Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL116C (PRR1)51850927230.0
Scas_721.13258448914250.0
CAGL0K11550g53853713360.0
Scas_336.148648310801e-143
Kwal_26.768251852810051e-131
ABL055C5364899641e-125
KLLA0C14278g5415299551e-123
KLLA0C01650g11121922878e-27
CAGL0K05709g11032592852e-26
AFR696C11422602842e-26
YDR507C (GIN4)11421952744e-25
CAGL0K08514g14892552701e-24
Kwal_26.87518482572663e-24
Scas_493.211171422655e-24
Scas_660.286232302521e-22
YCL024W (KCC4)10371952531e-22
ABL034W14252552532e-22
AEL230W6082302493e-22
CAGL0M08910g6122562484e-22
KLLA0A03806g6022302475e-22
YDR477W (SNF1)6332562475e-22
Kwal_47.182335982302451e-21
CAGL0M02519g7561992451e-21
ACR133C8512062423e-21
Kwal_26.87098292562405e-21
KLLA0F13552g12672552372e-20
CAGL0M02299g8931522362e-20
Scas_700.546982812352e-20
YKL101W (HSL1)15181422362e-20
Kwal_26.778812671422353e-20
CAGL0J03872g6613012333e-20
Scas_640.14*7281992324e-20
Scas_700.348642152335e-20
Scas_616.1014611422327e-20
KLLA0F11143g8132682309e-20
ACR142W8372012281e-19
ACR119W9312532282e-19
KLLA0F11319g8431932263e-19
Scas_700.288961422263e-19
Scas_707.349052802246e-19
CAGL0M11396g11921422246e-19
Scas_564.712101422239e-19
YLR096W (KIN2)11471422211e-18
Scas_693.1710492972211e-18
KLLA0F19536g11041422202e-18
KLLA0F23507g4874222172e-18
Kwal_56.240593532512133e-18
Kwal_26.87967962382183e-18
AGR058W10712642174e-18
KLLA0B07205g4552542144e-18
CAGL0B01925g9441422165e-18
CAGL0G09020g3612532115e-18
Kwal_56.237178581422165e-18
Kwal_23.35904992892128e-18
YKL166C (TPK3)3982532091e-17
Scas_715.3411501402122e-17
CAGL0M08404g4622532082e-17
CAGL0M02233g7672702103e-17
YDR122W (KIN1)10641422103e-17
Kwal_47.183076211722074e-17
YMR001C (CDC5)7051932085e-17
Scas_651.183712532036e-17
YCR008W (SAT4)6032502066e-17
YJL164C (TPK1)3972512037e-17
Scas_627.73491952017e-17
Kwal_26.735514464032078e-17
Kwal_27.1058111543302069e-17
ACR191C11491402061e-16
YCR073C (SSK22)13312722061e-16
KLLA0D03190g3722512001e-16
AFL090W3462511991e-16
Scas_690.133542541991e-16
YBL105C (PKC1)11511402051e-16
ACL006W7081942022e-16
KLLA0B12716g7161422022e-16
Kwal_33.138463752511992e-16
Kwal_23.632515422862033e-16
KLLA0E06413g11611402023e-16
CAGL0J11638g7461932023e-16
KLLA0C17160g8312792013e-16
CAGL0B02739g6762732013e-16
AEL115C3861871973e-16
Scas_644.157261912004e-16
AER264C14832662015e-16
CAGL0K10604g4462691975e-16
YJL095W (BCK1)14782612005e-16
ACL054W9722822005e-16
KLLA0F23155g4271911965e-16
Kwal_56.240913811951956e-16
KLLA0D07348g9092481987e-16
Kwal_47.172528722771989e-16
Scas_689.25*4091411922e-15
KLLA0E01584g4151871922e-15
Scas_711.2515152591952e-15
Scas_628.96212541942e-15
CAGL0M09361g11441401952e-15
YFR014C (CMK1)4461881922e-15
CAGL0L07810g5962511914e-15
KLLA0F07623g12291121925e-15
Kwal_26.76356912521915e-15
ABL028W7221421915e-15
CAGL0K07458g7041371906e-15
KLLA0B02332g3611951876e-15
YMR104C (YPK2)6771421906e-15
CAGL0H06259g13361121916e-15
Kwal_56.224766971931906e-15
CAGL0B04301g5423341897e-15
KLLA0F14190g13382611917e-15
CAGL0K03399g7031371898e-15
Scas_653.256662141898e-15
YGL180W (ATG1)8972781908e-15
CAGL0J03828g4672041879e-15
CAGL0F00913g12061121909e-15
Scas_613.55173111889e-15
Kwal_47.167617442091881e-14
Scas_720.9416832831891e-14
AFL188C4721871861e-14
KLLA0C06138g7081931881e-14
KLLA0E03487g6472931871e-14
KLLA0F24618g5562691871e-14
Scas_721.1246841371871e-14
YKL126W (YPK1)6801421871e-14
CAGL0L03520g14472691881e-14
YAL017W (PSK1)13561121882e-14
Scas_640.165052231862e-14
CAGL0C05005g10762491882e-14
CAGL0J04972g3391091832e-14
ADL389W7112091862e-14
Kwal_0.964271911842e-14
Kwal_26.715412131121872e-14
CAGL0L06006g9422751862e-14
KLLA0C08525g15512861862e-14
Scas_580.610151431853e-14
CAGL0F09075g7462081853e-14
Scas_700.354391981823e-14
KLLA0F01408g2921861783e-14
AFR092W14232611854e-14
Scas_703.57492091835e-14
YGL158W (RCK1)5123331825e-14
Kwal_14.12734152601805e-14
AFL101C3671951797e-14
Kwal_55.203267502731827e-14
Scas_618.84272531807e-14
Scas_675.25271491808e-14
CAGL0D02002g5531861808e-14
CAGL0L07326g5062601808e-14
AEL083W5362701809e-14
Scas_618.156202221809e-14
AER222C4233001781e-13
KLLA0B13112g7302811801e-13
AFR377C7261751801e-13
Scas_717.696741371801e-13
Kwal_0.3074902511781e-13
CAGL0E05720g3581971761e-13
YDR466W (PKH3)8981881791e-13
AFR335C10331501792e-13
KLLA0D07304g4652021772e-13
KLLA0C07535g6242011782e-13
YKL139W (CTK1)5281881782e-13
Scas_502.211161501792e-13
Scas_720.1038042051792e-13
Kwal_55.201898122941782e-13
ADR300C8902151782e-13
Kwal_27.97638681951782e-13
YDL101C (DUN1)5133361762e-13
CAGL0B03509g5973471772e-13
CAGL0C03509g8953341773e-13
CAGL0L11550g10721431783e-13
Scas_593.14d4952821753e-13
Scas_548.613821121773e-13
KLLA0B07579g7221601763e-13
YHR205W (SCH9)8242091763e-13
Kwal_33.136817152531754e-13
KLLA0C18568g7742851754e-13
ACR281C12591121764e-13
Kwal_23.42765211601744e-13
KLLA0B03586g7342081754e-13
CAGL0I07513g10762621765e-13
Kwal_55.215458651771746e-13
Kwal_26.75524612501726e-13
YHR082C (KSP1)10291721746e-13
Kwal_56.226939841501747e-13
ACL104C9472591747e-13
AAR009W4531911727e-13
KLLA0C04213g3942631717e-13
CAGL0F04741g4421851718e-13
Scas_477.57032831738e-13
AAL029W5342781728e-13
Kwal_26.87034441281719e-13
KLLA0C12485g9251511739e-13
YBR028C5252821711e-12
Kwal_0.1555872271711e-12
Scas_629.169182421721e-12
YHR102W (KIC1)10801431721e-12
Kwal_23.64588682671711e-12
ACR117W5241281701e-12
KLLA0E11979g6142501702e-12
CAGL0I09504g5281481692e-12
ADR174C6712111702e-12
AER195C5042501673e-12
Scas_201.1*2741911633e-12
Kwal_33.132221481141563e-12
YLR362W (STE11)7172891674e-12
KLLA0E21780g10161431674e-12
Kwal_27.97734062781655e-12
YAR019C (CDC15)9742481675e-12
KLLA0E17127g8522681665e-12
KLLA0A09713g5572861655e-12
CAGL0M13541g6222781665e-12
YJL106W (IME2)6451051656e-12
