATAISWTSYEFAKHLL 300

Query: 314 YS 315
           ++
Sbjct: 301 FT 302

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 80/223 (35%), Gaps = 32/223 (14%)

Query: 8   QDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQ--GEMSASAAKVYK 65
           + + I+    Q      + ++G LA   A  + NP + IK R+QL     M+  A ++Y+
Sbjct: 105 KSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAVRMYQ 164

Query: 66  NPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV 125
              +G+A  F              +Y   I +N         I  S  ++F P       
Sbjct: 165 R--EGIAAFFY-------------SYPTTIAMNIPFAALNFVIYESSTKIFNPSNN---- 205

Query: 126 QSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQ------SYSEFIKIGEQTHYTGVWNGLV 179
            +  ++                PL  VKT LQ        S+  K  +            
Sbjct: 206 YNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFR-----KAAS 260

Query: 180 TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKN 222
            I KT G  G FRG+   I+     +++    Y  AK++L  N
Sbjct: 261 AIHKTYGWSGFFRGLKPRIISNMPATAISWTSYEFAKHLLFTN 303

>Kwal_33.15446
          Length = 305

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/305 (20%), Positives = 110/305 (36%), Gaps = 31/305 (10%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +  S+   FV+G  +      V +P + IK+R+Q   +        +K P+  +    + 
Sbjct: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGR-----FKGPLDCVYQTMRQ 68

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           +GI+G   G     +  I ++   LG     R  L +  +  +E   +      +     
Sbjct: 69  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVL 125

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG-IDA 196
                     P+ L K +LQ   +     + T Y G  + +  ++  +G++G+++G +  
Sbjct: 126 AGWSVSFIAAPVELAKAKLQVQYD----AQTTRYRGPLDVIKKVYAADGIRGMYKGLVST 181

Query: 197 AILRT----GAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-LGVAVVMNPWD 251
            I RT      GS      Y         N  + D  A++  A   S   G      P D
Sbjct: 182 LIFRTHFVYWWGS------YELLTRWFKANTNLSD-TAINFWAGGFSASFGFWTTAYPSD 234

Query: 252 VILTRIYNQKGDLYKGPI----DCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
           VI   I     D Y G +    +      R  G+   +KGF     R  P     L   E
Sbjct: 235 VIKQVILCN--DKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFE 292

Query: 308 QTMKL 312
             +++
Sbjct: 293 FVLRV 297

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 116/309 (37%), Gaps = 45/309 (14%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG- 86
           AG +     V V  P +  K+R+Q       +  +V +N       + KNEG+    KG 
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTA-TTRTTTLEVLRN-------LVKNEGVFAFYKGA 91

Query: 87  ------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXX 140
                 +      Q G+N +   F++   +S N    P+     V     N         
Sbjct: 92  LTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLSRSNTLPLSQYYV 147

Query: 141 -------XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG 193
                         P+  ++ RLQ+ +     G    + G W+    I K +   GL RG
Sbjct: 148 CGLTGGVVNSFLASPIEQIRIRLQTQTS---NGGDREFKGPWD---CIKKLKAQGGLMRG 201

Query: 194 IDAAILRTGAGSSVQLPIYNT--AKNI---LVKNDLMKDGPALHLTA-STISGLGVAVVM 247
           +   ++R G G      +Y    A+ I   L +N++    P   L      SG  + + +
Sbjct: 202 LFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEI----PPWKLCLFGAFSGTMLWLTV 257

Query: 248 NPWDVILTRIYNQ--KGDLYKGPIDCLVKTVRI-EGVTALYKGFAAQVFRIAPHTIMCLT 304
            P DV+ + I N   +   YK  I  + KT+   EG+ A +KGF   + R AP       
Sbjct: 258 YPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFL 317

Query: 305 FMEQTMKLV 313
             E  M+ +
Sbjct: 318 TFELVMRFL 326

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/359 (21%), Positives = 137/359 (38%), Gaps = 68/359 (18%)

Query: 9   DKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQ---------GEMSAS 59
            K+  K  + K  +  S  AG L   + +T   P++++++R+  Q         G++S  
Sbjct: 2   SKETRKEGSAK-ERMVSASAGSLVTSLFLT---PLDVVRVRLHQQEMLPSCTCTGQLSKP 57

Query: 60  AAKVY-----------KNP-------IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSR 101
           A KV+           + P       ++G+  I + EG+  L +GL    +  +  N   
Sbjct: 58  AGKVFWQDECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVY 117

Query: 102 LGFYEPIRSSLNQLFFPDQEPHKVQ-SVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYS 160
              YE +R         D  P   +  V   +               PL L++TRLQS  
Sbjct: 118 FSGYEALR---------DNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVP 168

Query: 161 EFIKIGEQTHYTGVWNGLVTIFKTE----GVKGLFRGIDAAILRTGAGSSVQLPIYN--- 213
              +  E+T Y  +   L+   + E    G + LF+G++  + R    S++    Y    
Sbjct: 169 R-ARDTERTIY--LIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCK 225

Query: 214 ---TAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIY------------ 258
               A++    N    D         ++ G   A++ +P+DV  TR+             
Sbjct: 226 TQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVG 285

Query: 259 --NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315
               K D  +G    L    + EG+ ALY G   +V +IAP   + ++  E + K   S
Sbjct: 286 GKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFTS 344

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 92/210 (43%), Gaps = 34/210 (16%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + +S +    A   +  +   +TNP+ +IK RM  +     ++ KV ++ I       KN
Sbjct: 106 KDLSSWMYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLI-------KN 158

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGF--YEPIRSSLNQLFFPDQEPHKVQSVGVNVFXX 135
           +G++GL KGL  A +   G++   L F  Y+ ++   ++L   +++  ++ ++   +   
Sbjct: 159 DGVQGLWKGLVPALV---GVSQGALHFTCYDTLK---HKLVLKNRDSDEITNLET-IAVT 211

Query: 136 XXXXXXXXXXXXPLFLVKTRLQSYS------EFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189
                       P  L+K+ LQS+       + + + +             I+   G+ G
Sbjct: 212 SVSKMLSTSAVYPFQLLKSNLQSFQASENDFKLLPLSKM------------IYSRSGLLG 259

Query: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
            ++G+ A +LR+   + +   IY   K+ L
Sbjct: 260 FYKGLSANLLRSVPSTCITFCIYENFKSFL 289

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 124/289 (42%), Gaps = 32/289 (11%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKN---PIQGMAVIFKNEGIKGL 83
           ++G  A  +   + +P++L K+R+QL   ++++  K Y+N    I G  +    E  +GL
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLL--ITSTTKKGYRNLWSEIVGSDLSLTRELYRGL 70

Query: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXX--X 141
              L    I   GL      ++   R + + L   +      + +   ++          
Sbjct: 71  TVNLVGNTI-AWGL------YFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGML 123

Query: 142 XXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
                 PL+++KTR+ S     K         V   L+   K +GV+GL++G+  A++  
Sbjct: 124 TTVLTNPLWVIKTRMMS-----KANSDLTSMKVLRDLI---KNDGVQGLWKGLVPALVGV 175

Query: 202 GAGSSVQLPIYNTAKNILV-KNDLMKDGPALHLTAST-ISGLGVAVVMNPWDVILTRIYN 259
             G+ +    Y+T K+ LV KN    +   L   A T +S +     + P+ ++ + + +
Sbjct: 176 SQGA-LHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQS 234

Query: 260 ---QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTF 305
               + D    P+  ++ +    G+   YKG +A + R  P T  C+TF
Sbjct: 235 FQASENDFKLLPLSKMIYSR--SGLLGFYKGLSANLLRSVPST--CITF 279

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 83/199 (41%), Gaps = 17/199 (8%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           +++      +A G +      +TNPI +IK R+     M+ S A  YK+   G+  +++ 
Sbjct: 109 RRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRI-----MATSRAGPYKSTFDGVYKLYQT 163

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXX 137
           EG+    +G+  + +  +         Y+ ++   + L     +  +  SV   +     
Sbjct: 164 EGVLAFWRGVVPSLL-GVSQGAIYFALYDTLK--FHYLHSSTDKAERRLSVSEIIGITCI 220

Query: 138 XXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197
                     P  L+K++LQ +            +G+   + T++  EG++G +RG+ A 
Sbjct: 221 SKMISVTSVYPFQLLKSKLQDFGA---------PSGITQLVQTVYSREGIRGFYRGLSAN 271

Query: 198 ILRTGAGSSVQLPIYNTAK 216
           +LR    + +   +Y   K
Sbjct: 272 LLRAVPATCITFFVYENIK 290

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 82/163 (50%), Gaps = 15/163 (9%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P++++KTR+ + S   + G    Y   ++G+  +++TEGV   +RG+  ++L    G+ +
Sbjct: 133 PIWVIKTRIMATS---RAGP---YKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVSQGA-I 185

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTISGLG-VAVVMNPWDVILTRIYNQKGDLYK 266
              +Y+T K   + +    D     L+ S I G+  ++ +++   V   ++   K   + 
Sbjct: 186 YFALYDTLKFHYLHSS--TDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFG 243

Query: 267 GP--IDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
            P  I  LV+TV   EG+   Y+G +A + R  P T  C+TF 
Sbjct: 244 APSGITQLVQTVYSREGIRGFYRGLSANLLRAVPAT--CITFF 284

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 14/131 (10%)

Query: 168 QTHYTGVWNGLVTIF-KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKN---- 222
            T YTG+   +  IF + +  + L+RG+   +L      ++    Y  AK+I +++    
Sbjct: 45  NTTYTGL---IRDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNE 101

Query: 223 ----DLMKDGPA-LHLTASTISGLGVAVVMNPWDVILTRIY-NQKGDLYKGPIDCLVKTV 276
                + +  PA  ++ A+  SG+  AV+ NP  VI TRI    +   YK   D + K  
Sbjct: 102 SATGIMDRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLY 161

Query: 277 RIEGVTALYKG 287
           + EGV A ++G
Sbjct: 162 QTEGVLAFWRG 172

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 35  IAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQ 94
           I+VT   P +L+K ++Q  G  S           Q +  ++  EGI+G  +GL+A  +  
Sbjct: 224 ISVTSVYPFQLLKSKLQDFGAPSGIT--------QLVQTVYSREGIRGFYRGLSANLLRA 275

Query: 95  IGLNGSRLGFYEPIRSSL 112
           +         YE I+  L
Sbjct: 276 VPATCITFFVYENIKYRL 293

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 121/306 (39%), Gaps = 50/306 (16%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88
           GGLA+  A+    P++L+K R+Q   +  AS+ +     ++    +++      L+  + 
Sbjct: 18  GGLASVCAL---QPLDLLKTRLQ---QAQASSLRSVLREVRTTRELWRGTLPSALRTSIG 71

Query: 89  AAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXP 148
           +A +Y   LN SR        +       P  + ++      N+               P
Sbjct: 72  SA-LYLSLLNYSRSALARGSEARTRSSLLPRLQSYQ------NLLTGALSRAAVGLVTMP 124

Query: 149 LFLVKTRLQS--YSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           + ++K R +S  Y+          Y G+      I+++EG +G F+G  A  LR    + 
Sbjct: 125 ITVIKVRYESTLYA----------YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAG 174

Query: 207 VQLPIYNTAKNILVK------------------NDLMKDGPALHLTASTISGLGVAVVMN 248
           + + +Y  AK +L +                     M +G +  L+AS  + L       
Sbjct: 175 LYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTA----- 229

Query: 249 PWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           P+D I TR+  Q   +  G +  L   V  E    L+ G + ++ R A    +     E+
Sbjct: 230 PFDTIKTRMQLQSHPV--GFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEE 287

Query: 309 TMKLVY 314
            +KL++
Sbjct: 288 LLKLLH 293

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGE 55
           V+  L+A +A T+T P + IK RMQLQ  
Sbjct: 215 VSAFLSASLATTLTAPFDTIKTRMQLQSH 243

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 73/189 (38%), Gaps = 11/189 (5%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
            ++GG+A   A  V  P+EL+K ++Q+     ASA   +   +  +  I    G+ GL +
Sbjct: 111 LISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQ 170

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G +  +I +     +    YE ++ SL      D        +   +             
Sbjct: 171 GQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNAS 230

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P   VK+ +           QT +  + N +  IF   G+KG +RG+   + R    +
Sbjct: 231 IFPADTVKSVM-----------QTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPAN 279

Query: 206 SVQLPIYNT 214
           +    I+ T
Sbjct: 280 AAVFYIFET 288

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 56/279 (20%), Positives = 101/279 (36%), Gaps = 27/279 (9%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQK 85
           + G +A      +  P + +K+R+Q Q      A+ V+      +   ++NEGI +G  +
Sbjct: 18  INGSIAGACGKVIEFPFDTVKVRLQTQ------ASNVFPTTWSCIKFTYQNEGIARGFFQ 71

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH-KVQSVGVNVFXXXXXXXXXXX 144
           G+ +  +     N +    Y      L        E H  V  +G  +            
Sbjct: 72  GIASPLVGACLENATLFVSYNQCSKFL--------EKHTNVFPLGQILISGGVAGSCASL 123

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P+ LVK +LQ  +       +T +T V   +  I    G+ GL++G     +R   G
Sbjct: 124 VLTPVELVKCKLQ-VANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFG 182

Query: 205 SSVQLPIYNTAKNILVK----NDLMKDGPALH--LTASTISGLGVAVVMNPWDVILTRIY 258
                  Y   K  L      +D  +D   +   L +   +GL     + P D + + + 
Sbjct: 183 GVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQ 242

Query: 259 NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
            +   L     + + K     G+   Y+G    +FR  P
Sbjct: 243 TEHISL----TNAVKKIFGKFGLKGFYRGLGITLFRAVP 277

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 227 DGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVT-ALY 285
           +G  L +   +I+G    V+  P+D +  R+  Q  +++     C+  T + EG+    +
Sbjct: 11  EGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFF 70

Query: 286 KGFAA 290
           +G A+
Sbjct: 71  QGIAS 75

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 6/156 (3%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G + I K EG+  L+RG      R   GS         AK 
Sbjct: 140 DVLKIKRQTNPEAFKG--RGFLKILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKE 197

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D  +   + +  +S +      +V  P DVI TRI N+  D  +     +  T+
Sbjct: 198 YILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTL 257

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
           + EG TA +KG   ++    P  +      +  + +
Sbjct: 258 KNEGFTAFFKGLTPKLLTTGPKLVFSFALAQSLIPM 293

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 16/145 (11%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL-VKNDLMKDGPALHLTASTIS 239
           +++T G     +G  A I R  A +S+Q   Y   K +L  +ND           +S I+
Sbjct: 150 MYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARND---------KASSVIT 200

Query: 240 GLGVAVVM----NPWDVILTRIYNQKGDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFR 294
           GL  +  +     P DV+ TR+ +Q     YK  ++C+ +    EG+   +KG   +  +
Sbjct: 201 GLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMK 260

Query: 295 IAPHTIMCLTFMEQTMKLVYSIESR 319
           +     +  T  EQ + L+    SR
Sbjct: 261 VGISGGLTFTVYEQ-VSLLLGFSSR 284

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 24  GSFVAGGLAACIA-VTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
            S V  GLA     V +T PI+++K RM     MS +A   YKN +  M  IF  EG+  
Sbjct: 195 ASSVITGLATSFTLVAMTQPIDVVKTRM-----MSQNAKTEYKNTLNCMYRIFVQEGMAT 249

Query: 83  LQKGLNAAYIYQIGLNG 99
             KG    ++ ++G++G
Sbjct: 250 FWKGSIFRFM-KVGISG 265

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 83/196 (42%), Gaps = 38/196 (19%)

Query: 20  ISKFGSFVAGGLAACIA--------VTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           ++ F S + GG+   +          T    +E+ + +    G +  S+  V+KN     
Sbjct: 107 LNNFASGILGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKN----- 161

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKV---QSV 128
             I+K EGI+G+ KG+NA  I Q+   GSR G    +   + ++     +  K+   + +
Sbjct: 162 --IYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKI 219

Query: 129 GVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSE------FIKIGEQTHYTGVWNGLVTIF 182
           G +                P+ +++  +QS  E       + +G+   Y         I+
Sbjct: 220 GASAL-----GGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKY---------IY 265

Query: 183 KTEGVKGLFRGIDAAI 198
           ++ G+KGL+RG+   I
Sbjct: 266 QSNGLKGLYRGVTPRI 281

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 10/148 (6%)

Query: 175 WNGLVTIFKTEGVKGLFRGIDAAILR--TGAGSSVQLP--IYNTAKNILVK-NDLMKDGP 229
           W+    I+K EG++G+ +G++A  +R  T  GS   L   + +  + I  K N   K  P
Sbjct: 156 WSVFKNIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNP 215

Query: 230 ALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRI----EGVTALY 285
              + AS + G G++    P +VI   + ++K D  +     + KT +      G+  LY
Sbjct: 216 FEKIGASALGG-GLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLY 274

Query: 286 KGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +G   ++      T+  + F +   + V
Sbjct: 275 RGVTPRIGLGIWQTVFMVGFGDMAKEFV 302

>Kwal_27.11626
          Length = 299

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 7/151 (4%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G + I K EG  GL+RG      R   GS         AK 
Sbjct: 139 DVLKIKRQTNPESFKG--RGFIKILKDEGF-GLYRGWGWTAARNAPGSFALFGGNAFAKE 195

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D      + +  +S +      +V  P DVI TRI N+  D  +     +  T+
Sbjct: 196 YILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTL 255

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
           + EG+TA +KG   ++    P  +      +
Sbjct: 256 KNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 286

>Kwal_34.15907
          Length = 312

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 78/193 (40%), Gaps = 32/193 (16%)

Query: 20  ISKFGSFVAGGLAACIA--------VTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           +  FG+ + GG++  +A         T    +E+ K +  + G +  S+   +K      
Sbjct: 105 LGNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKE----- 159

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN 131
             I+  EGIKG+ KG+NA  I Q+   GSR G    +   +   F     P    +    
Sbjct: 160 --IYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRD-FTGKTNPDDKLTALEK 216

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEF------IKIGEQTHYTGVWNGLVTIFKTE 185
           +F              P+ +++  +QS  E       + +G    Y         I+++ 
Sbjct: 217 IF-ASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKY---------IYQSS 266

Query: 186 GVKGLFRGIDAAI 198
           G+KGL+RG+   I
Sbjct: 267 GIKGLYRGVAPRI 279

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 64/148 (43%), Gaps = 10/148 (6%)

Query: 175 WNGLVTIFKTEGVKGLFRGIDAAILR--TGAGSSVQLP--IYNTAKNILVKNDLMKDGPA 230
           W+    I+  EG+KG+ +G++A  +R  T  GS   L   +    ++   K +      A
Sbjct: 154 WSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTA 213

Query: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV-----RIEGVTALY 285
           L    ++  G G++    P +VI   + ++K D  + P    V +      +  G+  LY
Sbjct: 214 LEKIFASALGGGLSAWNQPIEVIRVEMQSKKEDPNR-PKKLTVGSAFKYIYQSSGIKGLY 272

Query: 286 KGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +G A ++      T+  + F +   + V
Sbjct: 273 RGVAPRIGLGVWQTVFMVGFGDIAKEFV 300

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 111/302 (36%), Gaps = 45/302 (14%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
           F S ++G  A      V  PI+ IK R+Q +G                    F N G KG
Sbjct: 5   FLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGF------------------FANGGYKG 46

Query: 83  LQKGLNAAYIYQIGLNGSRLGF----YEPIRSS--LNQLFFPDQEPHKVQSVGVNVFXXX 136
           + +GL +A +      G+ L F    Y  ++S   +++L+   Q   ++     ++    
Sbjct: 47  IYRGLGSAVV--ASAPGASLFFISYDYMKVKSRPYISKLY--SQGSEQLIDTTTHMLSSS 102

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG----LFR 192
                      P  +VK R Q +S              W  L +I + +  +G    L+R
Sbjct: 103 IGEICACLVRVPAEVVKQRTQVHST----------NSSWQTLQSILRNDNKEGLRKNLYR 152

Query: 193 GIDAAILRTGAGSSVQLPIYNTAKNILVK-NDLMKDGPALHLTASTISGLGVAVVMNPWD 251
           G    I+R    + +Q P+Y   K    K N   +  P       +I+G   A    P D
Sbjct: 153 GWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLD 212

