Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL117W (SBA1)2161997991e-109
CAGL0K11572g2181454894e-62
Sklu_2430.141681214724e-60
Scas_721.1312381244681e-58
Scas_254.1*1371214331e-54
Kwal_26.76772021204145e-51
ABL057W2341214081e-49
KLLA0C14322g1841203232e-37
YKL059C (MPE1)44158670.95
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL117W
         (213 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL117W (SBA1) [3147] chr11 (219970..220620) Ste5p-associated pr...   312   e-109
CAGL0K11572g complement(1120136..1120792) similar to sp|P28707 S...   192   4e-62
Sklu_2430.14 YKL117W, Contig c2430 26534-27040                        186   4e-60
Scas_721.131                                                          184   1e-58
Scas_254.1*                                                           171   1e-54
Kwal_26.7677                                                          164   5e-51
ABL057W [535] [Homologous to ScYKL117W (SBA1) - SH] complement(2...   161   1e-49
KLLA0C14322g complement(1243993..1244547) similar to sp|P28707 S...   129   2e-37
YKL059C (MPE1) [3200] chr11 complement(327763..329088) Component...    30   0.95 

>YKL117W (SBA1) [3147] chr11 (219970..220620) Ste5p-associated
           protein, putative cochaperone with Hsp90 family proteins
           (Hsp82p, Hsc82p) [651 bp, 216 aa]
          Length = 216

 Score =  312 bits (799), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 155/199 (77%), Positives = 155/199 (77%)

Query: 1   MSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDE 60
           MSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDE
Sbjct: 1   MSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDE 60

Query: 61  NVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTD 120
           NVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTD
Sbjct: 61  NVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTD 120

Query: 121 FDKWXXXXXXXXXXXXGNDAAQGMDFSQXXXXXXXXXXXXXXDFSQXXXXXXXXXSPDMX 180
           FDKW            GNDAAQGMDFSQ              DFSQ         SPDM 
Sbjct: 121 FDKWVDEDEQDEVEAEGNDAAQGMDFSQMMGGAGGAGGAGGMDFSQMMGGAGGAGSPDMA 180

Query: 181 XXXXXXXXSGGNLDMGDFK 199
                   SGGNLDMGDFK
Sbjct: 181 QLQQLLAQSGGNLDMGDFK 199

>CAGL0K11572g complement(1120136..1120792) similar to sp|P28707
           Saccharomyces cerevisiae YKL117w SBA1 Hsp90 Associated
           Co-chaperone, hypothetical start
          Length = 218

 Score =  192 bits (489), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 112/145 (77%), Gaps = 2/145 (1%)

Query: 4   KVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVH 63
           KV+ P+VAWAQRSS +D E+NY+LITVSI DC++PE+ I+   ++L+AQS+ HVGDE+ H
Sbjct: 3   KVLTPEVAWAQRSSESDAEKNYLLITVSIPDCESPEVKIEAGSLDLEAQSRGHVGDEHKH 62

Query: 64  HYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDK 123
            Y+LHID YK+I+PEK++HK+ANGQHYFLKL+KKDLE EYWPRLTKEK+KY  IKTDFDK
Sbjct: 63  TYKLHIDFYKDIVPEKSLHKIANGQHYFLKLFKKDLELEYWPRLTKEKIKYSNIKTDFDK 122

Query: 124 WXXXXXXXXXXXXGNDAAQGMDFSQ 148
           W            G      MDFSQ
Sbjct: 123 WVDEDEQETAADTGMPG--DMDFSQ 145

>Sklu_2430.14 YKL117W, Contig c2430 26534-27040
          Length = 168

 Score =  186 bits (472), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 82/121 (67%), Positives = 103/121 (85%)

Query: 4   KVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVH 63
           KVI P+V WAQRSS +DP+RNY+L+T+ + DC++P+L +KP Y+E  A S  HVGDE+ H
Sbjct: 3   KVITPEVLWAQRSSDSDPKRNYLLLTIGVRDCESPKLDLKPGYLEFTANSPGHVGDESAH 62

Query: 64  HYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDK 123
            Y+LHID YK+IIPE +++KVANGQ YFLKLYKKDL+SEYWPRLTKEK+KY +IKTDFDK
Sbjct: 63  SYRLHIDFYKDIIPEDSLNKVANGQDYFLKLYKKDLDSEYWPRLTKEKLKYHFIKTDFDK 122

Query: 124 W 124
           W
Sbjct: 123 W 123

>Scas_721.131
          Length = 238

 Score =  184 bits (468), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 103/124 (83%)

Query: 1   MSDKVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDE 60
           M+ K++ P+V WAQRS+ TD E+NY+LITV+I DC+ P+L ++ ++ EL A SK HVGDE
Sbjct: 1   MASKILTPEVRWAQRSNETDSEKNYLLITVTIPDCEEPKLDLQSTFFELTALSKGHVGDE 60