YAR018C (KIN3)4353021646e-12
KLLA0C04191g7971951657e-12
Scas_643.2010821121667e-12
YCR091W (KIN82)7202001658e-12
Scas_713.79832481659e-12
AEL179W2891091599e-12
YDL214C (PRR2)6991671641e-11
ADR167W8733341641e-11
ADR313W5782091621e-11
Scas_613.13*3122651582e-11
Scas_668.228931911622e-11
AEL149C7271251612e-11
Kwal_56.227885154361602e-11
Scas_711.157271331612e-11
Scas_692.247182081612e-11
CAGL0K02673g9151421613e-11
CAGL0G04455g7511071603e-11
CAGL0K04301g3551491573e-11
Kwal_55.220013632501574e-11
Scas_716.734161831574e-11
YJL187C (SWE1)8192771594e-11
KLLA0F12188g5461811584e-11
CAGL0C02893g6492081585e-11
YDR490C (PKH1)7661551585e-11
YHL007C (STE20)9392111586e-11
KLLA0F02838g7552531577e-11
KLLA0B13607g9891421577e-11
CAGL0K06479g9912271577e-11
Scas_634.57902501578e-11
Kwal_27.100047351771561e-10
KLLA0C00979g4832541541e-10
CAGL0G04609g9651531561e-10
Scas_660.209571721551e-10
ABL011C7012921551e-10
YKL168C (KKQ8)7341421551e-10
CAGL0K01661g4821491531e-10
Scas_721.1105201931541e-10
YNL183C (NPR1)7902221542e-10
Scas_673.20*7581881542e-10
Scas_584.1110741721542e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL116C
         (509 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...  1053   0.0  
Scas_721.132                                                          553   0.0  
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...   519   0.0  
Scas_336.1                                                            420   e-143
Kwal_26.7682                                                          391   e-131
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...   375   e-125
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...   372   e-123
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   115   8e-27
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   114   2e-26
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   114   2e-26
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   110   4e-25
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   108   1e-24
Kwal_26.8751                                                          107   3e-24
Scas_493.2                                                            106   5e-24
Scas_660.28                                                           101   1e-22
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   102   1e-22
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   102   2e-22
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   100   3e-22
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   100   4e-22
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   100   5e-22
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   100   5e-22
Kwal_47.18233                                                          99   1e-21
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    99   1e-21
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    98   3e-21
Kwal_26.8709                                                           97   5e-21
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    96   2e-20
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    96   2e-20
Scas_700.54                                                            95   2e-20
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    96   2e-20
Kwal_26.7788                                                           95   3e-20
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    94   3e-20
Scas_640.14*                                                           94   4e-20
Scas_700.34                                                            94   5e-20
Scas_616.10                                                            94   7e-20
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    93   9e-20
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    92   1e-19
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    92   2e-19
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    92   3e-19
Scas_700.28                                                            92   3e-19
Scas_707.34                                                            91   6e-19
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    91   6e-19
Scas_564.7                                                             91   9e-19
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    90   1e-18
Scas_693.17                                                            90   1e-18
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    89   2e-18
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    88   2e-18
Kwal_56.24059                                                          87   3e-18
Kwal_26.8796                                                           89   3e-18
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    88   4e-18
KLLA0B07205g complement(624606..625973) some similarities with s...    87   4e-18
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    88   5e-18
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    86   5e-18
Kwal_56.23717                                                          88   5e-18
Kwal_23.3590                                                           86   8e-18
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    85   1e-17
Scas_715.34                                                            86   2e-17
CAGL0M08404g complement(836791..838179) some similarities with s...    85   2e-17
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    86   3e-17
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    86   3e-17
Kwal_47.18307                                                          84   4e-17
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    85   5e-17