Query: 252 VILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
            + TR+   K     G +  +++  R EG    + G   +   I+    + L   E    
Sbjct: 213 FLKTRLMLNKTTASLGSV--IIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHS 270

Query: 312 LV 313
           L+
Sbjct: 271 LL 272

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 77/199 (38%), Gaps = 32/199 (16%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK--- 85
           G + AC+   V  P E++K R Q+    S+          Q +  I +N+  +GL+K   
Sbjct: 104 GEICACL---VRVPAEVVKQRTQVHSTNSS---------WQTLQSILRNDNKEGLRKNLY 151

Query: 86  -GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ-EPHKVQSVGVNVFXXXXXXXXXX 143
            G +   + +I     +   YE ++ +  +     Q EP K    G              
Sbjct: 152 RGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICG------SIAGGIAA 205

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               PL  +KTRL        +G           ++ I++ EG    F G+    +   A
Sbjct: 206 ATTTPLDFLKTRLMLNKTTASLGSV---------IIRIYREEGPAVFFSGVGPRTMWISA 256

Query: 204 GSSVQLPIYNTAKNILVKN 222
           G ++ L +Y T  ++L K+
Sbjct: 257 GGAIFLGMYETVHSLLSKS 275

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 81/193 (41%), Gaps = 33/193 (17%)

Query: 20  ISKFGSFVAGGLAACIA--------VTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           ++ FG+ + GG++  +A         T    +E+ K +    G   +S A   +      
Sbjct: 102 LNNFGAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKE------ 155

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN 131
             I+  EGI+G+ KG+NA  I Q+   GSR GF   +   L + F     P    +    
Sbjct: 156 --IYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRK-FTGKTNPDDKLTALEK 212

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYS------EFIKIGEQTHYTGVWNGLVTIFKTE 185
           +F              P+ +++  +QS +      + + +G+   Y         I+++ 
Sbjct: 213 IF-ASAIGGGLSAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRY---------IYQSN 262

Query: 186 GVKGLFRGIDAAI 198
           GVKGL+RG+   I
Sbjct: 263 GVKGLYRGVTPRI 275

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 69/163 (42%), Gaps = 7/163 (4%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G + I K EG  GL+RG      R   GS         AK 
Sbjct: 140 DVLKIKRQTNPESFKG--RGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALFGGNAFAKE 196

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D  +   + +  +S +      +V  P DVI TRI N+  D  +     +  T+
Sbjct: 197 YILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIIKNTL 256

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319
           + EG TA +KG   ++    P  +      +  + +  ++ S+
Sbjct: 257 KNEGFTAFFKGLTPKLLTTGPKLVFSFALAQTLIPIFDNLVSK 299

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 88/233 (37%), Gaps = 21/233 (9%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
           +   +AG  A  +  +V  PI+ +K R+Q     S SA    KN +  ++ I  +EG   
Sbjct: 34  YHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSA----KNMLSQISHISTSEGTLA 89

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXX 142
           L KG+ +  +     +    G YE  + +L  +   D + H      ++           
Sbjct: 90  LWKGVQSVILGAGPAHAVYFGTYEFCKKNL--IDSSDTQTHHPFKTAIS---GACATTAS 144

Query: 143 XXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG 202
                P   +K R+Q  +             VW     I+++EG+   +      ++   
Sbjct: 145 DALMNPFDTIKQRIQLNTS----------ASVWQTTKQIYQSEGLAAFYYSYPTTLVMNI 194

Query: 203 AGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT 255
             ++    IY ++   L  N   +  P +H    +ISG   A +  P D I T
Sbjct: 195 PFAAFNFVIYESSTKFL--NPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKT 245

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 78/210 (37%), Gaps = 18/210 (8%)

Query: 12  IEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           I+ +  Q    F + ++G  A   +  + NP + IK R+QL      ++A V++   Q  
Sbjct: 120 IDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLN-----TSASVWQTTKQ-- 172

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN 131
             I+++EG+           +  I         YE     LN    P  E + +    ++
Sbjct: 173 --IYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLN----PSNEYNPL----IH 222

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQ-SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGL 190
                           PL  +KT LQ   S+ + +               I++  G KG 
Sbjct: 223 CLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGF 282

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILV 220
           +RG    I+     +++    Y  AK+ L+
Sbjct: 283 WRGWKPRIVANMPATAISWTAYECAKHFLM 312

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 66/168 (39%), Gaps = 11/168 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTR+QS +      +      + + +  I  +EG   L++G+ + IL  G   +V
Sbjct: 53  PIDALKTRIQSAN-----AKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAV 107

Query: 208 QLPIYN-TAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-YNQKGDLY 265
               Y    KN++  +D     P     +   +      +MNP+D I  RI  N    ++
Sbjct: 108 YFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVW 167

Query: 266 KGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +       +  + EG+ A Y  +   +    P         E + K +
Sbjct: 168 QT----TKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFL 211

>Kwal_23.5757
          Length = 307

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 114/284 (40%), Gaps = 42/284 (14%)

Query: 29  GGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87
           GGL AC    +   P++L+K R Q+        A +YK+ + G   I ++EG   +  G+
Sbjct: 25  GGLVACGPTHSAVTPLDLVKCRRQVD-------ASLYKSNLDGWRQIVRSEGATKVFTGV 77

Query: 88  NAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
            A  I    L G+ + G YE  +   +QL      P    S    +F             
Sbjct: 78  GATAI-GYSLQGAFKYGGYEFFKHQYSQLV----SPETAHSYRTGIFLAASASAE----- 127

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYT-----GVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
              F+    L  + E IK+ +QT         V++    +   EG   L++GI     R 
Sbjct: 128 ---FIADIFLCPW-EAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQ 183

Query: 202 GAGSSVQLPIYNT------AKNILVKNDLMKDGP-ALHLTASTISGLGVAVVMNPWDVIL 254
              +  +   +        A+    K ++ + G  ++      ++G+  AVV +P DV++
Sbjct: 184 IPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMV 243

Query: 255 TRIYNQKGDLYKGPIDCLVKTVRIE---GVTALYKGFAAQVFRI 295
           +++ N++    K     L  T RI    G   L+ G A ++  I
Sbjct: 244 SKVNNER----KSGESTLQATSRIYGKIGFPGLWNGLAVRILMI 283

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 70/177 (39%), Gaps = 21/177 (11%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL LVK R Q         + + Y    +G   I ++EG   +F G+ A    T  G S+
Sbjct: 39  PLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGA----TAIGYSL 86

Query: 208 Q-------LPIYNTAKNILVKNDLMKD-GPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
           Q          +    + LV  +        + L AS  +     + + PW+ I  R   
Sbjct: 87  QGAFKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQT 146

Query: 260 Q-KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315
                  +   D   K V  EG  +LYKG     FR  P+T+   T  E+ ++++Y+
Sbjct: 147 AVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 75/195 (38%), Gaps = 15/195 (7%)

Query: 24  GSFVAGGLAA-CIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
           G F+A   +A  IA     P E IK+R Q     +A      +N     + +   EG   
Sbjct: 117 GIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGFAS 171

Query: 83  LQKGLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFXXXXXXXX 141
           L KG+   +  QI     +   +E I   +  +L  P +E  ++  + V+          
Sbjct: 172 LYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGIL 231

Query: 142 XXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
                 P  ++ +++ +     K GE T           I+   G  GL+ G+   IL  
Sbjct: 232 CAVVSHPADVMVSKVNNER---KSGESTL-----QATSRIYGKIGFPGLWNGLAVRILMI 283

Query: 202 GAGSSVQLPIYNTAK 216
           G  +S Q  IY++ K
Sbjct: 284 GTLTSFQWLIYDSFK 298

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 109/283 (38%), Gaps = 40/283 (14%)

Query: 59  SAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP 118
           ++A  + +  +    I + EG+  L +GL+   +  I  N      YE          F 
Sbjct: 92  NSALRFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYE---------MFR 142

Query: 119 DQEPHKVQSVGVN-VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIK-IGEQTHYTGVWN 176
           D  P +     +N +F              PL L+KTRLQS     K    Q  +  +  
Sbjct: 143 DHSPMRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLK 202

Query: 177 GLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYN-TAKNILVKNDLMKDGPALHLTA 235
                 ++ G K LF+G++  + R    S++    Y    KN  +  D  +     +L+ 
Sbjct: 203 ETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWI--DFSEQCLRWNLSP 260

Query: 236 S-----------TISGLGVAVVMNPWDVILTRIY-------NQKGDLY--------KGPI 269
           +           ++SG   A++ +P+DV  TR+         Q+  L         +G  
Sbjct: 261 NWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMF 320

Query: 270 DCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
             L    + EG  ALY G   +V +IAP   + ++  E + +L
Sbjct: 321 KFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKRL 363

 Score = 35.0 bits (79), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 78/207 (37%), Gaps = 16/207 (7%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQL--QGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
            G  A  +A T   P+ELIK R+Q   +     +   ++K+ ++      ++ G K L K
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK 218

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXX-----XXXXX 140
           GL       +  +    G YE  + +   + F +Q      S   + F            
Sbjct: 219 GLEITLWRDVPFSAIYWGSYEFYKKNF-WIDFSEQCLRWNLSPNWDFFINSFIGGSVSGS 277

Query: 141 XXXXXXXPLFLVKTRLQ--------SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFR 192
                  P  + KTR+Q          +  +   ++    G++  L  I +TEG   L+ 
Sbjct: 278 SAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYT 337

Query: 193 GIDAAILRTGAGSSVQLPIYNTAKNIL 219
           G+   +++     ++ +  Y  +K + 
Sbjct: 338 GLIPRVMKIAPSCAIMISTYELSKRLF 364

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 69/158 (43%), Gaps = 8/158 (5%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G V I K EG+ GL+RG      R   GS         AK 
Sbjct: 139 DVLKIKRQTNPEAFKG--RGFVKILKDEGL-GLYRGWGWTAARNAPGSFALFGGNAFAKE 195

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D  +   + +  +S +      ++  P DVI TRI N+  +  +     +  T+
Sbjct: 196 YILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNKNFENPESGFTIVKNTL 255

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVY 314
           + EG +A +KG   ++    P  +     + QT+  V+
Sbjct: 256 KNEGFSAFFKGLTPKLLTTGPKLVFSFA-LAQTLIPVF 292

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 73/202 (36%), Gaps = 22/202 (10%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           ++S + + V G  A      +T PI +IK+R +       S    YK+  +    I   E
Sbjct: 104 QLSMYENLVTGAFARGTVGYITMPITIIKVRYE-------STLYNYKSIAEAAKSIAAQE 156

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL-----NQLFFPDQEPHKV--QSVGVN 131
           GI+G  +G     +     +G  +  YE ++ +L       L   D E       S  +N
Sbjct: 157 GIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAIN 216

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
                           P   +KTR+Q         E T +   W+ L TI   E    +F
Sbjct: 217 STSAILSASMATTVTAPFDTIKTRMQL--------EPTKFKTFWSTLTTIVTQEHPIKIF 268

Query: 192 RGIDAAILRTGAGSSVQLPIYN 213
            G+   + R    + +   IY 
Sbjct: 269 SGLSMRLTRKALSAGIAWGIYE 290

 Score = 35.0 bits (79), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 110/284 (38%), Gaps = 32/284 (11%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQ-LQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           AGGL++ +A+    P++L+K R Q  +G       K    P Q    +++      ++  
Sbjct: 13  AGGLSSAVAL---QPLDLLKTRFQQTKGGTLWQTVKSLDTPWQ----LWRGTLPSAIRTS 65

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ-SVGVNVFXXXXXXXXXXXX 145
           + +A +Y   LN  R    +  +          +  +  Q S+  N+             
Sbjct: 66  VGSA-LYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYI 124

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P+ ++K R +S           +Y  +     +I   EG++G FRG     LR    S
Sbjct: 125 TMPITIIKVRYES--------TLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYS 176

Query: 206 SVQLPIY----NTAKNILVKNDLMKDGP---------ALHLTASTISGLGVAVVMNPWDV 252
            + + +Y    +T   IL K+ L  D           A++ T++ +S      V  P+D 
Sbjct: 177 GLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDT 236

Query: 253 ILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
           I TR+  +    +K     L   V  E    ++ G + ++ R A
Sbjct: 237 IKTRMQLEPTK-FKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKA 279

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 37/180 (20%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL L+KTR Q          QT    +W    T+   +    L+RG   + +RT  GS++
Sbjct: 24  PLDLLKTRFQ----------QTKGGTLWQ---TVKSLDTPWQLWRGTLPSAIRTSVGSAL 70

Query: 208 QLPIYNTAKNILVKN------DLMKDG-----PALHLTASTISGL----GVAVVMNPWDV 252
            L   N  +  L K       D +  G     P L +  + ++G      V  +  P  +
Sbjct: 71  YLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITI 130

Query: 253 ILTR----IYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308
           I  R    +YN     YK   +        EG+   ++GF     R AP++ + +   E+
Sbjct: 131 IKVRYESTLYN-----YKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEK 185

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 74/178 (41%), Gaps = 17/178 (9%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           +V G  + C    +  PIE ++IR+QLQ +  A+A   Y+  +  M  + K      L +
Sbjct: 122 YVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAE--YQGSLDCMRKLLKQ---GALMR 176

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP--DQEPHKVQSVGVNVFXXXXXXXXXX 143
           G  A  +      G     YE + ++ ++   P  D  P KV   G              
Sbjct: 177 GFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGA------FSGACYW 230

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRT 201
               P+ +VK+ +QS     ++    H T VW    +I+ T G +   +G   A+LR+
Sbjct: 231 AMAYPIDVVKSIMQS----DRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRS 284

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 117/301 (38%), Gaps = 31/301 (10%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S  AGG+A    V V  P ++ K+RMQ     SA+A  V  +       + KNEGI G  
Sbjct: 29  SGTAGGIAQ---VLVGQPFDITKVRMQTSAG-SATAVDVVTS-------LIKNEGILGFY 77

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           KG  A  +        + G  E ++    ++   + +P K  S+                
Sbjct: 78  KGTLAPLVGVGACVSCQFGVNEAMKRRFRRM---NGDPSKPLSLKQYYVCGVASGCANAF 134

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P+  V+ RLQ  ++ +   E   Y G  + +  + K      L RG  A ++RT  G
Sbjct: 135 LATPIEHVRIRLQLQTKSLANAE---YQGSLDCMRKLLKQ---GALMRGFTATLMRTCHG 188

Query: 205 -----SSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
                S+ +  I N  K  + + D+    P         SG     +  P DV+ + + +
Sbjct: 189 FGIYFSTYEALIANQHKKGIPRKDI---APWKVCIFGAFSGACYWAMAYPIDVVKSIMQS 245

Query: 260 QK--GDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
            +    ++   +  + K++    G  A  KGF   + R  P         E TM+L+  +
Sbjct: 246 DRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLERV 305

Query: 317 E 317
           +
Sbjct: 306 D 306

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 116/300 (38%), Gaps = 43/300 (14%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG- 86
           AGG+A    V V  P +  K+R+Q   E S +A KV K+       + KNEG  G  KG 
Sbjct: 32  AGGIAQ---VLVGQPFDTTKVRLQTS-ETSTNAVKVIKD-------LIKNEGPMGFYKGT 80

Query: 87  ------LNAAYIYQIGLNGSRLGFYEPIRSSLNQ-LFFPDQEPHKVQSVGVNVFXXXXXX 139
                 + A    Q G+N +   F+     + +Q L         V     N F      
Sbjct: 81  LTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLAS--- 137

Query: 140 XXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG-LFRGIDAAI 198
                   P+  ++ RLQ+ +        +  T  + G +   K   V G L RG+   +
Sbjct: 138 --------PIEHIRIRLQTQT-------GSGATAEFKGPIDCIKKLRVNGQLMRGLTPTM 182

Query: 199 LRTGAGSSVQLPIYNTAKNILVKNDLM-KDGPALHLTA-STISGLGVAVVMNPWDVILTR 256
           LR   G  V    Y       VK+ +  KD PA  L      SG  +  ++ P DVI + 
Sbjct: 183 LRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSV 242

Query: 257 IYNQKGDLYKGPIDCLV---KTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           +        K   + L      +  +GV+ L+KGFA  + R AP         E  M+L+
Sbjct: 243 MQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLL 302

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQ 69
           ++ A+Q +S    ++ G         + +PIE I+IR+Q Q    A+A   +K PI 
Sbjct: 109 DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE--FKGPID 163

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 125/328 (38%), Gaps = 43/328 (13%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKI----RMQLQGEMSASAAKVY-KNP------- 67
           I  FG F+AGG +  I+ T T P + IK+    R  L   +  S  KV  KNP       
Sbjct: 193 IRGFGFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKI 252

Query: 68  ----IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123
               I+    +++  GI+    G     I     +  + G +E  +  +  L   +   H
Sbjct: 253 KSPLIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHL---EGVHH 309

Query: 124 KVQSVGVNVFXXXXXX-XXXXXXXXPLFLVKTRLQS--YSEFIKIGEQTHYTGVWNGLVT 180
             +    + +               P+  +K R+Q       +K  E    T        
Sbjct: 310 TSELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTAR-----Q 364

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG-PALHLTASTI- 238
           +++  G+K  +RG+   ++     +++ L  ++  K   +       G P   +T S   
Sbjct: 365 MYRDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFI 424

Query: 239 -------SGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVRIEGVTALYKG 287
                  SG   A V+ P +++ TR+  Q        Y G  D L KTV+ EG   L+KG
Sbjct: 425 VLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKG 484

Query: 288 FAAQVFRIAPH---TIMCLTFMEQTMKL 312
               + ++ P    + +C    ++ MKL
Sbjct: 485 LVPNLAKVCPAVSISYLCYENFKRLMKL 512

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 86/208 (41%), Gaps = 16/208 (7%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           ++SKF +++AGG+   +A     PI+ +K R+Q       +A K  +  I     ++++ 
Sbjct: 312 ELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAP--LDTALKGNELLISTARQMYRDG 369

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK---VQSVGVNVFXX 135
           G+K   +G+    +         LG +    S+L + +   Q       V  V ++ F  
Sbjct: 370 GLKLFYRGVTVGVMGIFPYAALDLGTF----SALKKWYIARQAKMTGVPVDQVTISNFIV 425

Query: 136 ----XXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
                           P+ L++TRLQ+   +        YTG  + L    + EG +GLF
Sbjct: 426 LPMGAFSGTVGATVVYPINLLRTRLQAQGTY---AHPHTYTGFRDVLWKTVQREGYQGLF 482

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           +G+   + +     S+    Y   K ++
Sbjct: 483 KGLVPNLAKVCPAVSISYLCYENFKRLM 510

>Kwal_23.4354
          Length = 343

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 105/269 (39%), Gaps = 32/269 (11%)

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRS-SLNQLFFPDQEP 122
           Y +       I K EG++ L +GL+   +     N      YE +R  S  Q  +P   P
Sbjct: 84  YNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKSRLQDKYPTLNP 143

Query: 123 HKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182
               ++                   PL L +TRLQS     +   ++    +   L+   
Sbjct: 144 LMCGALA---------RVLAATTVAPLELFRTRLQSIP---RSSPKSTTAMMIKDLIKES 191

Query: 183 KTE----GVKGLFRGIDAAILRTGAGSSVQLPIY---------NTAKNILVKNDLMKDGP 229
           + E    G K LFRG++  + R    SS+    Y         ++ K+I+  ++   +  
Sbjct: 192 RYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHF 251

Query: 230 ALHLTASTISGLGVAVVMNPWDVILTR--IYNQKGDLYKGPIDCLVKTV----RIEGVTA 283
                  +  G   AV+ +P+DV  TR  I      L K P   + K +    + EG+ A
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAA 311

Query: 284 LYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
           LY G   +V +IAP   + ++  E   +L
Sbjct: 312 LYTGLVPRVIKIAPSCAIMISTYEVCKRL 340

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 80/211 (37%), Gaps = 14/211 (6%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQL--QGEMSASAAKVYKNPIQGMAVIF 75
            K       + G LA  +A T   P+EL + R+Q   +    ++ A + K+ I+      
Sbjct: 136 DKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEI 195

Query: 76  KNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVG------ 129
              G K L +GL       +  +    G YE  +S+++     D E   V S        
Sbjct: 196 SKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSI----DSEKSIVNSSNSNWNHF 251