Query: 61  NVHHYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTD 120
             H Y+LHID +KE++PEK++ +VANGQHYFLK++KKDL  EYWPRLTKEKVKY YIKTD
Sbjct: 61  ATHQYKLHIDFFKEVVPEKSVGRVANGQHYFLKIFKKDLGLEYWPRLTKEKVKYNYIKTD 120

Query: 121 FDKW 124
           FDKW
Sbjct: 121 FDKW 124

>Scas_254.1*
          Length = 137

 Score =  171 bits (433), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 98/121 (80%)

Query: 4   KVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVH 63
           KVI P+V WAQRSS +DP+RNY+L+T+ + DC++P+L +KP Y+E  A S  HVGDE+ H
Sbjct: 3   KVITPEVLWAQRSSDSDPKRNYLLLTIGVRDCESPKLDLKPGYLEFTANSPGHVGDESAH 62

Query: 64  HYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDK 123
            Y+LHID YK+IIPE ++ K+   +  FLKLYKKDL+SEYWPRLTKEK+KY +IKTDFDK
Sbjct: 63  SYRLHIDFYKDIIPEDSLTKLLMARTTFLKLYKKDLDSEYWPRLTKEKLKYHFIKTDFDK 122

Query: 124 W 124
           W
Sbjct: 123 W 123

>Kwal_26.7677
          Length = 202

 Score =  164 bits (414), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 73/120 (60%), Positives = 94/120 (78%)

Query: 5   VINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVHH 64
            + P+V WAQRSS +D E+NY+L+T+ I DC  P L +  +++E KA+S  H GDE  H 
Sbjct: 4   TLTPEVLWAQRSSDSDAEKNYLLVTIVIPDCSEPTLDLTSTHLEFKAKSPGHTGDEQEHQ 63

Query: 65  YQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDKW 124
           Y+L ID YKEI  EK++ +VANG++YFLKLYKK+LESEYWPRLTKEK+KY YIKTDF+KW
Sbjct: 64  YKLRIDFYKEIDAEKSLSRVANGRNYFLKLYKKELESEYWPRLTKEKLKYHYIKTDFNKW 123

>ABL057W [535] [Homologous to ScYKL117W (SBA1) - SH]
           complement(293539..294243) [705 bp, 234 aa]
          Length = 234

 Score =  161 bits (408), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 94/121 (77%)

Query: 4   KVINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVH 63
           K I P+V WAQRS  TD ++NYVL+T+ I DC+ P+L ++ + +E  A+S  H G+++ H
Sbjct: 3   KTITPEVHWAQRSHETDEDKNYVLLTLVIPDCEEPKLKLESTSLEFSARSPGHTGEKDGH 62

Query: 64  HYQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDK 123
            YQLHID +KEI PEK+ H+VANGQ Y+LKL KK+L  EYWPRLTKEK+KY YIKTDFDK
Sbjct: 63  TYQLHIDFFKEIDPEKSQHRVANGQGYYLKLVKKELGKEYWPRLTKEKLKYHYIKTDFDK 122

Query: 124 W 124
           W
Sbjct: 123 W 123

>KLLA0C14322g complement(1243993..1244547) similar to sp|P28707
           Saccharomyces cerevisiae YKL117w SBA1 Hsp90 (Ninety)
           Associated Co-chaperone singleton, start by similarity
          Length = 184

 Score =  129 bits (323), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 2/120 (1%)

Query: 5   VINPQVAWAQRSSTTDPERNYVLITVSIADCDAPELTIKPSYIELKAQSKPHVGDENVHH 64
           V  P+V WAQRSS +D  +N + IT++I DC  P++ +  + +E  A SK H  D   +H
Sbjct: 3   VHTPEVLWAQRSSESDDTKNNLFITINIPDCTNPKMELTENSLEFSALSKYHSKDGIKYH 62

Query: 65  YQLHIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDKW 124
             LHID YK I  E +  +VANG++YFL L KKDL  EYWPRLTKEK+KY YIKTDFDKW
Sbjct: 63  --LHIDFYKPIDTENSEQRVANGRNYFLVLRKKDLGLEYWPRLTKEKLKYHYIKTDFDKW 120

>YKL059C (MPE1) [3200] chr11 complement(327763..329088) Component of
           the Polyadenylation Factor I complex required for
           cleavage and polyadenylation of mRNA [1326 bp, 441 aa]
          Length = 441

 Score = 30.4 bits (67), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 10/58 (17%)

Query: 69  IDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEY------WPRLTKEKVKY-PYIKT 119
            DL +EII E   +K+ +G  + LK+Y  D E EY       PR T   VK  P IK+
Sbjct: 28  FDLKREIIQE---NKLGDGTDFQLKIYNPDTEEEYDDDAFVIPRSTSVIVKRSPAIKS 82

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,516,871
Number of extensions: 217344
Number of successful extensions: 392
Number of sequences better than 10.0: 12
Number of HSP's gapped: 391
Number of HSP's successfully gapped: 12
Length of query: 213
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 116
Effective length of database: 13,238,163
Effective search space: 1535626908
Effective search space used: 1535626908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)