Scas_651.18                                                            83   6e-17
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    84   6e-17
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    83   7e-17
Scas_627.7                                                             82   7e-17
Kwal_26.7355                                                           84   8e-17
Kwal_27.10581                                                          84   9e-17
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    84   1e-16
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    84   1e-16
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    82   1e-16
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    81   1e-16
Scas_690.13                                                            81   1e-16
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    84   1e-16
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    82   2e-16
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    82   2e-16
Kwal_33.13846                                                          81   2e-16
Kwal_23.6325                                                           83   3e-16
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    82   3e-16
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    82   3e-16
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    82   3e-16
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    82   3e-16
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    80   3e-16
Scas_644.15                                                            82   4e-16
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    82   5e-16
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    80   5e-16
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    82   5e-16
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    82   5e-16
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    80   5e-16
Kwal_56.24091                                                          80   6e-16
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    81   7e-16
Kwal_47.17252                                                          81   9e-16
Scas_689.25*                                                           79   2e-15
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    79   2e-15
Scas_711.25                                                            80   2e-15
Scas_628.9                                                             79   2e-15
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    80   2e-15
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    79   2e-15
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    78   4e-15
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    79   5e-15
Kwal_26.7635                                                           78   5e-15
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    78   5e-15
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    78   6e-15
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    77   6e-15
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    78   6e-15
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    78   6e-15
Kwal_56.22476                                                          78   6e-15
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    77   7e-15
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    78   7e-15
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    77   8e-15
Scas_653.25                                                            77   8e-15
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    78   8e-15
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    77   9e-15
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    78   9e-15
Scas_613.5                                                             77   9e-15
Kwal_47.16761                                                          77   1e-14
Scas_720.94                                                            77   1e-14
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    76   1e-14
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    77   1e-14
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    77   1e-14
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    77   1e-14
Scas_721.124                                                           77   1e-14
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    77   1e-14
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    77   1e-14
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    77   2e-14
Scas_640.16                                                            76   2e-14
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    77   2e-14
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    75   2e-14
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    76   2e-14
Kwal_0.96                                                              75   2e-14
Kwal_26.7154                                                           77   2e-14
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    76   2e-14
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    76   2e-14
Scas_580.6                                                             76   3e-14
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    76   3e-14
Scas_700.35                                                            75   3e-14
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    73   3e-14
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    76   4e-14
Scas_703.5                                                             75   5e-14
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    75   5e-14