Query: 130 VNVFX-XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVK 188
           VN F               P  + KTR+Q  +      E+     ++  L  + K+EG+ 
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQ-ITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 189 GLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
            L+ G+   +++     ++ +  Y   K + 
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 9   DKQIEKTAAQKISKF-GSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP 67
           +K I  ++    + F  SFV G     +A  +T+P ++ K RMQ+    S    K  KN 
Sbjct: 237 EKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNM 296

Query: 68  IQGMAVIFKNEGIKGLQKGL 87
            + +  + K+EG+  L  GL
Sbjct: 297 FKYLNQMRKSEGLAALYTGL 316

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 9/96 (9%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           +S D+  + ++++K   + +  +   ++GGLA   + T   P E+I+ R+Q+    + S 
Sbjct: 245 LSEDD--ELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVS---ALSP 299

Query: 61  AKVYKNPIQGMA----VIFKNEGIKGLQKGLNAAYI 92
             +Y +  Q ++    +IFK  G++G   GL+  YI
Sbjct: 300 KTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYI 335

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 169 THYTGVWNGLVT----IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDL 224
           T YTG   GLV     I+  +GV+G F+G  A +LR    ++V+   Y   +N L+ +  
Sbjct: 69  TKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKE 128

Query: 225 MKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
             +     L + +++GL    +  P D++  R+
Sbjct: 129 F-ESHWRRLVSGSLAGLCSVFITYPLDLVRVRL 160

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 8/119 (6%)

Query: 2   SSDNSKQDKQIEKTAAQKIS-KFGSF-------VAGGLAACIAVTVTNPIELIKIRMQLQ 53
           S D++   K I K   QK S    SF       +AGG++   A T+  P++ IKI  Q  
Sbjct: 5   SPDSNDSYKHINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTS 64

Query: 54  GEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL 112
                         ++    I+ N+G++G  +G +A  +        +   YE IR++L
Sbjct: 65  NPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIRNTL 123

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/224 (19%), Positives = 78/224 (34%), Gaps = 30/224 (13%)

Query: 21  SKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGE-----MSASAAKVYKNPIQGMAVIF 75
           S +   V+G LA   +V +T P++L+++R+  + E     +     K+YK P    A + 
Sbjct: 131 SHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEP--ASATLI 188

Query: 76  KNEGIK-------GLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP---------D 119
           KN+ I           +G     +  I   G     ++ +   L   FF          D
Sbjct: 189 KNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSED 248

Query: 120 QEPHKVQS-------VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYT 172
            E  +VQ            +               P  +++ RLQ  +   K      + 
Sbjct: 249 DELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQ 308

Query: 173 GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 216
            +      IFK  GV+G F G+    ++     +    +Y   K
Sbjct: 309 SISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMK 352

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL  +KTRLQ+       G Q   + +   L +I   EG   L++G+ + +L  G   +V
Sbjct: 38  PLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAV 97

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTISG----LGVAVVMNPWDVILTRI 257
               Y   K+ L+  D        H   +  SG    +    +MNP+DVI  RI
Sbjct: 98  YFATYEMVKSFLI--DEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRI 149

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 71/208 (34%), Gaps = 18/208 (8%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           E T+  K   F +  +G  A   A  + NP ++IK R+QL   +S     V+    +   
Sbjct: 112 EATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNIS-----VWDTAKR--- 163

Query: 73  VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNV 132
            I+  EG +             I       G Y+      N        P  V +  ++ 
Sbjct: 164 -IYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATRYFN--------PSGVYNPFIHC 214

Query: 133 FXXXXXXXXXXXXXXPLFLVKTRLQSY-SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
                          PL  +KT LQ   SE + +               I++  G +G +
Sbjct: 215 LCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFW 274

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNIL 219
            G+   IL     +++    Y  AK+ L
Sbjct: 275 SGVKPRILANMPATAISWTAYEFAKHFL 302

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/232 (18%), Positives = 84/232 (36%), Gaps = 17/232 (7%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAK-VYKNPIQGMAVIFKNEGIKGLQK 85
           +AG  A     +V  P++ +K R+Q    +S +  + +    ++ ++ I   EG   L K
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWK 82

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G+ +  +     +      YE ++S L        + H  ++     F            
Sbjct: 83  GVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTA----FSGATATIAADAL 138

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P  ++K R+Q  +             VW+    I+  EG +  +      +      +
Sbjct: 139 MNPFDVIKQRIQLNTNI----------SVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFA 188

Query: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           +    IY+TA      + +    P +H     ISG   A +  P D I T +
Sbjct: 189 AFNFGIYDTATRYFNPSGVYN--PFIHCLCGGISGAACAGLTTPLDCIKTAL 238

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 83/190 (43%), Gaps = 33/190 (17%)

Query: 20  ISKFGSFVAGGLAACIA--------VTVTNPIELIKIRM-QLQGEMSASAAKVYKNPIQG 70
           ++ FG+ + GG+   +          T    +E+ + +   + G +  S+ +V+K+    
Sbjct: 99  LNNFGAGIMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKS---- 154

Query: 71  MAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGV 130
              I+K EGI+G+ KG+NA  I Q+   GSR G    +   + +L     +  K+ +  +
Sbjct: 155 ---IYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTA--L 209

Query: 131 NVFXXXXXXXXXXXXXXPLFLVKTRLQSYSE------FIKIGEQTHYTGVWNGLVTIFKT 184
                            P+ +++  +QS  E       + +G+   Y         I+++
Sbjct: 210 EKIMASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKY---------IYQS 260

Query: 185 EGVKGLFRGI 194
            G+KGL+RG+
Sbjct: 261 NGLKGLYRGV 270

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 64/147 (43%), Gaps = 8/147 (5%)

Query: 175 WNGLVTIFKTEGVKGLFRGIDAAILR--TGAGSSVQLP--IYNTAKNILVKNDLMKDGPA 230
           W    +I+K EG++G+ +G++A  +R  T  GS   L   + +  + +  K        A
Sbjct: 149 WQVFKSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTA 208

Query: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRI----EGVTALYK 286
           L    ++  G G++    P +VI   + ++K D  +     + KT +      G+  LY+
Sbjct: 209 LEKIMASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYR 268

Query: 287 GFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           G   +V      T+  + F +   + V
Sbjct: 269 GVTPRVGLGIWQTVFMVGFGDMAREFV 295

>Scas_697.47
          Length = 328

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 127/350 (36%), Gaps = 66/350 (18%)

Query: 1   MSSDNSKQDKQI--EKTAAQKI------------SKFGSFVAGGLAACIAVTVTNPIELI 46
           MS D S  D  +  E+T A K                 S VAGG+    AV   +P +LI
Sbjct: 1   MSQDTSLADTTLIKEETHALKARPPVTPPANAIRDNLKSLVAGGVGGVCAVLTGHPFDLI 60

Query: 47  KIRMQLQGEMSASAAKVYKNPIQGMAVIFKN-----------EGIKGLQKG-----LNAA 90
           K+R Q  G+ S++        I  + +I K+             +KG  KG     L   
Sbjct: 61  KVRCQ-SGQASST--------IHAIKIILKDARAIPTSNMLVNSVKGFYKGVIPPLLGVT 111

Query: 91  YIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLF 150
            I+ +   G  +G     RS        D    ++ ++G                  P  
Sbjct: 112 PIFAVSFWGYDVGKKIVTRS--------DSSSAQL-TMGQMAAAGFISAIPTTLVTAPTE 162

Query: 151 LVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLP 210
            +K  LQ+         +T + G    +V   K  GVK LF+G  A + R G GS++   
Sbjct: 163 RIKVVLQTAGA----NSKTSFIGAAKNIV---KDGGVKSLFKGSLATLARDGPGSALYFA 215

Query: 211 IYNTAKNILVKNDLMKDGPALHLT------ASTISGLGVAVVMNPWDVILTRIYNQKG-- 262
            Y  +K  L   +   +     +       A  I+G+ + +V+ P D I T++ +  G  
Sbjct: 216 SYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSGSQ 275

Query: 263 DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
            +     +  VK   I+G    + G    + R  P        +E T  L
Sbjct: 276 SMVAATREIYVKRGGIKG---FFPGLGPALLRSFPANAATFLGVELTHSL 322

>Scas_379.2
          Length = 301

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/296 (20%), Positives = 102/296 (34%), Gaps = 43/296 (14%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
            +AG  A  +  +V  PI+ +K R+Q      +++AK   N +  MA I   EG   L K
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQ------STSAKSTSNMLSQMAKISTAEGSLALWK 80

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           G+ +  +     +      YE  +  L ++      +P K    G               
Sbjct: 81  GVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGT------VATIAADA 134

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P   +K R+Q  +           T VWN    I+K EG    +      +      
Sbjct: 135 LMNPFDTLKQRMQLNTN----------TTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPF 184

Query: 205 SSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT--------- 255
           ++    IY +A      N      P +H  +  +SG   A +  P D I T         
Sbjct: 185 AAFNFMIYESATKFF--NPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSES 242

Query: 256 ---RIYNQKGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFME 307
              ++  +     K       K + ++ G    ++G   +VF   P T +  T  E
Sbjct: 243 VSLQVMKEANTFQKA-----TKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 78/210 (37%), Gaps = 18/210 (8%)

Query: 12  IEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           I++   Q      + ++G +A   A  + NP + +K RMQL    +     V+    Q  
Sbjct: 108 IDEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRMQLNTNTT-----VWNVTKQ-- 160

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN 131
             I+KNEG          +Y   + +N     F   I  S  + F P  + + +    V+
Sbjct: 161 --IYKNEGFSAFYY----SYPTTLAMNIPFAAFNFMIYESATKFFNPTNDYNPL----VH 210

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSY-SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGL 190
                           PL  +KT LQ   SE + +               I++  G KG 
Sbjct: 211 CLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKEANTFQKATKAIYQVHGAKGF 270

Query: 191 FRGIDAAILRTGAGSSVQLPIYNTAKNILV 220
           +RG+   +      +++    Y  AK+ L+
Sbjct: 271 WRGLQPRVFANMPATAIAWTAYECAKHFLL 300

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 224 LMKDGPALH-LTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVT 282
           L    P  H L A   +G+    VM P D + TRI +         +  + K    EG  
Sbjct: 17  LPDSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSL 76

Query: 283 ALYKGFAAQVFRIAP-HTIMCLTF 305
           AL+KG  + +    P H +   T+
Sbjct: 77  ALWKGVQSVILGAGPAHAVYFATY 100

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 9/113 (7%)

Query: 6   SKQDKQIEKTAAQK--ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV 63
           S Q++   K   QK  +  +   VAGGL+  ++ T   P+E+I+ R+Q+    + S  K+
Sbjct: 231 SSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVS---TLSPRKM 287

Query: 64  YKNPIQGMA----VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL 112
           Y +  Q ++    +I++ +G +G   GL+  YI    +       YE ++  L
Sbjct: 288 YDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 340

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 8/121 (6%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           M+  N++Q   ++K +   + + G  +AGG++   A T+  P++ IKI  Q      +  
Sbjct: 1   MTKTNNRQ--AVDKNSLDYVVRSG--LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKY 56

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ 120
           A       +    I+ N+GI+G  +G +   +        +   YE IRS    +  P +
Sbjct: 57  AGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRS----ILIPSR 112

Query: 121 E 121
           E
Sbjct: 113 E 113

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 11/105 (10%)

Query: 163 IKIGEQT---HYT-------GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIY 212
           IKI  QT   HY+       G++     I+  +G++G F+G    +LR    ++V+   Y
Sbjct: 42  IKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAY 101

Query: 213 NTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
              ++IL+ +    +     L + +++GL    +  P D+   R+
Sbjct: 102 EQIRSILIPSR-EYESHWRRLASGSLAGLCSVFITYPLDLTRVRL 145

>Scas_696.9
          Length = 312

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 75/183 (40%), Gaps = 35/183 (19%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S++  G   C+       +E+ +++    G    S+  V+++       I+  EG++G+ 
Sbjct: 123 SYLTMGFCTCMKT-----VEITRLKSASAGAPVQSSWNVFRS-------IYAKEGLRGIY 170

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF---PDQEPHKVQSVGVNVFXXXXXXXX 141
           KG+NA  I Q+   GSR GF   +   + +      P+   +  + +G            
Sbjct: 171 KGVNAVAIRQMTNWGSRFGFSRLVEDWVRKATGKTKPEDRLNAWEKIGATA-----VGGG 225

Query: 142 XXXXXXPLFLVKTRLQSYSE------FIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGID 195
                 P+ +++  +QS  E       + + +   Y         I KT GVKGL+RG+ 
Sbjct: 226 LSAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKY---------IMKTNGVKGLYRGVT 276

Query: 196 AAI 198
             I
Sbjct: 277 PRI 279

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 14/129 (10%)

Query: 175 WNGLVTIFKTEGVKGLFRGIDAAILR--TGAGSSVQLPIYNTAKNILVKNDLMKDGPALH 232
           WN   +I+  EG++G+++G++A  +R  T  GS      ++      V+    K  P   
Sbjct: 154 WNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFG---FSRLVEDWVRKATGKTKPEDR 210

Query: 233 LTA-----STISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKT----VRIEGVTA 283
           L A     +T  G G++    P +VI   + ++K D  +     + KT    ++  GV  
Sbjct: 211 LNAWEKIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKG 270

Query: 284 LYKGFAAQV 292
           LY+G   ++
Sbjct: 271 LYRGVTPRI 279

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 137/331 (41%), Gaps = 49/331 (14%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKI----RMQLQGEMSASAAKVY-KNP------- 67
           I  FG F+AGG++  I+ T T P + +K+    R  L   +  S   V  KNP       
Sbjct: 198 IKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKL 257

Query: 68  ----IQGMAVIFKNEGIKGLQ--KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE 121
               ++ +  +++  GIK      GLNA  ++    +  + G +E  +  + ++   + +
Sbjct: 258 RSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPE--SSIKFGSFEITKKLMTKV--ENCK 313

Query: 122 PHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQS---------YSEFIKIGEQTHYT 172
             K  S                    P+  +K R+Q              I+  ++ +  
Sbjct: 314 DTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTE 373

Query: 173 GVWNGLVTIFK--TEGVKGLFRGIDAAILRTGAGSSVQ-LPIYNTAKNILVKNDLMKDGP 229
           G   GL   ++  T GV G+F     A L  G  S ++   I + AK +  K + ++   
Sbjct: 374 G---GLKLFYRGVTVGVLGIF---PYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSN 427

Query: 230 ALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDL-----YKGPIDCLVKTVRIEGVTAL 284
            + L     SG   A V+ P +++ TR+  Q G       Y G  D L+KT++ EG   L
Sbjct: 428 LVVLPMGAFSGTFGATVVYPINLLRTRLQAQ-GTFAHPYRYDGFRDVLLKTIQREGYPGL 486

Query: 285 YKGFAAQVFRIAPH---TIMCLTFMEQTMKL 312
           +KG    + ++ P    + +C   +++ MKL
Sbjct: 487 FKGLVPTLAKVCPAVSISYLCYENLKKLMKL 517

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 2/83 (2%)

Query: 5   NSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVY 64
           +SK  K  +K    ++S       G  +     TV  PI L++ R+Q QG  +      Y
Sbjct: 410 SSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYR--Y 467

Query: 65  KNPIQGMAVIFKNEGIKGLQKGL 87
                 +    + EG  GL KGL
Sbjct: 468 DGFRDVLLKTIQREGYPGLFKGL 490

>Kwal_23.2913
          Length = 320

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 74/166 (44%), Gaps = 13/166 (7%)

Query: 154 TRLQSYSEFIKIGEQTHYTGVWNGLV-TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIY 212
           T + + +E +K+  QT  +G + G   T+ +  GV+ LF+G  A + R G GS++    Y
Sbjct: 156 TLITAPTERVKVVLQTSESGSFLGAARTLIREGGVRSLFQGTLATLARDGPGSALYFASY 215

Query: 213 NTAKNILVKNDLMKDGPALHL----TASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGP 268
             +K  L +N   +D  AL +     A  ++G+ + + + P D I T++  Q     +  
Sbjct: 216 EVSKRFLSRN---QDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKTKL--QSSSRSQSM 270

Query: 269 IDCLVKTVRIEGVTALYKGFAAQVFRIAP---HTIMCLTFMEQTMK 311
           +    +     G+   + G    + R  P    T + + F  Q  K
Sbjct: 271 VQAAREIYTRAGLRGFFPGLGPALMRSFPANAATFLGVEFTHQLFK 316

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 121/315 (38%), Gaps = 65/315 (20%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG- 86
           +GG+A    V V  P ++ K+RMQ     S +A +V KN       + KNEG+    KG 
Sbjct: 32  SGGIAQ---VLVGQPFDITKVRMQTSSG-SPTAIEVIKN-------LVKNEGLLAFYKGT 80

Query: 87  ------LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQ-------SVGVNVF 133
                 + A    Q G+N +   ++  +        + DQ    +Q       S   N F
Sbjct: 81  LVPLIGVGACVSCQFGVNEAMKRYFLRVNG------YKDQHLSLLQYYTCGFVSGSANAF 134

Query: 134 XXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG 193
                         P+  V+ RLQ  ++ +   E   Y G  + +  + K    K L RG
Sbjct: 135 LAT-----------PIEHVRIRLQLQTKALAKAE---YRGSLDCMKKLLKQ---KALMRG 177

Query: 194 IDAAILRTGAGSSVQLPIY-----NTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMN 248
             A ++RT  G  V    Y     N  KN +++ D+    P         SG     +  
Sbjct: 178 FTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDI---PPWKVCVFGAFSGAFFWAMTY 234

Query: 249 PWDVILTRIYNQKGDLYKGPIDC-----LVKTVR-IEGVTALYKGFAAQVFRIAPHTIMC 302
           P+DV+ + +   + D    P+       + K++    G  A  KGF   + R  P     
Sbjct: 235 PFDVVKSIM---QADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGAT 291

Query: 303 LTFMEQTMKLVYSIE 317
               E TM+L+ S++
Sbjct: 292 FATFEVTMRLLESLD 306

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
           FV+G   A +A     PIE ++IR+QLQ +  A A   Y+  +  M  + K    K L +
Sbjct: 126 FVSGSANAFLA----TPIEHVRIRLQLQTKALAKAE--YRGSLDCMKKLLKQ---KALMR 176

Query: 86  GLNA 89
           G  A
Sbjct: 177 GFTA 180

>Scas_645.9
          Length = 391

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 101/280 (36%), Gaps = 51/280 (18%)

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123
           +   ++    I+K EGI  L +G++   +  I  N      YE +R         D  P 
Sbjct: 129 FNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLR---------DNSPL 179

Query: 124 KVQSVGVN-VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182
              S   N +               PL L+KT+LQS      I   +  T  W  +  + 
Sbjct: 180 ATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQS------IPRVSKSTTSWMMVKELL 233

Query: 183 K--------TEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALH-- 232
           K        +     LF+G++  + R    S++    Y        K  L  D    H  
Sbjct: 234 KETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYE-----FCKTHLWMDTSKSHSN 288

Query: 233 -------LTASTISGLGVAVVMNPWDVILTR-----IYNQKGDLYKGP--------IDCL 272
                      +ISG   A+V +P+DV  TR     + N    + K P           L
Sbjct: 289 LTFFINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFL 348

Query: 273 VKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312
               ++EG  ALY G   ++ +IAP   + ++  E + +L
Sbjct: 349 RNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRL 388

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 78/210 (37%), Gaps = 19/210 (9%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA------KVYKNPIQGMAVIFK 76
           F   + G +A  +A +   P+EL+K ++Q    +S S        ++ K   Q M +   
Sbjct: 186 FNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRI--- 242

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFX-X 135
           +     L KGL       +  +    G YE  ++    L+    + H   +  +N F   
Sbjct: 243 SGASNALFKGLEITLWRDVPFSAIYWGSYEFCKT---HLWMDTSKSHSNLTFFINSFIGG 299

Query: 136 XXXXXXXXXXXXPLFLVKTRLQ------SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189
                       P  + KTR Q      +    +K  +      ++  L  I+K EG   
Sbjct: 300 SISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGA 359

Query: 190 LFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           L+ G+   +++     ++ +  Y  +K + 
Sbjct: 360 LYTGLVPRMVKIAPSCAIMISSYELSKRLF 389

>Kwal_0.232
          Length = 274

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 31/167 (18%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTRLQ+   F                   F   G  G++RG+ +A++ +   +S+
Sbjct: 26  PIDTLKTRLQAAGGF-------------------FANGGYLGVYRGLGSAVVASAPSASL 66

Query: 208 QLPIYNTAK--------NILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
               Y+  K        N++  +D + +  A H+ +S+   +   +V  P +VI  R   
Sbjct: 67  FFVTYDGMKSYSRPIFNNLITSSDQVAE-TATHMFSSSAGEIAACMVRVPAEVIKQRTQT 125

Query: 260 QKGDLYKGPIDCLVKTVRIEGVTA-LYKGFAAQVFRIAPHTIMCLTF 305
            K D     +  L++    EG+   LY+G++  V R  P T  C+ F
Sbjct: 126 HKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFT--CIQF 170

 Score = 34.3 bits (77), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 82/220 (37%), Gaps = 44/220 (20%)

Query: 9   DKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPI 68
             Q+ +TA    S      AG +AAC+   V  P E+IK R Q     S S+ +  K  +
Sbjct: 89  SDQVAETATHMFSS----SAGEIAACM---VRVPAEVIKQRTQTH--KSDSSLQTLKKLL 139

Query: 69  QGMAVIFKNEGIK-GLQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEP 122
           Q        EGI+  L +G +   + +I     +   YE ++     S   +   P Q  
Sbjct: 140 QNE----NGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQ-- 193

Query: 123 HKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRL---QSYSEFIKIGEQTHYTGVWNGLV 179
                     F              PL ++KTRL    +    + +  Q           
Sbjct: 194 --------GAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPVLHLARQ----------- 234

Query: 180 TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
            I+ TEG K  F G+    +   AG ++ L +Y T  +IL
Sbjct: 235 -IYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETVHSIL 273

 Score = 32.0 bits (71), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 84/240 (35%), Gaps = 32/240 (13%)

Query: 25  SFVAGGLAACIAVTVTN----PIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI 80
           SF+   LA   A T T+    PI+ +K R+Q  G                    F N G 
Sbjct: 5   SFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGF------------------FANGGY 46

Query: 81  KGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP-DQEPHKVQSVGVNVFXXXXXX 139
            G+ +GL +A +            Y+ ++S    +F        +V     ++F      
Sbjct: 47  LGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGE 106

Query: 140 XXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVK-GLFRGIDAAI 198
                   P  ++K R Q++     +          NG       EG++  L+RG    +
Sbjct: 107 IAACMVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENG-------EGIRRNLYRGWSTTV 159

Query: 199 LRTGAGSSVQLPIYN-TAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           +R    + +Q P+Y    K   +     +  P        ++G   A    P DV+ TR+
Sbjct: 160 MREIPFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRL 219

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/327 (18%), Positives = 133/327 (40%), Gaps = 41/327 (12%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAK-----VYKNP------- 67
           I  FG F+AGG +  ++ T T P + IK+ +  + ++S++        + KNP       
Sbjct: 197 IKGFGFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKI 256

Query: 68  ----IQGMAVIFKNEGIKGLQ--KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE 121
               I+    +++  G++      GLN   ++    +  + G +E  +  + +L   + +
Sbjct: 257 KSPLIKAATTLYRQGGLRAFYVGNGLNVVKVFP--ESAIKFGSFEMAKRIMARL--ENVK 312

Query: 122 PHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTI 181
                S                    P+  +K R+Q       + + +    +      +
Sbjct: 313 DTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSI---LLQTAKEM 369

Query: 182 FKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDG-PALHLTASTI-- 238
           ++  G++  +RG+   ++     +++ L  ++  K   +K +  K G P   +  S +  
Sbjct: 370 YQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIV 429

Query: 239 ------SGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVRIEGVTALYKGF 288
                 SG   A ++ P +++ TR+  Q        Y G  D L KT++ EG   L+KG 
Sbjct: 430 LPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGL 489

Query: 289 AAQVFRIAPH---TIMCLTFMEQTMKL 312
              + ++ P    + +C   +++ MKL
Sbjct: 490 VPNLAKVCPAVSISYLCYENLKRLMKL 516

>Kwal_55.21106
          Length = 328

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/345 (20%), Positives = 134/345 (38%), Gaps = 81/345 (23%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM-----------SASAAKV----YKNPIQ 69
           S + G +A+ +A  V  P++L+K  +Q Q +             A  ++V    YK+ + 
Sbjct: 6   SAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLD 65

Query: 70  GMAVIFKNEGIKGLQKGL----------NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPD 119
            +  IFK +G+ GL +GL          + +Y +   +       Y+ +R  L +   P+
Sbjct: 66  ALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPE 125

Query: 120 QEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIG----------EQT 169
           +    + +  V+                P+ ++ TR Q+ +   K G          EQ 
Sbjct: 126 ELLLGIVAAAVS-----------QIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQN 174

Query: 170 HYTGVWNGL-----------VTIFKTEGVKGLF----RGID--AAILRTGAGSSVQ---- 208
           + TG W G            +T    E ++ +F    R +D    +L T    S +    
Sbjct: 175 NITGFWRGFKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFL 234

Query: 209 LPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKG--DLYK 266
           L +++   + L+   L+     L  T S             +  +L  +Y Q+G   L+K
Sbjct: 235 LGVFSKVISTLITQPLIVSKAYLQRTGSN---------FQSFQQVLLYLYKQEGLISLWK 285

Query: 267 GPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311
           G    L K + ++G+  ++KG   ++ ++    I  +     T+K
Sbjct: 286 GLAPQLSKGILVQGLLFMFKG---ELTKLIKRCIFYIRLRSSTLK 327

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 113/308 (36%), Gaps = 51/308 (16%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87
           AG +     V V  P +  K+R+Q         +K     I+ +  + +NEG     KG+
Sbjct: 32  AGTMGGVAQVLVGQPFDTTKVRLQ--------TSKTKIGVIEVVQNLLRNEGALAFYKGM 83

Query: 88  NAAYI-------YQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXX 140
               +        Q G+N S   F+    +        D + H    +            
Sbjct: 84  LTPLLGVGICVSVQFGVNESMKRFFAAYNADRV-----DPQKHVPLPLHQYYLCGLTGGV 138

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
                  P+  V+ RLQ+ +     G +  + G ++    I K    K L RG+   ++R
Sbjct: 139 VNSFLAAPIEHVRIRLQTQTS---QGNERQFKGPFD---CIKKLAKAKALMRGLLPTMIR 192

Query: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTA------STISGLGVAVVMNPWDVIL 254
            G G    L  Y  A   LV  +  K  P   + A        +SG  + + + P DV+ 
Sbjct: 193 AGHG----LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVDVVK 248

Query: 255 T-----RIYNQKGDLYKGPIDCLVKTVRI----EGVTALYKGFAAQVFRIAPHTIMCLTF 305
           +      I N K   YK   + ++K  R      G+ A +KGF   + R AP        
Sbjct: 249 SVLQTDSIENPK---YK---NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302

Query: 306 MEQTMKLV 313
            E TM+++
Sbjct: 303 FEMTMRVL 310

>Scas_717.20
          Length = 356

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 7/116 (6%)

Query: 1   MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           ++   S+Q+++  K     +  +   ++GGLA   + T   P E+I+ R+Q+    + S 
Sbjct: 242 LALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVS---TLSV 298

Query: 61  AKVYKNPIQGMA----VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL 112
           +++Y +  Q ++    +I+K  G +G   GL+  YI    +       YE ++  L
Sbjct: 299 SQMYDHRFQSISEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 64/154 (41%), Gaps = 9/154 (5%)

Query: 12  IEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGM 71
           I+K + + I++ G  +AGG++   A T+  P++ IKI  Q         A       +  
Sbjct: 24  IDKNSLEYITRSG--LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAA 81

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVN 131
             I+ N+GI+G  +G +   +        +   YE IR++L     P +E    +S    
Sbjct: 82  KHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTL----IPSKE---YESHWRR 134

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKI 165
           +               PL L++ RL   +E  +I
Sbjct: 135 LMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRI 168

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 47/105 (44%), Gaps = 11/105 (10%)

Query: 163 IKIGEQT---HYTGVWNGLV-------TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIY 212
           IKI  QT   HYT     LV        I+  +G++G F+G    ++R    ++V+   Y
Sbjct: 56  IKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAY 115

Query: 213 NTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
              +N L+ +    +     L + +++GL       P D+I  R+
Sbjct: 116 EQIRNTLIPSKEY-ESHWRRLMSGSLAGLCSVFTTYPLDLIRVRL 159

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 113/290 (38%), Gaps = 29/290 (10%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG 79
           + +    +AG L    ++ VT P  L+ I   LQ + + +  K     ++ +  I+   G
Sbjct: 9   VDELAHAIAGSLGGAASIAVTYP--LVTITTNLQTKENEARPK-----LETIKEIYNKNG 61

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXX 139
           I G   GL +A       N     FYE    +   L        +  S   ++       
Sbjct: 62  IIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTL-----TTKQYLSTWESILASTIAG 116

Query: 140 XXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199
                   P+++  TR+        + +  H T     ++ I KT+G   L  G+  A++
Sbjct: 117 SMTAVASNPIWVANTRMT-------VAKSNHSTL--RTVIDIVKTDGPLTLLNGLKPALV 167

Query: 200 RTGAGSSVQLPIYNTAKNILVKNDLMKD-GPALHLTASTISGLGVAVVMNPWDVILTRIY 258
              +   +Q  +Y   KN++++    K   P+       I  L       P+  + TR++
Sbjct: 168 LV-SNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMH 226

Query: 259 NQKGD--LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
             + D    K     +V+ V+ +GV+ LY G A ++ +    +IM   F+
Sbjct: 227 LMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQ----SIMTAAFL 272

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 76/187 (40%), Gaps = 19/187 (10%)

Query: 15  TAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI 74
           T  Q +S + S +A  +A  +    +NPI +   RM        + AK   + ++ +  I
Sbjct: 98  TTKQYLSTWESILASTIAGSMTAVASNPIWVANTRM--------TVAKSNHSTLRTVIDI 149

Query: 75  FKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFX 134
            K +G   L  GL  A +  +     +   YE +++ + +L     +  KV S       
Sbjct: 150 VKTDGPLTLLNGLKPALVL-VSNPIIQYTVYEQLKNLVLRL-----QRKKVLSPSWAFLL 203

Query: 135 XXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                        P   +KTR+      +   +  H   +W+ +V I K +GV GL+ G+
Sbjct: 204 GAIGKLAATGTTYPYITLKTRMH-----LMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGV 258

Query: 195 DAAILRT 201
              ++++
Sbjct: 259 AVKLVQS 265

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 10/143 (6%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYN----TAKNILVKNDLMKDGPALHLTAS 236
           I+   G+ G F G+++A+      + V    Y     TA+ +  K  L      L   AS
Sbjct: 56  IYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESIL---AS 112

Query: 237 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
           TI+G   AV  NP  V  TR+   K +     +  ++  V+ +G   L  G    +  ++
Sbjct: 113 TIAGSMTAVASNPIWVANTRMTVAKSN--HSTLRTVIDIVKTDGPLTLLNGLKPALVLVS 170

Query: 297 PHTIMCLTFMEQTMKLVYSIESR 319
            + I+  T  EQ   LV  ++ +
Sbjct: 171 -NPIIQYTVYEQLKNLVLRLQRK 192

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 70/167 (41%), Gaps = 30/167 (17%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTRLQ+   F                   F   G KG++RG+ +A++ +   +S+
Sbjct: 26  PIDTLKTRLQAKGGF-------------------FANGGYKGVYRGLGSAVVASAPSASL 66

Query: 208 QLPIYNTAK--------NILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
               Y++ K         +L K +        H+ +S+   +   +V  P +VI  R   
Sbjct: 67  FFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSSFGEISACMVRVPAEVIKQRTQT 126

Query: 260 QKGDLYKGPIDCLVKTVRIEGVTA-LYKGFAAQVFRIAPHTIMCLTF 305
            + +     +  L++    EG+   LY+G++  + R  P T  C+ F
Sbjct: 127 HRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFT--CIQF 171

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 83/211 (39%), Gaps = 30/211 (14%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           E   A  +S   S   G ++AC+   V  P E+IK R Q     S+         +Q + 
Sbjct: 90  EDQTADTLSHMVSSSFGEISACM---VRVPAEVIKQRTQTHRTNSS---------LQTLQ 137

Query: 73  VIFKNEGIKGLQK----GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSV 128
            + +NE  +GL++    G +   + +I     +   YE ++    ++   ++      SV
Sbjct: 138 ALLRNENGEGLRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKRWAEVQGKERAAPWQGSV 197

Query: 129 GVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVK 188
              +               PL ++KTR+  + + +      H         T+ + EGVK
Sbjct: 198 CGCI-----AGGIAAAATTPLDVLKTRIMLHHKSV---SALHLAK------TMLQEEGVK 243

Query: 189 GLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
             F G+    +   AG ++ L +Y T  ++ 
Sbjct: 244 VFFSGVGPRTMWISAGGAIFLGVYETVHSLF 274

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 99/274 (36%), Gaps = 28/274 (10%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQKGL 87
           G +A  +   +  P + +K+R+Q Q       A ++      +   + NEG+ +G  +G+
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQ------PAHMFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXX 147
            +       L G+ L     +  S NQ          +  +   V+              
Sbjct: 67  GSP------LAGAALE-NAVLFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACASFVLT 119

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+ L+K +LQ  +       +T +T +   + ++    G  GL++G     +R   G + 
Sbjct: 120 PVELIKCKLQVSNLSTT---KTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAA 176

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTIS-GLGVAVVMNPWDVILTRIYNQKGDLYK 266
               Y   KN L      +      L AS  S GL     + P D I       K  +  
Sbjct: 177 WFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTI-------KSTMQT 229

Query: 267 GPIDCLVKTVRI---EGVTALYKGFAAQVFRIAP 297
             ID    T +I   +G+   Y+G    + R  P
Sbjct: 230 DHIDLSSATRKIYARQGIAGFYRGLGITLIRAVP 263

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/192 (18%), Positives = 74/192 (38%), Gaps = 20/192 (10%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87
           AG  A   A  V  P+ELIK ++Q+    +   +     P   +  +    G  GL +G 
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPT--IKSVLSERGFLGLWQGQ 163

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE-PHKVQSVGVNVFXXXXXXXXXXXXX 146
           +  +I + G   +    YE +++ L      +Q    ++ + G +               
Sbjct: 164 SGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASA------GLAFNASI 217

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
            P   +K+ +Q  ++ I +   T           I+  +G+ G +RG+   ++R    ++
Sbjct: 218 FPADTIKSTMQ--TDHIDLSSATR---------KIYARQGIAGFYRGLGITLIRAVPANA 266

Query: 207 VQLPIYNTAKNI 218
                Y T  ++
Sbjct: 267 AIFYTYETLSSV 278

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 7/111 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTR+QS S     G  T   G+   +  I   EG   L++G+ + IL  G   +V
Sbjct: 36  PVDAIKTRIQSSSS----GAATQ--GLIKQISKITTAEGSLALWKGVQSVILGAGPAHAV 89

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVA-VVMNPWDVILTRI 257
               Y  +K+ L+    M     +    S ++   VA  +MNP+DVI  R+
Sbjct: 90  YFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPFDVIKQRM 140

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/248 (20%), Positives = 95/248 (38%), Gaps = 23/248 (9%)

Query: 9   DKQIEKTAAQKISKFGS-FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP 67
           D++I+  A    +      +AG  A  +  +V  P++ IK R+Q     S+S+    +  
Sbjct: 2   DEEIDYEALPPCAPLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ-----SSSSGAATQGL 56

Query: 68  IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQS 127
           I+ ++ I   EG   L KG+ +     +G   +   ++     S ++L  P Q+ H  Q 
Sbjct: 57  IKQISKITTAEGSLALWKGVQSVI---LGAGPAHAVYFATYEFSKSKLIDP-QDMHTHQP 112

Query: 128 VGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGV 187
           +   +               P  ++K R+Q  +             VW+    I+  EG 
Sbjct: 113 IKTAI-SGMAATTVADALMNPFDVIKQRMQLNTR----------ESVWHVTKNIYHKEGF 161

Query: 188 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVM 247
              +      ++     ++    IY +A   +  N   +  P +H  +  +SG   A + 
Sbjct: 162 AAFYYSYPTTLVMNIPFAAFNFAIYESATKFM--NPSNEYNPFIHCISGGLSGATCAAIT 219

Query: 248 NPWDVILT 255
            P D I T
Sbjct: 220 TPLDCIKT 227

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 66/198 (33%), Gaps = 18/198 (9%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G  A  +A  + NP ++IK RMQL      S   V KN       I+  EG       
Sbjct: 117 ISGMAATTVADALMNPFDVIKQRMQLNTR--ESVWHVTKN-------IYHKEGFAAFYYS 167

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
                +  I         YE     +N        P    +  ++               
Sbjct: 168 YPTTLVMNIPFAAFNFAIYESATKFMN--------PSNEYNPFIHCISGGLSGATCAAIT 219

Query: 147 XPLFLVKTRLQSY-SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
            PL  +KT LQ   SE +                 I+K  G KG  RG+   ++     +
Sbjct: 220 TPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPAT 279

Query: 206 SVQLPIYNTAKNILVKND 223
           ++    Y  AK+ LV + 
Sbjct: 280 AISWTSYECAKHFLVNSS 297

>Scas_715.45
          Length = 305

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 14/174 (8%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL L+K RLQ         + T Y    +G++ I K EG+  LF G+ A  +      + 
Sbjct: 36  PLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAG 87

Query: 208 QLPIYNTAKNI----LVKNDLM--KDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK 261
           +   Y   K +    LVK++    K   +++L +S  +     +++ P++ I  +     
Sbjct: 88  KYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTM 147

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315
                  I+   K    EG+   YKG      R  P+T+   T  E+ ++ +Y+
Sbjct: 148 PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201

 Score = 34.7 bits (78), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 69/176 (39%), Gaps = 15/176 (8%)

Query: 42  PIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSR 101
           P E IK++ Q       +      N I+G   ++  EG+ G  KG+   +  QI     +
Sbjct: 135 PFEAIKVKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188

Query: 102 LGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYS 160
              +E I  ++  +L     E   +Q + V+                P  ++ +++ +  
Sbjct: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248

Query: 161 EFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 216
              K+ E  +       L  I+   G  GL+ G+   IL  G  +S Q  IY++ K
Sbjct: 249 ---KVNESMNV-----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 26/161 (16%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P  ++K RLQ+       G  T     W  +  + K EG  G ++G  A ++  GA  S 
Sbjct: 44  PFDIIKVRLQTMP-----GNAT----AWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSC 94

Query: 208 QLPIYNTAKNIL--------VKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
           Q  I    K           + ++ +  G   + T   +SG   A++  P + +  R+  
Sbjct: 95  QFGINEAMKRYFRDLNRSRGIYDNTLSLGQ--YYTCGFVSGSANALLATPIEHVRIRLQL 152

Query: 260 QKGDL----YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
           QK  L    YK  +DC  K ++ +G  +L +GF A + R +
Sbjct: 153 QKEALANAEYKSTLDCTEKLLK-QG--SLMRGFTATLMRTS 190

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 63/296 (21%), Positives = 104/296 (35%), Gaps = 29/296 (9%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQ-LQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           +G +     V V  P ++IK+R+Q + G  +A  A         +  + K EG  G  KG
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEA---------ITDLVKYEGFMGFYKG 80

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
             A  +        + G  E ++     L           S+G                 
Sbjct: 81  TMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLA 140

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
            P+  V+ RLQ   E +   E   Y    +    + K      L RG  A ++RT  G  
Sbjct: 141 TPIEHVRIRLQLQKEALANAE---YKSTLDCTEKLLKQ---GSLMRGFTATLMRTSHGFG 194

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALHLTA------STISGLGVAVVMNPWDVILTRIYNQ 260
           +    Y T    L+ + L        ++A        +SG     +  P+DV+ + +   
Sbjct: 195 IYFLTYET----LIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQAD 250

Query: 261 K--GDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           K     Y   +  + K + R  G+ A  KGF   + R  P         E TM+++
Sbjct: 251 KLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 40/89 (44%), Gaps = 3/89 (3%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           + IS + + + G L+      +T P +++K  MQ    ++ +      N +Q    I++ 
Sbjct: 215 EDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGT---NVVQVAKNIYRE 271

Query: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYE 106
            G++   KG     +  + +NG+    +E
Sbjct: 272 RGLRAFTKGFMPTMLRSLPVNGATFAAFE 300

>Kwal_27.11419
          Length = 298

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 75/180 (41%), Gaps = 37/180 (20%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG-LFRGIDAAILRTGAGSS 206
           P  L+KTRLQ                  + L+ + ++    G L++G   + LRT  GS+
Sbjct: 27  PFDLLKTRLQQNKS--------------SNLLDVVRSIETPGQLWKGTLPSALRTSVGSA 72

Query: 207 VQLPIYNTAKNIL----VKNDLMKDG-----PALHLTASTISGL----GVAVVMNPWDVI 253
           + L   N  ++ +    VK    K+G     P L +  + ISG      V V   P  V+
Sbjct: 73  LFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPITVL 132

Query: 254 LTR----IYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQT 309
             R    +YN     YK   +      R EG+  L+ G  A V R AP+  + + F EQ+
Sbjct: 133 KVRFESTMYN-----YKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYEQS 187

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 81/220 (36%), Gaps = 30/220 (13%)

Query: 9   DKQIEKTAAQ--------KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA 60
           DK+++  A +        ++S + + ++G +        T PI ++K+R +       S 
Sbjct: 87  DKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVATMPITVLKVRFE-------ST 139

Query: 61  AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ 120
              YK+  +    I+++EGI+GL  G  A  +      G  + FYE  +  L ++     
Sbjct: 140 MYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWM 199

Query: 121 EPHKVQSVG-------VNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTG 173
             H    V        +N                P   +KTR+Q           + Y G
Sbjct: 200 VEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKTRMQL--------NPSQYYG 251

Query: 174 VWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYN 213
                 +I + E  + LF G+   + R    + +   IY 
Sbjct: 252 FIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 32/167 (19%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTG--AG- 204
           P+ ++K R +S           +Y  +      I+++EG++GLF G  A ++R    AG 
Sbjct: 128 PITVLKVRFES--------TMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGL 179

Query: 205 -------SSVQLPI--------YNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNP 249
                  S +QLP         +N +     K   + +  A   +AS         + +P
Sbjct: 180 YVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASL-----ATTITSP 234

Query: 250 WDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
           +D I TR+       Y G I      +R E    L+ G + ++ R A
Sbjct: 235 FDTIKTRMQLNPSQYY-GFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 7/82 (8%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           +A   +A +A T+T+P + IK RMQL           Y   IQ    I + E  + L  G
Sbjct: 219 IAAFSSASLATTITSPFDTIKTRMQLNPSQ-------YYGFIQTFKSIIRYERPRNLFDG 271

Query: 87  LNAAYIYQIGLNGSRLGFYEPI 108
           L+     +    G   G YE +
Sbjct: 272 LSLRLSRKALSAGIAWGIYEEL 293

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 14/58 (24%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQK--------------GDLYKGPIDCLVKT 275
           H     + GL  AV++ P+D++ TR+   K              G L+KG +   ++T
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSIETPGQLWKGTLPSALRT 67

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 71/167 (42%), Gaps = 31/167 (18%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTRLQ+   F                   F   G KG++RG+ +A++ +   +S+
Sbjct: 26  PIDTLKTRLQAKGGF-------------------FANGGYKGVYRGLGSAVIASAPSASL 66

Query: 208 QLPIYNTAK--------NILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259
               Y++ K          +  N+ M D  + H+ +S+I  +   +V  P +VI  R   
Sbjct: 67  FFVSYDSMKVYSKPVISKYVTSNNQMADTLS-HMFSSSIGEVSACLVRVPAEVIKQRTQT 125

Query: 260 QKGDLYKGPIDCLVKTVRIEGV-TALYKGFAAQVFRIAPHTIMCLTF 305
            K +        +++    EGV   LY+G+   + R  P T  C+ F
Sbjct: 126 HKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFT--CIQF 170

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 95/268 (35%), Gaps = 50/268 (18%)

Query: 42  PIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSR 101
           PI+ +K R+Q +G                    F N G KG+ +GL +A I         
Sbjct: 26  PIDTLKTRLQAKGGF------------------FANGGYKGVYRGLGSAVIAS------- 60

Query: 102 LGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLF------LVKTR 155
                P  S    LFF   +  KV S  V +                +F      +    
Sbjct: 61  ----APSAS----LFFVSYDSMKVYSKPV-ISKYVTSNNQMADTLSHMFSSSIGEVSACL 111

Query: 156 LQSYSEFIKIGEQTHYT-GVWNGLVTIFKTEGVKG----LFRGIDAAILRTGAGSSVQLP 210
           ++  +E IK   QTH T   W     I + E  +G    L+RG +  I+R    + +Q P
Sbjct: 112 VRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFP 171

Query: 211 IYNTAKNILVKNDLMKD-GPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPI 269
           +Y   K    K +      P       +++G   A    P DV+ TR+      +   P+
Sbjct: 172 LYEFLKKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRLMLSHKSI---PV 228

Query: 270 DCLVKTVRI-EGVTALYKGFAAQVFRIA 296
             L K +   EG    + G   +   I+
Sbjct: 229 AQLAKNIYAEEGFKVFFSGVGPRTMWIS 256

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 78/207 (37%), Gaps = 30/207 (14%)

Query: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76
           A  +S   S   G ++AC+   V  P E+IK R Q     S+          Q    I +
Sbjct: 93  ADTLSHMFSSSIGEVSACL---VRVPAEVIKQRTQTHKTNSS---------WQTFTKILQ 140

Query: 77  NEG----IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNV 132
           NE     ++ L +G N   + +I     +   YE ++ +  +    D       SV  +V
Sbjct: 141 NENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAPWQGSVCGSV 200

Query: 133 FXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFR 192
                          PL ++KTRL    + I + +             I+  EG K  F 
Sbjct: 201 -----AGAIAAATTTPLDVLKTRLMLSHKSIPVAQLAK---------NIYAEEGFKVFFS 246

Query: 193 GIDAAILRTGAGSSVQLPIYNTAKNIL 219
           G+    +   AG ++ L +Y T  +IL
Sbjct: 247 GVGPRTMWISAGGAIFLGVYETVHSIL 273

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 65/154 (42%), Gaps = 8/154 (5%)

Query: 161 EFIKIGEQTH---YTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKN 217
           + +KI  QT+   + G   G + I + EG+ GL+RG      R   GS         AK 
Sbjct: 139 DVLKIKRQTNPESFRG--RGFLRILRDEGM-GLYRGWGWTAARNAPGSFALFGGNAFAKE 195

Query: 218 -ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTV 276
            IL   D  +     +  +S        +V  P DVI TRI ++  +  +     +  T+
Sbjct: 196 YILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTL 255

Query: 277 RIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTM 310
           + EG TA +KG   ++    P  +     + QT+
Sbjct: 256 KNEGATAFFKGLTPKLLTTGPKLVFSFA-IAQTL 288

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQG-EMSASAAKVYKNPIQGMAVIFKNEGIKGL 83
           +FV+    A  ++ V+ P+++IK R+Q +  E + S   + KN +       KNEG    
Sbjct: 211 NFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTL-------KNEGATAF 263

Query: 84  QKGL 87
            KGL
Sbjct: 264 FKGL 267

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 1   MSSDNSKQDKQIEKTAAQ-KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSAS 59
           + +D+ K D Q  +T  +  ++ +   +AGGLA   + T   P E+I+ R+Q+ G ++  
Sbjct: 268 LDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQV-GAVTNP 326

Query: 60  AAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYI 92
               + +  +   +IF   G +G   GL+  YI
Sbjct: 327 LEHKFTSMSEMAKIIFHERGWRGFFVGLSIGYI 359

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 148 PLFLVKTRLQ-SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           PL  +K   Q S   ++K      + G+ N  V I+  + ++G+F+G  A +LR    ++
Sbjct: 73  PLDRIKILFQTSNPHYVKYAGS--FQGLLNAGVHIWSRDRLRGVFQGHSATLLRIFPYAA 130

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           V+   Y   +N+++ +   +      L + +++GL       P D+I  R+
Sbjct: 131 VKFIAYEQIRNVIIPSKEYETH-FRRLCSGSLAGLCSVFCTYPLDLIRVRL 180

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           S +AGG+A   A T+  P++ IKI  Q         A  ++  +     I+  + ++G+ 
Sbjct: 56  SGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRS 110
           +G +A  +        +   YE IR+
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRN 141

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 72/175 (41%), Gaps = 23/175 (13%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P  L+KTRLQ          Q   + +W  L +I   E    L+RG   + +RT  GS++
Sbjct: 27  PFDLLKTRLQ----------QDKTSTLWKTLKSI---ETPSQLWRGALPSCIRTSVGSAM 73

Query: 208 QLPIYNTAKNILVK-NDLMKDG----PALHLTASTISGLGV----AVVMNPWDVILTRIY 258
            L + N+ +  + K  +    G    P L++  +  SG        ++  P  VI  R Y
Sbjct: 74  YLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVR-Y 132

Query: 259 NQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
                 Y           R EG+   ++GF A   R AP+  + + F ++   LV
Sbjct: 133 ESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLV 187

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 102/244 (41%), Gaps = 35/244 (14%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87
           +GGL + I   +  P +L+K R  LQ + +++  K  K+ I+  + +++      ++  +
Sbjct: 16  SGGLVSAI---ILQPFDLLKTR--LQQDKTSTLWKTLKS-IETPSQLWRGALPSCIRTSV 69

Query: 88  NAAYIYQIGLNGSRLGFYEPIRS-SLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
            +A +Y   LN  R    +   + S    + P    ++      N+F             
Sbjct: 70  GSA-MYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYE------NMFSGAVTRALTGLIT 122

Query: 147 XPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
            P+ ++K R +S            YT +      IF+TEG++G FRG  A  LR    + 
Sbjct: 123 MPITVIKVRYES--------TLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAG 174

Query: 207 VQLPIYNTAK----NILVKNDLMKDGPALHLT-ASTI----SGLGVAVVMN----PWDVI 253
           + +  Y+  K     +L  N +  +    + T AST+    S    AV+      P+D +
Sbjct: 175 LYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTV 234

Query: 254 LTRI 257
            TR+
Sbjct: 235 KTRM 238

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 76/202 (37%), Gaps = 22/202 (10%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           +++ + +  +G +   +   +T PI +IK+R +       S    Y +     + IF+ E
Sbjct: 101 QLNMYENMFSGAVTRALTGLITMPITVIKVRYE-------STLYQYTSLRYATSHIFRTE 153

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLF-------FPDQEPHKVQSVGVN 131
           G++G  +G  A  +      G  + FY+ ++  +  L          D       S  +N
Sbjct: 154 GLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLIN 213

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
                           P   VKTR+Q     ++  +   +T  +  + T    E V+ LF
Sbjct: 214 GSSAFSAAVIATSITAPFDTVKTRMQ-----LEPAKFHSFTSTFWHIAT---KESVRNLF 265

Query: 192 RGIDAAILRTGAGSSVQLPIYN 213
            GI   + R    + +   IY 
Sbjct: 266 AGISLRLTRKAFSAGIAWGIYE 287

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVR-IEGVTALYKGFAA 290
           HL      GL  A+++ P+D++ TR+   K          L KT++ IE  + L++G   
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQQDK-------TSTLWKTLKSIETPSQLWRGALP 62

Query: 291 QVFRIAPHTIMCLTFMEQ 308
              R +  + M LT +  
Sbjct: 63  SCIRTSVGSAMYLTMLNS 80

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 69/321 (21%), Positives = 127/321 (39%), Gaps = 67/321 (20%)

Query: 4   DNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAK 62
           +++KQ ++I+    +    + +   GG+ AC    +   P++L+K R+Q+         K
Sbjct: 2   ESNKQPRKIQLYTKEF---YATCTLGGIIACGPTHSSITPLDLVKCRLQVN-------PK 51

Query: 63  VYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEP 122
           +Y + +QG   I  NEG K +  G  A ++        + G YE  +   +    P    
Sbjct: 52  LYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSP---- 107

Query: 123 HKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182
                 GV V+                FL    L  + E IK+ +QT      N +V  +
Sbjct: 108 ------GVTVYLMASATAE--------FLADIMLCPF-EAIKVKQQTTMPPFCNNVVDGW 152

Query: 183 K-----TEGVKGLFRGIDAAILRTGAGSSVQLPI----YNTAKNILVK------------ 221
           K     + G+K  ++GI     R       Q+P     + + + I+ K            
Sbjct: 153 KKMYAESGGMKAFYKGIVPLWCR-------QIPYTMCKFTSFEKIVQKIYSVLPKKKEEM 205

Query: 222 NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIE-- 279
           N L +   ++      ++G+  A V +P DV++++I +++    K      V + RI   
Sbjct: 206 NALQQI--SVSFVGGYLAGILCAAVSHPADVMVSKINSER----KANESMSVASKRIYQK 259

Query: 280 -GVTALYKGFAAQVFRIAPHT 299
            G T L+ G   ++  I   T
Sbjct: 260 IGFTGLWNGLMVRIVMIGTLT 280

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 67/170 (39%), Gaps = 11/170 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL LVK RLQ   +         YT    G   I   EG K ++ G  A  +      + 
Sbjct: 38  PLDLVKCRLQVNPKL--------YTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAG 89

Query: 208 QLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKG 267
           +   Y   K++   +  +  G  ++L AS  +     +++ P++ I  +           
Sbjct: 90  KYGGYEYFKHLY--SSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNN 147

Query: 268 PIDCLVKT-VRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
            +D   K      G+ A YKG      R  P+T+   T  E+ ++ +YS+
Sbjct: 148 VVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 76/172 (44%), Gaps = 16/172 (9%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGV-----WNGLVTIFKTEGVKGLFRGIDAAILRTG 202
           PL  + TR+Q       + EQ    G         +  I++ EGV G + G+++A+    
Sbjct: 36  PLVTLATRMQ-------VSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMA 88

Query: 203 AGSSVQLPIYNTAKNILVK-NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK 261
           A S      Y  A    ++     +   +  + +S ++G   A+  NP  V+ TR+   K
Sbjct: 89  ANSLNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAK 148

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
            +  +  +  L+  VR +GVTAL+ G    +  ++ + I+  T  EQ   +V
Sbjct: 149 SE--QSTLAVLLDIVRKDGVTALFNGLRPALMLVS-NPIIQYTVFEQLKNVV 197

>Kwal_26.7972
          Length = 358

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMA 72
           +K +++ +  +   VAGGLA   + T + P E+I+ R+Q+   +S ++   ++     + 
Sbjct: 249 KKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVS-VVSPTSIHNFQTIPDMIR 307

Query: 73  VIFKNEGIKGLQKGLNAAYI 92
           +I+K  G +G   GL+  YI
Sbjct: 308 IIYKERGWRGFFVGLSIGYI 327

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 6/114 (5%)

Query: 8   QDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP 67
           +++ ++K +A  I + G  +AGG+A   A T+  P++ IKI  Q         +      
Sbjct: 15  KNQSVDKRSAHYILRSG--LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGL 72

Query: 68  IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQE 121
           I+  A I  ++GI+G  +G +A  I        +   YE IR        P +E
Sbjct: 73  IRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIR----HFMIPSKE 122

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 7/127 (5%)

Query: 172 TGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPAL 231
           T V      +++  G++  F+G    ++R    S V+   +   K    K    ++    
Sbjct: 179 TNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKE--YQNNEYF 236

Query: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQKGD---LYKGPIDCLVKTVRIEGVTALYKGF 288
                 IS   V     P DVI TR+  Q  D   LY+  I+C  +    EG   L+KG+
Sbjct: 237 ATLLGLISSCAVVGATQPLDVIKTRM--QAKDSVLLYRNSINCAYRIFVEEGFAMLWKGW 294

Query: 289 AAQVFRI 295
             ++ ++
Sbjct: 295 LPRLMKV 301

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 10  KQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQ 69
           KQ      Q    F + + G +++C  V  T P+++IK RMQ     +  +  +Y+N I 
Sbjct: 223 KQFAPKEYQNNEYFATLL-GLISSCAVVGATQPLDVIKTRMQ-----AKDSVLLYRNSIN 276

Query: 70  GMAVIFKNEGIKGLQKGLNAAYIYQIGLNGS-RLGFYE 106
               IF  EG   L KG     + ++GL+GS   G Y+
Sbjct: 277 CAYRIFVEEGFAMLWKGW-LPRLMKVGLSGSVSFGIYQ 313

>Kwal_55.21338
          Length = 323

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77
           Q+++   S + G +A  +  T  NP+ +   RM +Q     + + ++         I K+
Sbjct: 114 QRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFD--------IVKD 165

Query: 78  EGIKGLQKGLNAAYIYQI 95
           EGI GL KGLN A I  I
Sbjct: 166 EGISGLFKGLNPALILVI 183

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 52/263 (19%), Positives = 102/263 (38%), Gaps = 33/263 (12%)

Query: 35  IAVTVTNPIELIKIRMQLQ---GEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAY 91
           I++T+T P+ ++  ++Q Q   GE   S A   K+       I++ +G  G   GL +A 
Sbjct: 35  ISMTLTYPLIVVTTKLQTQDAKGE-KLSLADTIKD-------IYRKDGAMGFFAGLESAL 86

Query: 92  IYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFL 151
               G   S   +Y    +S ++     +   ++ +   ++               PL++
Sbjct: 87  F---GTTLSNFVYYYCYEAS-SRCVLRARHTQRL-TTAESMLVGSIAGSLNATAANPLWV 141

Query: 152 VKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPI 211
             TR+           Q    G  + +  I K EG+ GLF+G++ A++       +Q  +
Sbjct: 142 ANTRMTV---------QKSDRGTLSTIFDIVKDEGISGLFKGLNPALILV-INPIIQYTV 191

Query: 212 YNTAKN-ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIY---NQKGDLYKG 267
           Y   KN IL         P+       +  L       P+  +  R++     K      
Sbjct: 192 YEQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAP 251

Query: 268 P---IDCLVKTVRIEGVTALYKG 287
           P   +  + + ++ +G+  LY+G
Sbjct: 252 PRSLLSLMAEIIKKDGILGLYRG 274

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 63/272 (23%), Positives = 107/272 (39%), Gaps = 23/272 (8%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQKGL 87
           GG+A  +   V  P + +K+R+Q Q      +A ++      ++  +K EG+ +G  +G+
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQTQ------SAALFPTTWSCVSHTYKQEGLWRGFYQGM 68

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXX 147
            A+ ++   L  + L        S N+     +  +    +   VF              
Sbjct: 69  -ASPVFGAFLEHAVL------FVSFNRAQAVLENCYSCGPLEKVVFAGAIAGACTSYVLT 121

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+ LVK +LQ  S    +     YT V   L  I K  G+ GL++G     +R  AG +V
Sbjct: 122 PVELVKCKLQ-VSNLTGV-SGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAV 179

Query: 208 QLPIYNTAKNILVKNDLMKDGPALH-LTASTISGLGVAVVMNPWDVILTRIYNQKGDLYK 266
               Y   K  L +     +      L +   +G      + P D + + +  Q   L  
Sbjct: 180 WFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTM--QTEHLGL 237

Query: 267 GPIDCLVKTV-RIEGVTALYKGFAAQVFRIAP 297
           GP    V+TV +  G T  Y+G    + R  P
Sbjct: 238 GPA---VRTVLKKHGPTGFYRGVGITLLRALP 266

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/187 (20%), Positives = 71/187 (37%), Gaps = 17/187 (9%)

Query: 28  AGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGL 87
           AG +A      V  P+EL+K ++Q+      S  + Y   +  +  I K  G+ GL +G 
Sbjct: 108 AGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPR-YTAVLPTLRAIVKQNGLGGLWQGQ 166

Query: 88  NAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXX 147
           +  +I +          YE ++  L +     +      +V   +               
Sbjct: 167 SGTFIRESAGGAVWFTAYEVLKGWLAR-----RRGSTENTVWELLASGAGAGAAFHASIF 221

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P   VK+ +           QT + G+   + T+ K  G  G +RG+   +LR    ++V
Sbjct: 222 PADTVKSTM-----------QTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAV 270

Query: 208 QLPIYNT 214
              +Y +
Sbjct: 271 IFYVYES 277

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 245 VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGV-TALYKGFAAQVF-RIAPHTIMC 302
           +V  P+D +  R+  Q   L+     C+  T + EG+    Y+G A+ VF     H ++ 
Sbjct: 24  LVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVLF 83

Query: 303 LTF 305
           ++F
Sbjct: 84  VSF 86

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 76/197 (38%), Gaps = 18/197 (9%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           ++G +A   A  + NP + +K R+QL   +     +V+    Q    I++NEG       
Sbjct: 125 LSGTIATIAADALMNPFDTVKQRLQLDTNL-----RVWNVTKQ----IYQNEGFAAFYY- 174

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
              +Y   + +N     F   I  S ++ F P    + +    ++               
Sbjct: 175 ---SYPTTLAMNIPFAAFNFMIYESASKFFNPQNSYNPL----IHCLCGGISGATCAALT 227

Query: 147 XPLFLVKTRLQSY-SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
            PL  +KT LQ   SE + I               I +  G KG +RG+   I+     +
Sbjct: 228 TPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPAT 287

Query: 206 SVQLPIYNTAKNILVKN 222
           ++    Y  AK+ L+KN
Sbjct: 288 AISWTAYECAKHFLMKN 304

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 6/111 (5%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTR+Q+         +   TG+ + +  I   EG   L++G+ + IL  G   +V
Sbjct: 43  PIDALKTRVQAAGL-----NKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAV 97

Query: 208 QLPIYNTAKNILVK-NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
               Y   K  L+   D+    P     + TI+ +    +MNP+D +  R+
Sbjct: 98  YFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRL 148

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 83/231 (35%), Gaps = 23/231 (9%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
            +AG  A  +  ++  PI+ +K R+Q  G   A++  +    I  ++ I   EG   L K
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGM----ISQISKISTMEGSMALWK 82

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFP-DQEPHKVQSVGVNVFXXXXXXXXXXX 144
           G+ +  +     +    G YE  ++   +L  P D + H+     ++             
Sbjct: 83  GVQSVILGAGPAHAVYFGTYEFCKA---RLISPEDMQTHQPMKTALS---GTIATIAADA 136

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              P   VK RLQ  +             VWN    I++ EG    +      +      
Sbjct: 137 LMNPFDTVKQRLQLDTNL----------RVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPF 186

Query: 205 SSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILT 255
           ++    IY +A      N      P +H     ISG   A +  P D I T
Sbjct: 187 AAFNFMIYESASKFF--NPQNSYNPLIHCLCGGISGATCAALTTPLDCIKT 235

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 122/301 (40%), Gaps = 47/301 (15%)

Query: 14  KTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA-SAAKVYKNPIQGMA 72
           KT++  I   G FV GGL + I   V  P +L+K R+Q   + +     K  ++P Q   
Sbjct: 6   KTSSHLI---GGFV-GGLTSAI---VLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQ--- 55

Query: 73  VIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLN--QLFFPDQEPHKVQSVGV 130
            +++      L+  + +A +Y   LN  R    +    +LN    F P    ++      
Sbjct: 56  -LWRGALPSSLRTSIGSA-LYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYE------ 107

Query: 131 NVFXXXXXXXXXXXXXXPLFLVKTRLQS--YSEFIKIGEQTHYTGVWNGLVTIFKTEGVK 188
           N+               P+ ++K R +S  YS +  +GE T +         I+ TEG++
Sbjct: 108 NLASGAFTRGVVGFITMPITIIKVRYESTMYS-YKSLGEATRH---------IYSTEGIR 157

Query: 189 GLFRGIDAAILRTGAGSSVQLPIYNTAK----NILVKNDLMKDGPALHLTAST------- 237
           G F G  A ++R    + + + +Y  AK     +L  + +  D   +  T ++       
Sbjct: 158 GFFNGCGATVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSIS 217

Query: 238 --ISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRI 295
             +S      + +P+D I TR+       + G    LV  V  E    L+ G   ++ R 
Sbjct: 218 AFMSASLATTITSPFDTIKTRM-QLDPTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRK 276

Query: 296 A 296
           A
Sbjct: 277 A 277

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 67/176 (38%), Gaps = 24/176 (13%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P  L+KTRLQ          Q   T +W  L  I      K L+RG   + LRT  GS++
Sbjct: 27  PFDLLKTRLQ----------QNKDTTLWGTLKEI---RSPKQLWRGALPSSLRTSIGSAL 73

Query: 208 QLPIYNTAKNILVK--NDLMKDG----PALHLTASTISGLG----VAVVMNPWDVILTRI 257
            L   N  +  + K     +  G    P L +  +  SG      V  +  P  +I  R 
Sbjct: 74  YLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKVR- 132

Query: 258 YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
           Y      YK   +        EG+   + G  A V R AP+  + +   E+   LV
Sbjct: 133 YESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEKAKLLV 188

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/322 (17%), Positives = 127/322 (39%), Gaps = 65/322 (20%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV---------------- 63
           ++ F S ++G +A+ +A TV  P++L+K  +Q Q +      ++                
Sbjct: 1   MASFESALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDI 60

Query: 64  --------------YKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIR 109
                         Y +    +  I+K EGI+GL +GL  + +       S   +Y  +R
Sbjct: 61  PPVPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVR 120

Query: 110 SSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSY------SEFI 163
               ++   +++  K  ++   +               P+ L+  R Q+       ++F+
Sbjct: 121 KCYFRVKLINRKNTKFTTIE-ELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFL 179

Query: 164 KIGEQTHYTGVWNGLVTIFKTE-GVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKN 222
            + ++            I+K +  +KG ++G+  +++ T    S+    Y   K+ L   
Sbjct: 180 TVAKE------------IYKEQRSIKGFWKGLKVSLMLT-INPSITYTSYEKLKDALFTT 226

Query: 223 DLM-----------KDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK-GDLYKGPID 270
           D M           +  P  + T   +S +  A++  P  +I+++ + Q+ G  +     
Sbjct: 227 DTMNLKKELVDSSSQLSPYQNFTLGVLSKMISAIITMP--LIISKAWLQRNGSNFSSFQQ 284

Query: 271 CLVKTVRIEGVTALYKGFAAQV 292
            L    + EG+ + +KG + Q+
Sbjct: 285 VLYYLYKNEGLRSWWKGLSPQL 306

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/325 (20%), Positives = 127/325 (39%), Gaps = 37/325 (11%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA-----SAAKVYKNP------- 67
           I  FG F+AGG++  I+ T T P + +K+ +  + ++S+         + KNP       
Sbjct: 225 IRGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKI 284

Query: 68  ----IQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPH 123
                + +  +++  GIK    G     I     +  + G +E  +  + +L        
Sbjct: 285 SSPLAKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKL--EGCRDT 342

Query: 124 KVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFK 183
           K  S                    P+  +K R+Q      K+        ++     +F+
Sbjct: 343 KDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNL---LFQTAKDMFR 399

Query: 184 TEGVKGLFRGIDAAI--------LRTGAGSSVQ-LPIYNTAKNILVKNDLMKDGPALHLT 234
             G++  +RG+   I        L  G  S+++   I   AK + +  D +     + L 
Sbjct: 400 EGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLP 459

Query: 235 ASTISGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVRIEGVTALYKGFAA 290
               SG   A V+ P +++ TR+  Q       +Y G  D L+KT+  EG   L+KG   
Sbjct: 460 MGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVP 519

Query: 291 QVFRIAPH---TIMCLTFMEQTMKL 312
            + ++ P    + +C   +++ M L
Sbjct: 520 TLAKVCPAVSISYLCYENLKKFMNL 544

>Scas_671.1*
          Length = 123

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           V+   +A +A  +T P + IK RMQL+        KV+ N    + +I KNE I  L  G
Sbjct: 44  VSAIASASLATAITAPFDTIKTRMQLK-------PKVFTNFFTTLVLITKNESIFQLFSG 96

Query: 87  LNAAYIYQIGLNGSRLGFYE 106
           L+     +    G   G YE
Sbjct: 97  LSMRLTRKALSAGIAWGIYE 116

>Kwal_27.12599
          Length = 304

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 72/186 (38%), Gaps = 21/186 (11%)

Query: 119 DQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGL 178
           DQ+PH    V  ++               P    K RLQ+          T  T     +
Sbjct: 15  DQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVV 65

Query: 179 VTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTI 238
             + K EG++G ++G    ++  GA  S Q  + N A     +         L L    I
Sbjct: 66  KKLVKNEGLRGFYKGTLTPLVGVGACVSCQFGV-NEAMKRFFRGSSADPHKTLTLPQYYI 124

Query: 239 SGL--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAA 290
            G   GVA   + +P + +  R+  Q        +KGP+DC+ K +R  G  AL +G + 
Sbjct: 125 CGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSP 181

Query: 291 QVFRIA 296
            + R A
Sbjct: 182 TILREA 187

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 116/321 (36%), Gaps = 28/321 (8%)

Query: 12  IEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSA--SAAKVYKNPIQ 69
           + +T +Q      S  AGG+    AV   +P +L+K+R Q     SA  + + + +   Q
Sbjct: 18  VSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQ 77

Query: 70  GMAVIFKNEGIKGLQKG-----LNAAYIYQIGLNGSRLG--FYEPIRSSLNQLFFPDQEP 122
                  N  ++G  KG     L    I+ +   G  +G      + SS        +  
Sbjct: 78  AAGPTSLN-AVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPE 136

Query: 123 HKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIF 182
             +  +    F               + +V    Q  + F+   +Q            I 
Sbjct: 137 LTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQGKASFLDAAKQ------------IV 184

Query: 183 KTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-- 240
           +T+G + LF+G  A + R G GS++    Y   K  L K      G  L +T   ISG  
Sbjct: 185 RTQGFQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSG-ELSITNVCISGGM 243

Query: 241 LGVA--VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPH 298
            GV+  VV+ P D + T++ +         +  ++   R  G+   + G    + R  P 
Sbjct: 244 AGVSMWVVVFPIDTVKTQLQSSSKRQSMLEVTRMIYNTR-GGIKGFFPGVGPAILRSFPA 302

Query: 299 TIMCLTFMEQTMKLVYSIESR 319
                  +E T  L    E +
Sbjct: 303 NAATFLGVELTHSLFKKFEQQ 323

>Scas_714.18
          Length = 305

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/307 (19%), Positives = 114/307 (37%), Gaps = 38/307 (12%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGI-KGLQK 85
           +AG +A  I   +  P + +K+R+Q Q       A ++ +    +   ++NEGI +G  +
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQTQ------EAYMFPSTWSCIKYTYENEGILEGFYQ 70

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G+ +  I     N      Y    S LN          +  +  + +             
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFLNAF-------TEFSAFLIILISAGFAGSCASFV 123

Query: 146 XXPLFLVKTRLQ----SYS---------------EFIKIGEQTHYTGVWNGLVTIFKTEG 186
             P+ L+K +LQ     YS               + + IGE  H T +   + +I K +G
Sbjct: 124 LTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRH-TRIIPTIKSIIKEKG 182

Query: 187 VKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVV 246
           + GL++G  +  +R   GS V    Y   K  L       +     L +   +GL     
Sbjct: 183 LFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGS 242

Query: 247 MNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFM 306
           + P D + + +  +   L    ++ +   +  +GV   Y+G    + R  P         
Sbjct: 243 VFPADTVKSIMQTEHLAL----METVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTY 298

Query: 307 EQTMKLV 313
           E+  K++
Sbjct: 299 EKLSKIL 305

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 85/196 (43%), Gaps = 38/196 (19%)

Query: 20  ISKFGSFVAGGLAACIA--------VTVTNPIELIKIRMQLQGEMSASAAKV-YKNPIQG 70
           +S FG+ + GG++  +A         T    +E+ + +       +ASA  V   + +Q 
Sbjct: 104 LSNFGAGILGGVSGGVAQAYLTMGFCTCMKTVEITRSK-------AASAPGVPVPSSLQV 156

Query: 71  MAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF--PDQEPHKVQSV 128
              IF  EG++G+ KG+NA  I Q+   GSR G    +   + ++     D++   ++ +
Sbjct: 157 FKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKI 216

Query: 129 GVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYS------EFIKIGEQTHYTGVWNGLVTIF 182
             +                P+ +++  +QS +      + + +G+   Y         I+
Sbjct: 217 VASAL-----GGGLSAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRY---------IY 262

Query: 183 KTEGVKGLFRGIDAAI 198
           +  G++GL+RG+   I
Sbjct: 263 ENNGLRGLYRGVTPRI 278

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 9/133 (6%)

Query: 181 IFKTEGVKGLFRGIDAAILR--TGAGSSVQLP--IYNTAKNILVKNDLMKDGPALHLTAS 236
           IF  EG++G+ +G++A  +R  T  GS   L   + +  + +  K    K      + AS
Sbjct: 160 IFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVAS 219

Query: 237 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRI----EGVTALYKGFAAQV 292
            + G G++    P +VI   + ++  D  +     + KT R      G+  LY+G   ++
Sbjct: 220 ALGG-GLSAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI 278

Query: 293 FRIAPHTIMCLTF 305
                 TI  + F
Sbjct: 279 GLGVWQTIFMVGF 291

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 70/167 (41%), Gaps = 32/167 (19%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+  +KTRLQ+   F                   F   G +G++RG+ +A++ +  G+S+
Sbjct: 25  PIDTLKTRLQAKGGF-------------------FHNGGYRGIYRGLGSAVVASAPGASL 65

Query: 208 QLPIYNTAKNILVKNDLMKDGPA--------LHLTASTISGLGVAVVMNPWDVILTRIYN 259
               Y++ K  L    +M    A         H+ +S++  +   +V  P +VI  R   
Sbjct: 66  FFVTYDSMKQQL--RPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVPAEVIKQRTQT 123

Query: 260 QKGDLYKGPIDCLVKTVRIEGVT-ALYKGFAAQVFRIAPHTIMCLTF 305
              +     +  +++    EGV   LY+G+   + R  P T  C+ F
Sbjct: 124 HHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT--CIQF 168

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/282 (21%), Positives = 106/282 (37%), Gaps = 41/282 (14%)

Query: 23  FGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKG 82
             S V+G  A      V  PI+ +K R+Q +G                    F N G +G
Sbjct: 6   LASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG------------------FFHNGGYRG 47

Query: 83  LQKGLNAAYIYQIGLNGSRLGF--YEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXX 140
           + +GL +A +      G+ L F  Y+ ++  L  +        ++  V  ++        
Sbjct: 48  IYRGLGSAVVASA--PGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEM 105

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKT---EG-VKGLFRGIDA 196
                  P  ++K R Q++          H       L  I +    EG V+GL+RG   
Sbjct: 106 SACLVRVPAEVIKQRTQTH----------HTNSSLQTLRLILRDPTGEGVVRGLYRGWWT 155

Query: 197 AILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALH-LTASTISGLGVAVVMNPWDVILT 255
            I+R    + +Q P+Y   K        ++   A       +++G   A    P DV+ T
Sbjct: 156 TIMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKT 215

Query: 256 RIYNQKGDLYKGPIDCLVKTV-RIEGVTALYKGFAAQVFRIA 296
           R+   +  +   P+  L +T+ R EG    ++G   +   I+
Sbjct: 216 RMMLHERRV---PMLHLARTLFREEGARVFFRGIGPRTMWIS 254

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 76/195 (38%), Gaps = 30/195 (15%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN---EGI-KGLQ 84
           G ++AC+   V  P E+IK R Q     S+         +Q + +I ++   EG+ +GL 
Sbjct: 103 GEMSACL---VRVPAEVIKQRTQTHHTNSS---------LQTLRLILRDPTGEGVVRGLY 150

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXX 144
           +G     + +I     +   YE     L + +    E  +V S                 
Sbjct: 151 RGWWTTIMREIPFTCIQFPLYE----YLKKKWAAYAEIERV-SAWQGAVCGSLAGGIAAA 205

Query: 145 XXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
              PL ++KTR+  +   + +              T+F+ EG +  FRGI    +   AG
Sbjct: 206 ATTPLDVLKTRMMLHERRVPMLHLAR---------TLFREEGARVFFRGIGPRTMWISAG 256

Query: 205 SSVQLPIYNTAKNIL 219
            ++ L +Y    ++ 
Sbjct: 257 GAIFLGVYEAVHSLF 271

>Scas_578.3*
          Length = 524

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 89/207 (42%), Gaps = 22/207 (10%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQ---LQGEMSASAAKVYKNPIQGMAVIFK 76
           +SK  ++VAGG+A  +A     PI+ +K R+Q   L+G +  +A       I     ++K
Sbjct: 324 LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALL-----ISTAKEMYK 378

Query: 77  NEGIKGLQKG--LNAAYIY-----QIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVG 129
             GI+   +G  L A  I+      +G   +   +Y  I+    +L  P+++   + S  
Sbjct: 379 EGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWY--IKRQSKKLNIPEKDV--MLSYL 434

Query: 130 VNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKG 189
           + +               P+ L++TRLQ+   +        YTG  +  +   K EGV G
Sbjct: 435 LVLPMGAFSGTVGATAVYPINLLRTRLQAQGTY---AHPYTYTGFRDVFMQTLKREGVPG 491

Query: 190 LFRGIDAAILRTGAGSSVQLPIYNTAK 216
            ++G+   +++     S+    Y   K
Sbjct: 492 FYKGLVPTLVKVCPAVSIGYLCYEKFK 518

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/311 (21%), Positives = 127/311 (40%), Gaps = 44/311 (14%)

Query: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSAS--------------AAKVYK 65
           I  FG F+AGGL+  I+ T T P++ IK+ +  + ++S++               AK+  
Sbjct: 206 IKGFGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRS 265

Query: 66  NPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHK 124
             I+ +  +++  G++    G N   +++I    S + G +E  +  +  L   D+  + 
Sbjct: 266 PIIKAIRSLYRQGGLRAFYVG-NGLSVFKICPESSIKFGTFELAKRLMANL-SGDKLVND 323

Query: 125 VQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLV----- 179
           +  +   V               P+  +K R+Q          + +  G  N L+     
Sbjct: 324 LSKLQTYV-AGGIAGVMAQISIYPIDTLKFRIQCAP------LEGNLKG--NALLISTAK 374

Query: 180 TIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVK------NDLMKD---GPA 230
            ++K  G++  +RG+    L     +++ L  ++  K   +K      N   KD      
Sbjct: 375 EMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYL 434

Query: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVRIEGVTALYK 286
           L L     SG   A  + P +++ TR+  Q        Y G  D  ++T++ EGV   YK
Sbjct: 435 LVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYK 494

Query: 287 GFAAQVFRIAP 297
           G    + ++ P
Sbjct: 495 GLVPTLVKVCP 505

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 117/320 (36%), Gaps = 50/320 (15%)

Query: 20  ISKFGSFVAGGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAKVY-KNPIQGMAVIFKN 77
           +S +  F   G   C    +   PI+++K R+QL+         VY K  I     I  +
Sbjct: 10  LSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLE-------PTVYNKGMISSFKQIISS 62

Query: 78  EGIKGLQKGLNAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX 136
           EG   L  G     +    L GS + G YE  +     +   DQ  +   S+ +      
Sbjct: 63  EGAGALLTGFGPTLL-GYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIG--SAA 119

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      PL   + RL S        + T   G+  G   I K EG    + G   
Sbjct: 120 IAEFFADIALCPLEATRIRLVS--------QPTFANGLVGGFSRILKEEGAGSFYNGFTP 171

Query: 197 AILRTGAGSSVQLPIYNTAKNILVKND----LMKDGPALHL-TASTI---------SGLG 242
            + +       Q+P YN AK ++ +          GP   L TAST          +GL 
Sbjct: 172 ILFK-------QIP-YNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLA 223

Query: 243 VAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMC 302
            A+V  P D +L+++   K    +  I  L +  +  G    + G   ++  +   T+  
Sbjct: 224 AAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVG--TLTS 281

Query: 303 LTF-----MEQTMKLVYSIE 317
           L F     +++T+    +IE
Sbjct: 282 LQFGIYGSLKKTLGCAPAIE 301

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 12/101 (11%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGE-----MSASAAKVYKNPIQGMAVIFKNEGIK 81
           + GG+A      VT P++ IK  +Q++G       S   A  +K   Q    I+++ G K
Sbjct: 231 LCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQA---IWQSYGWK 287

Query: 82  GLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEP 122
           G  +GL    I  I         YE  +     L F  QEP
Sbjct: 288 GFWRGLQPRVISNIPATAISWTSYEFAK----HLLFTKQEP 324

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 85/243 (34%), Gaps = 29/243 (11%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP-------------IQGMAV 73
           +AG  A  +  ++  PI+ +K RMQ   E+ A+A+                   +Q ++ 
Sbjct: 25  IAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISR 84

Query: 74  IFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNV 132
           I   EG   L +G+ +  +     +      YE  +  L +   F   +P K    GV  
Sbjct: 85  ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVSGV-- 142

Query: 133 FXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFR 192
                          P   +K RLQ       +  ++  + +W     I+K EG    F 
Sbjct: 143 ----AATVAADALMNPFDTIKQRLQ-------LQSKSSDSSMWRMAFNIYKNEGPMAFFY 191

Query: 193 GIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDV 252
                +      +++   IY ++      N      P +H     I+G   A V  P D 
Sbjct: 192 SYPTTLAMNIPFAALNFVIYESSTKFF--NPTNAYNPWIHCLCGGIAGATCAAVTTPLDC 249

Query: 253 ILT 255
           I T
Sbjct: 250 IKT 252

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 75/206 (36%), Gaps = 22/206 (10%)

Query: 29  GGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAV-IFKNEGIKGLQKG 86
            G+AA +A   + NP + IK R+QLQ + S S+       +  MA  I+KNEG       
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKSSDSS-------MWRMAFNIYKNEGPMAFFYS 192

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
                   I         YE      N        P    +  ++               
Sbjct: 193 YPTTLAMNIPFAALNFVIYESSTKFFN--------PTNAYNPWIHCLCGGIAGATCAAVT 244

Query: 147 XPLFLVKTRLQ-SYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
            PL  +KT LQ   S+ + +               I+++ G KG +RG+   ++     +
Sbjct: 245 TPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPAT 304

Query: 206 SVQLPIYNTAKNILVKNDLMKDGPAL 231
           ++    Y  AK++L      K  P+L
Sbjct: 305 AISWTSYEFAKHLL----FTKQEPSL 326

>Scas_582.7
          Length = 329

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/301 (20%), Positives = 105/301 (34%), Gaps = 31/301 (10%)

Query: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQK 85
            +AG  A  +  +   PI+ +K R  +Q   +    +   + I+ ++ I   EG   L K
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTR--IQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 86  GLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXX 145
           G+ +  +     +      YE  ++ L     PD +    Q + V V             
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHL----IPDSQRETHQPIKVAV-SGATATVASDFF 152

Query: 146 XXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
             P   +K R+Q  S+  K         V+N    I+  EG+   +      I      +
Sbjct: 153 MNPFDTIKQRMQ-ISDLKK-------EKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFA 204

Query: 206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI-------- 257
           +    IY +A      N L    P +H     ISG   A V  P D I T I        
Sbjct: 205 AFNFMIYESASKFF--NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVV 262

Query: 258 ---YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVY 314
                +K + +K     +   + + G    ++G   ++    P T +  T  E     ++
Sbjct: 263 SLEVMKKANTFKKATSAI---LMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFLF 319

Query: 315 S 315
           S
Sbjct: 320 S 320

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 69/202 (34%), Gaps = 16/202 (7%)

Query: 27  VAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG 86
           V+G  A   +    NP + IK RMQ+          V K        I+  EG+      
Sbjct: 140 VSGATATVASDFFMNPFDTIKQRMQISDLKKEKVYNVAKK-------IYNLEGLSAFYY- 191

Query: 87  LNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXX 146
              +Y   I +N     F   I  S ++ F P    + +    ++               
Sbjct: 192 ---SYPTTIAMNIPFAAFNFMIYESASKFFNPLHHYNPL----IHCLCGGISGAIAAAVT 244

Query: 147 XPLFLVKTRLQSY-SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGS 205
            PL  +KT +Q   S  + +               I    G KG +RG+   IL     +
Sbjct: 245 TPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPAT 304

Query: 206 SVQLPIYNTAKNILVKNDLMKD 227
           ++    Y  AK+ L    L+K+
Sbjct: 305 AISWTAYECAKHFLFSTRLLKN 326

>Scas_198.1
          Length = 72

 Score = 35.0 bits (79), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 25 SFVAGGLAACIAVTVTNPIELIKIRMQLQGEM 56
           F+ GG++A IA T   PIE +KI MQ Q EM
Sbjct: 18 DFLMGGVSAAIAKTGAAPIERVKILMQNQDEM 49

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 67/149 (44%), Gaps = 18/149 (12%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILV----------KNDLMKDGPA 230
           +++  G++  +RG+   IL     +++ L  ++  K   +          +N+++     
Sbjct: 345 MYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLV 404

Query: 231 LHLTASTISGLGVAVVMNPWDVILTRIYNQ----KGDLYKGPIDCLVKTVRIEGVTALYK 286
           + L     SG   A V+ P +++ TR+  Q        Y G  D   KTV+ EG+  LYK
Sbjct: 405 V-LPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYK 463

Query: 287 GFAAQVFRIAPH---TIMCLTFMEQTMKL 312
           G    + ++ P    + +C   +++ M+L
Sbjct: 464 GLVPTLAKVCPAVAISYLCYENLKRAMRL 492

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 14/65 (21%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP--IQGMAVIFK----NEGIKG 82
           G  +  +  TV  PI L++ R+Q QG         Y +P    G   +F+     EG+ G
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQG--------TYAHPHRYDGFQDVFRKTVQREGLPG 460

Query: 83  LQKGL 87
           L KGL
Sbjct: 461 LYKGL 465

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 80/208 (38%), Gaps = 16/208 (7%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNP--IQGMAVIFK 76
           ++S+  ++VAGGL   +A     PI+ +K R+Q     +    +    P  I+    +++
Sbjct: 292 ELSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQ----CAPLDTRCRGLPLLIKTAKDMYR 347

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIR-----SSLNQLFFPDQEPHKVQSVGVN 131
             G++   +GL    +         LG +  ++        N L   + E   V S  V 
Sbjct: 348 EGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENE--VVMSNLVV 405

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
           +               P+ L++TRLQ+   +        Y G  +      + EG+ GL+
Sbjct: 406 LPMGAFSGTVGATVVYPINLLRTRLQAQGTY---AHPHRYDGFQDVFRKTVQREGLPGLY 462

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNIL 219
           +G+   + +     ++    Y   K  +
Sbjct: 463 KGLVPTLAKVCPAVAISYLCYENLKRAM 490

>Kwal_33.15597
          Length = 305

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 93/259 (35%), Gaps = 43/259 (16%)

Query: 20  ISKFGSFVAGGLAAC-IAVTVTNPIELIKIRMQLQGEMSASAAKVY-KNPIQGMAVIFKN 77
           IS +  F   G   C    +   PI+++K R+QL+         VY K  I     I  +
Sbjct: 10  ISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLE-------PTVYNKGMISSFKQIISS 62

Query: 78  EGIKGLQKGLNAAYIYQIGLNGS-RLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXX 136
           EG   L  G     +    L GS + G YE  +         DQ  +   S+ +      
Sbjct: 63  EGAGALLTGFGPTLL-GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIG--SAA 119

Query: 137 XXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDA 196
                      PL   + RL S        + T   G+  G   I K EG+   + G   
Sbjct: 120 IAEFFADIALCPLEATRIRLVS--------QPTFANGLVGGFSRILKEEGLSSFYNGFTP 171

Query: 197 AILRTGAGSSVQLPIYNTAKNILVKND----LMKDGP----------ALHLTASTISGLG 242
            + +       Q+P YN AK ++ +          GP           L+L +   +GL 
Sbjct: 172 ILFK-------QIP-YNIAKFLVFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLA 223

Query: 243 VAVVMNPWDVILTRIYNQK 261
            A+V  P D +L+++   K
Sbjct: 224 AAIVSQPADTLLSKVNKAK 242

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 72/174 (41%), Gaps = 14/174 (8%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYT-GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+ +VKTR+Q         E T Y  G+ +    I  +EG   L  G    +L      S
Sbjct: 33  PIDVVKTRIQL--------EPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 207 VQLPIYNTAKNILVK----NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKG 262
            +   Y   K + +     +  +    ++++ ++ I+     + + P +    R+ +Q  
Sbjct: 85  FKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQP- 143

Query: 263 DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
               G +    + ++ EG+++ Y GF   +F+  P+ I      E+  ++ + +
Sbjct: 144 TFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGM 197

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 35.0 bits (79), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 6/81 (7%)

Query: 233 LTASTISGLGVAVVMNPWDVILTRIY------NQKGDLYKGPIDCLVKTVRIEGVTALYK 286
           L    ISG     ++ P+D++  R        N+ G  YK   D L+   + EG    YK
Sbjct: 14  LAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYK 73

Query: 287 GFAAQVFRIAPHTIMCLTFME 307
           G  A +F++ P T +     E
Sbjct: 74  GLTANLFKVIPSTAVSWLVYE 94

 Score = 34.3 bits (77), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 170 HYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVK 221
            Y  V + L+TI KTEG KG ++G+ A + +    ++V   +Y   +  +V+
Sbjct: 51  RYKSVSDALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 33.9 bits (76), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 36/84 (42%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLN 88
           G ++  +A T+  P +L++ R Q+           YK+    +  I K EG KG  KGL 
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLT 76

Query: 89  AAYIYQIGLNGSRLGFYEPIRSSL 112
           A     I         YE IR ++
Sbjct: 77  ANLFKVIPSTAVSWLVYEVIREAM 100

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 70/162 (43%), Gaps = 26/162 (16%)

Query: 148 PLFLVKTRLQSYSEFIKIG---EQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204
           PL L KT +Q+  +    G   E+  Y  V + ++ IFK  G  GL++G+   +    A 
Sbjct: 23  PLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLYQGLATNV----AA 78

Query: 205 SSVQLPIYNTAKNILVKN---------DLMKDGPALHLTASTISGLGVA------VVMNP 249
           + VQ  IY    +++  N          L  D   + L+      LG++      VV NP
Sbjct: 79  NFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAGAMTQVVTNP 138

Query: 250 WDVILTRIYNQKGDLYKGPIDCLVKTVRIEG---VTALYKGF 288
             VI TR    K D     +  ++K +  E    +TA +KGF
Sbjct: 139 ISVISTRQQLTK-DGEDASLKAVIKQIYEESNGDLTAFWKGF 179

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 4/91 (4%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA----AKVYKNPIQGMAVIFKNEGI 80
           S   G +A+ +A T   P++L K  +Q Q + + S      + YKN I  +  IFK  G 
Sbjct: 6   SAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 81  KGLQKGLNAAYIYQIGLNGSRLGFYEPIRSS 111
            GL +GL          N     +Y  IRS+
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRSN 96

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 11/70 (15%)

Query: 233 LTASTISGLGVAVVMNPWDVILTRIYNQ-----KGDL-----YKGPIDCLVKTVRIEGVT 282
            T +  S L  A  + P D+  T I  Q      GD      YK  IDC++K  +  G  
Sbjct: 8   FTGAVASSLA-ATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFL 66

Query: 283 ALYKGFAAQV 292
            LY+G A  V
Sbjct: 67  GLYQGLATNV 76

>Kwal_56.23011
          Length = 303

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 110/298 (36%), Gaps = 41/298 (13%)

Query: 29  GGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKG-- 86
           GG+A    V V  P ++ K+R+Q    +  +AA+V K+       + KNEG+    KG  
Sbjct: 33  GGVAQ---VLVGQPFDITKVRLQ-TSPVPTTAAQVIKS-------LVKNEGLLAFYKGTL 81

Query: 87  -----LNAAYIYQIGLNGSRLGFYEPIRSSLNQ-LFFPDQEPHKVQSVGVNVFXXXXXXX 140
                + A    Q G+N +   ++     + +Q L           S   N F       
Sbjct: 82  APLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLAT---- 137

Query: 141 XXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
                  P+  V+ RLQ  +      E   Y G  +    + K      L RG  A  LR
Sbjct: 138 -------PIEHVRIRLQLQTASSSAAE---YHGSLDCARKLLKQ---GALMRGFTATTLR 184

Query: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDG-PALHLTA-STISGLGVAVVMNPWDVI--LTR 256
           T  G  +    Y T       + ++++  PA  +      SG     +  P+DV+  + +
Sbjct: 185 TSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQ 244

Query: 257 IYNQKGDLY-KGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
               K  +Y + P+       R  G  A  KGF   + R  P         E TM+L+
Sbjct: 245 ADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLI 302

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 10/95 (10%)

Query: 13  EKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVY-KNPIQGM 71
           E   A K+  +G+F      A     +T P +++K  MQ     +     VY +NP+   
Sbjct: 211 ENIPAWKVCVYGAFSGAFFWA-----MTYPFDVVKSVMQADKLKN----PVYGRNPLAVA 261

Query: 72  AVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYE 106
             I++  G +   KG     +  + +NG+    +E
Sbjct: 262 KAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFE 296

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 31  LAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAA 90
           L+A +A TVT P + IK RMQL+          + N       I KNE +  L  GL+  
Sbjct: 232 LSASLATTVTAPFDTIKTRMQLEPSK-------FTNSFNTFTSIVKNENVLKLFSGLSMR 284

Query: 91  YIYQIGLNGSRLGFYEPI 108
              +    G   G YE +
Sbjct: 285 LARKAFSAGIAWGIYEEL 302

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 8/65 (12%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P   +KTR+Q         E + +T  +N   +I K E V  LF G+   + R    + +
Sbjct: 243 PFDTIKTRMQL--------EPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGI 294

Query: 208 QLPIY 212
              IY
Sbjct: 295 AWGIY 299

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 7/101 (6%)

Query: 17  AQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFK 76
           A  +S   +F+ G L+  I+  VT P+ + K  +Q       SA   +    + +  ++K
Sbjct: 217 AGSLSAVQNFILGVLSKMISTLVTQPLIVAKAMLQ-------SAGSKFTTFQEALLYLYK 269

Query: 77  NEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF 117
           NEG+K L KG+       + + G    F   +  SL +L F
Sbjct: 270 NEGLKSLWKGVLPQLTKGVIVQGLLFAFRGELTKSLKRLIF 310

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 9/96 (9%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAA---------KVYKNPIQGMAVIF 75
           S + G +A+ +A     P++L K  +Q Q   S+S           + YKN +  M  IF
Sbjct: 6   SALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIF 65

Query: 76  KNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSS 111
           K +GI GL +G+    +     N     +Y  IR S
Sbjct: 66  KEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKS 101

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 26/132 (19%)

Query: 148 PLFLVKTRLQSY--------SEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199
           PL L KT +QS         S   K+     Y  V + ++ IFK +G+ GL++G+    +
Sbjct: 23  PLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEKGILGLYQGMTVTTV 82

Query: 200 RTGAGSSVQLPIYNTAKNILVKNDLM-------KDGPALHLTASTISG--LGVA------ 244
            T   + V    Y   +   +K+ L+       +DGP   +T STI    LGVA      
Sbjct: 83  ATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGP---ITPSTIEELVLGVAAASISQ 139

Query: 245 VVMNPWDVILTR 256
           +  +P  V+ TR
Sbjct: 140 LFTSPMAVVATR 151

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 68/176 (38%), Gaps = 20/176 (11%)

Query: 21  SKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG- 79
           S     V G  AA I+   T+P+ ++  R Q     SA +AK + N I+   +  +N G 
Sbjct: 123 STIEELVLGVAAASISQLFTSPMAVVATRQQ--TVHSAESAK-FTNVIKD--IYRENNGD 177

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGV-NVFXXXXX 138
           I    KGL       I  + +   F       L ++FF D          V N       
Sbjct: 178 ITAFWKGLRTGLALTINPSITYASF-----QRLKEVFFHDHSNDAGSLSAVQNFILGVLS 232

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194
                    PL + K  LQS          + +T     L+ ++K EG+K L++G+
Sbjct: 233 KMISTLVTQPLIVAKAMLQSAG--------SKFTTFQEALLYLYKNEGLKSLWKGV 280

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 2/108 (1%)

Query: 3   SDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAK 62
           S   +    ++K++   I K G  +AGG+A   A T+  P++ IKI  Q      A  A 
Sbjct: 2   SGRQRGSGPVDKSSVDYIVKSG--LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAG 59

Query: 63  VYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRS 110
                ++    I  ++G +G  +G +A  +        +   YE IRS
Sbjct: 60  SMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRS 107

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 9/89 (10%)

Query: 5   NSKQDKQIE-KTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV 63
           +S  D+ +  KT AQ        VAGGLA   + T   P E+I+ R+Q+   ++    + 
Sbjct: 233 SSAYDRTVPLKTWAQ-------LVAGGLAGMASQTAAYPFEIIRRRLQVSA-ITDPTRRH 284

Query: 64  YKNPIQGMAVIFKNEGIKGLQKGLNAAYI 92
           +    +   +I+   G +G   GL+  YI
Sbjct: 285 FVGINEIAKIIYTEGGWRGFFVGLSIGYI 313

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 171 YTGVWNGLVT----IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMK 226
           + G   GLV     I   +G +G F+G  A +LR    ++++   Y   +++++      
Sbjct: 57  FAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSVVIPT-WRH 115

Query: 227 DGPALHLTASTISGLGVAVVMNPWDVILTRI 257
           +     L + +++GL    V  P D++  R+
Sbjct: 116 ESHWRRLLSGSLAGLCSVFVTYPLDLVRVRL 146

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 109/308 (35%), Gaps = 34/308 (11%)

Query: 21  SKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG- 79
           + F   + G +A  +   +  P + +K+R+Q QG        V+ +    +   +KNEG 
Sbjct: 12  AAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQGR------HVFPDTWSCITYTYKNEGI 65

Query: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXX 139
           IKG  +G+ A+ +    +  + L        S NQ     Q    V  +   +       
Sbjct: 66  IKGFFQGI-ASPLAGAAIENAALFL------SYNQCSKFLQHYTNVSDLTNILISGAFAG 118

Query: 140 XXXXXXXXPLFLVKTRLQ-SYSEFIKIG------EQTHYTGVWNGLVTIFKTEGVKGLFR 192
                   P+ L+K +LQ S  + + +G          +T +   +  + K  G  GL++
Sbjct: 119 SCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQ 178

Query: 193 GIDAAILRTGAGSSVQLPIYNTAKNILVKN------DLMKDGPALHLTASTIS-GLGVAV 245
           G     +R   G       Y   K  L          L  D     L AS  S GL    
Sbjct: 179 GQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNA 238

Query: 246 VMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIE-GVTALYKGFAAQVFRIAPHTIMCLT 304
            + P D + + +  +   L        +K + +E G+   Y+G    + R  P       
Sbjct: 239 SIFPADTVKSMMQTEHLGL-----KTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFY 293

Query: 305 FMEQTMKL 312
             E   KL
Sbjct: 294 VYETLSKL 301

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 67/175 (38%), Gaps = 16/175 (9%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYT-GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+ +VKTR+Q         E T Y  G+      I   EG   L  G    +L      +
Sbjct: 33  PIDVVKTRIQL--------EPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGA 84

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVA-----VVMNPWDVILTRIYNQK 261
            +   Y   K   + + L  D  A +  +  I     A     + + P +    R+ +Q 
Sbjct: 85  FKFGGYEVFKKFFI-DTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQP 143

Query: 262 GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
                G +    + ++ EGV + Y GF   +F+  P+ I      E+  +L +S+
Sbjct: 144 -TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFSL 197

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 88/253 (34%), Gaps = 41/253 (16%)

Query: 21  SKFGSFVAGGLAACIAVTVTN-PIELIKIRMQLQGEMSASAAKVY-KNPIQGMAVIFKNE 78
           S +  F   G   C +   +  PI+++K R+QL+         VY K  +     I   E
Sbjct: 11  SDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLE-------PTVYNKGMVGSFRKIIAEE 63

Query: 79  GIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXX 138
           G   L  G     +        + G YE  +         D       SV +        
Sbjct: 64  GAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIG--SAAAA 121

Query: 139 XXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAI 198
                    PL   + RL        + + T   G+  G   I K EGV   + G    +
Sbjct: 122 EFLADIALCPLEATRIRL--------VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPIL 173

Query: 199 LRTGAGSSVQLPIYNTAKNILV-------------KNDLMKDG-PALHLTASTISGLGVA 244
            +       Q+P YN AK ++              K+ L +    A++L +   +GL  A
Sbjct: 174 FK-------QIP-YNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAA 225

Query: 245 VVMNPWDVILTRI 257
           +V  P D +L+++
Sbjct: 226 IVSQPADTLLSKV 238

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 67/174 (38%), Gaps = 14/174 (8%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYT-GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+ +VKTR+Q         E T Y  G+ +    I  +EG   L  G    +L      S
Sbjct: 33  PIDVVKTRIQL--------EPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGS 84

Query: 207 VQLPIYNTAKNILVKN----DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKG 262
            +   Y   K + + N    + +     +++ ++ I+     + + P +    R+ +Q  
Sbjct: 85  FKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQP- 143

Query: 263 DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
               G      + ++ EGV + Y GF   +F+  P+ I      E      + +
Sbjct: 144 TFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANAYFGL 197

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 116/308 (37%), Gaps = 55/308 (17%)

Query: 20  ISKFGSFVAGGLAAC-IAVTVTNPIELIKIRMQLQGEMSASAAKVY-KNPIQGMAVIFKN 77
           +S +  F   G   C I  +   PI+++K R+QL+         VY K  +     I  +
Sbjct: 10  VSDYAKFALAGAIGCGITHSSMVPIDVVKTRIQLE-------PTVYNKGMVSSFKQIISS 62

Query: 78  EGIKGLQKGLNAAYIYQIGLNGS-RLGFYEPIRS-SLNQLFFPDQEPHK----VQSVGVN 131
           EG   L  G     +    L GS + G YE  +  +++ + + +   +K    + S  + 
Sbjct: 63  EGAGALLTGFGPTLL-GYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIA 121

Query: 132 VFXXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLF 191
            F              PL   + RL        + + T   G++ G   I K EGV   +
Sbjct: 122 EFFADIALC-------PLEATRIRL--------VSQPTFANGLFGGFSRILKEEGVGSFY 166

Query: 192 RGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMK----DGPALHLTASTISGLGVA--- 244
            G    + +       Q+P YN AK  + ++         GP   ++ +T + + +A   
Sbjct: 167 NGFTPILFK-------QIP-YNIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGL 218

Query: 245 -------VVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297
                  VV  P D +L+++   K    +  I  L +  +  G    + G   ++  +  
Sbjct: 219 TAGLAAAVVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVG- 277

Query: 298 HTIMCLTF 305
            T+  L F
Sbjct: 278 -TLTSLQF 284

>Scas_705.9
          Length = 323

 Score = 34.7 bits (78), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 7   KQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKN 66
           KQ    EK+ + +++   +F+ G LA  I+  +T P+ + K+ +Q       S +K +K+
Sbjct: 207 KQVSNSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQ------RSNSK-FKH 259

Query: 67  PIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFF 117
             + +  ++K EG+  L KG+       + + G    F   +  S  +L F
Sbjct: 260 FEEVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVFAFKGELTKSWKRLLF 310

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 73/162 (45%), Gaps = 24/162 (14%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQT-------HYTGVWNGLVTIFKTEGVKGLFRGIDAAILR 200
           PL + KT +QS ++  +  E +           V   L+ IF+  G++GL++G+  ++  
Sbjct: 23  PLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRGLRGLYQGMSTSVFS 82

Query: 201 TGAGSSVQLPIYNTAKNILVKNDLMKDGPA-----LHLTASTISGLGVA----VVMNPWD 251
               S      Y+  +       L+++  A     +      I G+G A    VV NP +
Sbjct: 83  KFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVGVGAAALTQVVNNPIE 142

Query: 252 VILTRIYNQKGDLYKGPID--CLVKTVRIEG---VTALYKGF 288
           VILT+   Q+    K  +D   ++K + +E    +++ +KGF
Sbjct: 143 VILTK---QQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGF 181

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 20 ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQ------GEMSASAAKVYK--NPIQGM 71
          +S   S + G +A+ +A  +  P+++ K  +Q +       E+S    ++ +  N I+ +
Sbjct: 1  MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 72 AVIFKNEGIKGLQKGLNAA 90
            IF+  G++GL +G++ +
Sbjct: 61 IRIFRKRGLRGLYQGMSTS 79

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 16  AAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIF 75
           A Q +    +F+ G L+  + V  T P++ +K RMQ      A  A  Y + +     + 
Sbjct: 205 ADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ------ALDAARYGSTVGCFRAVV 258

Query: 76  KNEGIKGLQKG 86
           + EG++ L +G
Sbjct: 259 REEGVRALWRG 269

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 113/296 (38%), Gaps = 20/296 (6%)

Query: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84
           SFVAG  A  I   VT P E  K R+QL  + S  +    +NP+  +    + +G   L 
Sbjct: 13  SFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGES----RNPLVLLYRTARTQGAGALY 68

Query: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHK-VQSVGVNVFXXXXXXXXXX 143
            G  A  +      G R   ++ +R +L         P   +  +G  +           
Sbjct: 69  VGCPAFVVGNTCKAGVRFLGFDALRRALQDERGALSGPRGMLAGLGAGLLESVLAVT--- 125

Query: 144 XXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203
               P   VKT L    +  +   Q +  G       + +  G++GL+ G+    LR  +
Sbjct: 126 ----PFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQAS 181

Query: 204 GSSVQLPIYNTAKNILVK------NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRI 257
             +V+   Y   K  + +      +  +  G    + A  +SG+       P D + TR+
Sbjct: 182 NQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGA--LSGIVTVYATMPVDTVKTRM 239

Query: 258 YNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLV 313
                  Y   + C    VR EGV AL++G   ++ R+     +  T  E+ + L+
Sbjct: 240 QALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLLVLL 295

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/172 (19%), Positives = 66/172 (38%), Gaps = 14/172 (8%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYT-GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+ +VKTR+Q         E T Y  G+      I   EG   L  G    +L      +
Sbjct: 37  PIDVVKTRIQL--------EPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGA 88

Query: 207 VQLPIYNTAKNILVKN----DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKG 262
            +   Y   K   + N       +   ++++ ++ ++     + + P +    R+ +Q  
Sbjct: 89  FKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQP- 147

Query: 263 DLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVY 314
               G +    + ++ EG+ + Y GF   +F+  P+ I      E+  +  Y
Sbjct: 148 QFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYY 199

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 93/262 (35%), Gaps = 49/262 (18%)

Query: 20  ISKFGSFVAGGLAACIAVTVTN-PIELIKIRMQLQGEMSASAAKVY-KNPIQGMAVIFKN 77
           +S +  F   G   C +   +  PI+++K R+QL+         VY K  +     I   
Sbjct: 14  VSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLE-------PTVYNKGMVGSFKQIIAG 66

Query: 78  EGIKGLQKGLNAAYI-YQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSV---GVNVF 133
           EG   L  G     + Y I     + G YE  +      FF D   +   S     V + 
Sbjct: 67  EGAGALLTGFGPTLLGYSI-QGAFKFGGYEVFKK-----FFIDNLGYDTASRYKNSVYMG 120

Query: 134 XXXXXXXXXXXXXXPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRG 193
                         PL   + RL S  +F          G+  G   I K EG+   + G
Sbjct: 121 SAAMAEFLADIALCPLEATRIRLVSQPQFAN--------GLVGGFSRILKEEGIGSFYSG 172

Query: 194 IDAAILRTGAGSSVQLPIYNTAKNILVKND----LMKDGPA----------LHLTASTIS 239
               + +       Q+P YN AK ++ +          GP           L+L +   +
Sbjct: 173 FTPILFK-------QIP-YNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTA 224

Query: 240 GLGVAVVMNPWDVILTRIYNQK 261
           GL  A+V  P D +L+++   K
Sbjct: 225 GLAAAIVSQPADTLLSKVNKTK 246

>Scas_673.17
          Length = 314

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 66/176 (37%), Gaps = 18/176 (10%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYT-GVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSS 206
           P+ +VKTR+Q         E T Y  G+      I   EG   L  G    +L      +
Sbjct: 40  PVDVVKTRIQL--------EPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGA 91

Query: 207 VQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVA------VVMNPWDVILTRIYNQ 260
            +   Y   K + +  D +    A+H   S   G          + + P +    R+ +Q
Sbjct: 92  FKFGGYEVFKKLSI--DTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQ 149

Query: 261 KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
                 G +    + ++ EGV + Y GF   +F+  P+ I      E+  ++ Y I
Sbjct: 150 P-TFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGI 204

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 63/178 (35%), Gaps = 14/178 (7%)

Query: 42  PIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSR 101
           P+E  +IR+  Q   +          + G + I K EG+     G       QI  N ++
Sbjct: 138 PLEATRIRLVSQPTFA-------NGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAK 190

Query: 102 LGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRLQSYSE 161
              +E        +    +    + + G+N+               P     T L   ++
Sbjct: 191 FLVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQP---ADTLLSKVNK 247

Query: 162 FIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL 219
             K   Q+        L  + K  GV G F G+   ++  G  +S+Q  IY + KN L
Sbjct: 248 TKKAPGQS----TIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTL 301

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 18/101 (17%)

Query: 65  KNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSL---------NQL 115
           K+ +  M  I   EGIKGL K  N  +IYQI L+ +   +Y  + S L         + +
Sbjct: 234 KHTLDIMNSILDEEGIKGLWKANNTNFIYQI-LSSTLEAWYTGLISPLLHIPDPYFIDLI 292

Query: 116 FFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRL 156
            FPD +   + ++ V V               P+ L++TR 
Sbjct: 293 HFPDTQSAVLLTLSVGVL--------TALTLIPIDLIRTRF 325

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 107/270 (39%), Gaps = 37/270 (13%)

Query: 36  AVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQI 95
           ++ +T P+  I  ++Q QG    +     K+ ++ +  I++ +G+ G   GL +A IY +
Sbjct: 27  SMALTYPLVTITTKLQTQGNDENNQV---KSKLETIKEIYRKDGLLGFYAGLESA-IYGM 82

Query: 96  GL-NGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKT 154
            L N     FYE   +S N L       HK  +   ++               P+++  T
Sbjct: 83  ALTNFVYYYFYE--LTSRNVL---KVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANT 137

Query: 155 RLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNT 214
           R+      +   E+T    +    + I K +  K LF G+  A++       VQ  ++  
Sbjct: 138 RMT-----VTKSEKTALATI----IEIVKKDSAKTLFNGLKPALVLV-MNPIVQYTVFEQ 187

Query: 215 AKN-ILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIY---------NQKGDL 264
            KN +L  N      P+       +  L       P+  + TR++         +  G  
Sbjct: 188 LKNLVLAWNKQGILSPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKK 247

Query: 265 YKGP-------IDCLVKTVRIEGVTALYKG 287
            KG        +  + + V+ +GV+ LY+G
Sbjct: 248 AKGHKASSKSMLSLITEIVKKDGVSGLYRG 277

>KLLA0A01342g complement(120385..122730) some similarities with
           sp|P18494 Saccharomyces cerevisiae YER040w GLN3
           transcription factor for positive nitrogen regulation,
           hypothetical start
          Length = 781

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 170 HYTGVWNGLVTIFKTEGVKG---------LFRGIDAAILRTGAGS----SVQLPIYNTAK 216
           H+   WN L+      G            LF+  +++     A        QLP  ++++
Sbjct: 218 HFQNSWNHLLHQQHDNGPNSSSLAYQHPRLFQNNNSSQSTIKADEYQHKQPQLPRRSSSR 277

Query: 217 NILVKNDLMKDGPALHLTASTISGL 241
           N+L+KND+ +DG AL L   T + L
Sbjct: 278 NLLIKNDMNEDG-ALPLLTHTTTNL 301

>Scas_613.24
          Length = 177

 Score = 31.2 bits (69), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 230 ALHLTASTISGLGVAVVMNPWDVILTRIYNQKG 262
           ++HL +  I GL  AV + P D++ TRI   KG
Sbjct: 9   SVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKG 41

 Score = 30.8 bits (68), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 19  KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNE 78
           +++ + + + G +A  +   +T PI ++K+R +       S    YK+  + +  I+K E
Sbjct: 103 QLTMYENLLTGAMARGLVGYITMPITILKVRYE-------STYYSYKSMNEAIKDIYKME 155

Query: 79  GIKGLQKGL 87
           GI G  KG 
Sbjct: 156 GISGFFKGF 164

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 61/156 (39%), Gaps = 26/156 (16%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           PL L+KTR+Q          Q     +W+ +  I   +     +RG   + LRT  GS++
Sbjct: 28  PLDLLKTRIQ----------QHKGATLWSAIKDI---KDPIQFWRGTLPSALRTSIGSAL 74

Query: 208 QLPIYNTAKNILVKNDLMKDG------PALH-----LTASTISGLGVAVVMNPWDVILTR 256
            L   N  +  LV              P L      LT +   GL V  +  P  ++  R
Sbjct: 75  YLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGL-VGYITMPITILKVR 133

Query: 257 IYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQV 292
            Y      YK   + +    ++EG++  +KGF   V
Sbjct: 134 -YESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces
           cerevisiae YDL154w MSH5 meiosis-specific protein,
           hypothetical start
          Length = 867

 Score = 32.0 bits (71), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 82  GLQKGLNAAYIYQIG----LNGSRLGFYEPIRSSLN-QLFFPDQEPH 123
            L +GLNA YI Q+G    +  +R+ ++  +  SLN QL F D   H
Sbjct: 431 NLAEGLNALYIPQLGFLVTIENTRVHYWGEVWGSLNWQLVFKDNSHH 477

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 10/137 (7%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVK----NDLMKDGPALHLTAS 236
           I  T GV+ LFRG  A + R G GS++    Y   K  L      N+L      L   A 
Sbjct: 192 ILATGGVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCL---AG 248

Query: 237 TISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIE-GVTALYKGFAAQVFRI 295
            ++G+ + V + P D I T +  Q  +  +  ++   K      G+   + G    + R 
Sbjct: 249 GMAGVSMWVGVFPIDTIKTEL--QSSNTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRS 306

Query: 296 APHTIMCLTFMEQTMKL 312
            P        +E T  L
Sbjct: 307 FPANAATFLGVELTHSL 323

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 30/173 (17%), Positives = 63/173 (36%), Gaps = 12/173 (6%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P+ +VKTR+Q       +    + +G+      I   EG   L  G    +L      + 
Sbjct: 35  PIDVVKTRIQ-------LEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLLGYSMQGAF 87

Query: 208 QLPIYNTAKNILVK----NDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 263
           +   Y   K   V         +    +++ ++ I+     + + P +    R+ +Q   
Sbjct: 88  KFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRIRLVSQP-T 146

Query: 264 LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316
              G +    + ++ EG+ + Y GF   +F+  P+ I      E      + +
Sbjct: 147 FANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKFVVFEHAANAYFGL 199

>Scas_628.9
          Length = 621

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 10/52 (19%)

Query: 223 DLMKDGPALHLTASTISGLGVAVV----------MNPWDVILTRIYNQKGDL 264
           DLM D P LH   S ISGL   +           M  ++ +  +IYN+KG+L
Sbjct: 269 DLMLDKPLLHCPPSLISGLVKQMTSAEGESNNSSMMSFNKLDKKIYNKKGEL 320

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 51/124 (41%), Gaps = 14/124 (11%)

Query: 181 IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGP--ALHLTASTI 238
           + K EG +G ++G    ++  GA  SVQ  +    K      +    GP   L L    +
Sbjct: 67  LVKNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRN-GNSGPNETLGLLQYYL 125

Query: 239 SGL--GVA--VVMNPWDVILTRIYNQKGD----LYKGPIDCLVKTVRIEGVTALYKGFAA 290
            G   G A   + +P + +  R+  Q G      + GP+DC+ K   +    +L +G   
Sbjct: 126 CGFAGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKK---LTANNSLMRGLTP 182

Query: 291 QVFR 294
            + R
Sbjct: 183 TMLR 186

>Kwal_33.12988
          Length = 303

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 63/156 (40%), Gaps = 19/156 (12%)

Query: 148 PLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSV 207
           P  + K RLQ+ S        T    V   LV   K EG++G ++G    ++  G   S 
Sbjct: 43  PFDITKVRLQTSST------PTTALRVVQDLV---KNEGLRGFYKGTTLPLIGVGLCVSS 93

Query: 208 QLPIYNTAKNILVK-NDLMKDGPAL--HLTASTISGLGVAVVMNPWD---VILTRIYNQK 261
           Q       K    K N+       L  +     +SG   A +  P +   ++L      +
Sbjct: 94  QFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVRILLQVQTKSR 153

Query: 262 GDL-YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIA 296
            D  Y+G +DC+ K ++ EG   L +GF   + R +
Sbjct: 154 ADAEYQGAMDCIKKLLK-EG--KLMRGFTPTILRTS 186

>Sklu_2250.1 YBL030C, Contig c2250 1624-1847
          Length = 75

 Score = 28.1 bits (61), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 29 GGLAACIAVTVTNPIELIKIRMQLQGEM 56
          GG++A ++ T   PIE +K+ +Q Q EM
Sbjct: 2  GGVSAAVSKTAAAPIERVKLLIQNQDEM 29

>KLLA0C15983g 1389936..1395617 highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2 fatty-acyl-CoA
            synthase, alpha chain singleton, start by similarity
          Length = 1893

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 168  QTHYTGVWNGLVTIFKTEGVKGLFRGI---DAAILRTGAGSSVQLPIYNTAKNI 218
            Q+ + G W+    +FK+ GVK    G    D  I+R  +G   ++ ++N A  I
Sbjct: 1813 QSSFAGTWSAKEAVFKSLGVKSQGAGAPLKDIEIVREKSGEPPKVQLHNEAAKI 1866

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 62/157 (39%), Gaps = 9/157 (5%)

Query: 168 QTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNIL-----VKN 222
           +  Y    + +V +++ EG  GL+ G+ A++L T   S      Y   +        VK 
Sbjct: 84  EQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKG 143

Query: 223 DLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIE-GV 281
           +  +      L  S ++     +  NP +++ T+   ++G         + K V  E G+
Sbjct: 144 EAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGI 203

Query: 282 TALYKGFAAQ-VFRIAPHTIMCLTFMEQTMKLVYSIE 317
           T  +K      V  I P   +     E+   ++Y +E
Sbjct: 204 TGFWKSLKVSLVLTINPS--ITYASAEKLKDILYHVE 238

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 260 QKGDLYKGPIDCLVKTVRIEGVTALYKGFAA 290
           Q  + YKG +D L +    EGV  LY+G  +
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGS 97

>CAGL0M05423g 577097..579535 highly similar to sp|P38132
           Saccharomyces cerevisiae YBR202w CDC47, start by
           similarity
          Length = 812

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 24/41 (58%), Gaps = 5/41 (12%)

Query: 248 NPWDVILTRI--YNQKGDLYKG--PIDCLVKTVRIEGVTAL 284
           NP   I T I   +Q+GD YKG  P D +VKTVR  G T L
Sbjct: 733 NPTTKIFTIIKKMSQEGD-YKGSLPYDSIVKTVRSRGFTML 772

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 22/113 (19%)

Query: 55  EMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQI----------GLNGSRLGF 104
           ++S + A    + I  +  +F  EGI+GL K  N  +IY            GL  S LG 
Sbjct: 217 DISLTIAPQSLHTIDVINALFDQEGIRGLWKANNTTFIYNFLSLSIDTWFTGLLSSFLGV 276

Query: 105 YEP-IRSSLNQLFFPDQEPHKVQSVGVNVFXXXXXXXXXXXXXXPLFLVKTRL 156
            +P     +N    PD     + ++G  VF              P+ L++TRL
Sbjct: 277 PDPYFMEVINS---PDISKSFILALGAGVF--------TSIILLPVDLIRTRL 318

>Kwal_56.22641
          Length = 722

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 5   NSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIK 47
           +SKQD++ +K  A  IS+ G +   GLA  + V     I +I+
Sbjct: 79  DSKQDEESQKATADLISQIGVYTIHGLANRVVVENEGLINIIE 121

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,612,955
Number of extensions: 318495
Number of successful extensions: 1985
Number of sequences better than 10.0: 220
Number of HSP's gapped: 1357
Number of HSP's successfully gapped: 601
Length of query: 319
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 217
Effective length of database: 13,065,073
Effective search space: 2835120841
Effective search space used: 2835120841
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)