Kwal_14.1273                                                           74   5e-14
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    74   7e-14
Kwal_55.20326                                                          75   7e-14
Scas_618.8                                                             74   7e-14
Scas_675.2                                                             74   8e-14
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    74   8e-14
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    74   8e-14
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    74   9e-14
Scas_618.15                                                            74   9e-14
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    73   1e-13
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    74   1e-13
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    74   1e-13
Scas_717.69                                                            74   1e-13
Kwal_0.307                                                             73   1e-13
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    72   1e-13
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    74   1e-13
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    74   2e-13
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    73   2e-13
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    73   2e-13
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    73   2e-13
Scas_502.2                                                             74   2e-13
Scas_720.103                                                           74   2e-13
Kwal_55.20189                                                          73   2e-13
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    73   2e-13
Kwal_27.9763                                                           73   2e-13
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    72   2e-13
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    73   2e-13
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    73   3e-13
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    73   3e-13
Scas_593.14d                                                           72   3e-13
Scas_548.6                                                             73   3e-13
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    72   3e-13
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    72   3e-13
Kwal_33.13681                                                          72   4e-13
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    72   4e-13
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    72   4e-13
Kwal_23.4276                                                           72   4e-13
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    72   4e-13
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    72   5e-13
Kwal_55.21545                                                          72   6e-13
Kwal_26.7552                                                           71   6e-13
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    72   6e-13
Kwal_56.22693                                                          72   7e-13
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    72   7e-13
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    71   7e-13
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    70   7e-13
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    70   8e-13
Scas_477.5                                                             71   8e-13
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    71   8e-13
Kwal_26.8703                                                           70   9e-13
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    71   9e-13
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    70   1e-12
Kwal_0.155                                                             70   1e-12
Scas_629.16                                                            71   1e-12
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    71   1e-12
Kwal_23.6458                                                           70   1e-12
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    70   1e-12
KLLA0E11979g complement(1060048..1061892) some similarities with...    70   2e-12
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    70   2e-12
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    70   2e-12
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    69   3e-12
Scas_201.1*                                                            67   3e-12
Kwal_33.13222                                                          65   3e-12
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    69   4e-12
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    69   4e-12
Kwal_27.9773                                                           68   5e-12
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    69   5e-12
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    69   5e-12
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    68   5e-12
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    69   5e-12
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    68   6e-12
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    68   6e-12
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    68   7e-12
Scas_643.20                                                            69   7e-12
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    68   8e-12
Scas_713.7                                                             68   9e-12
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    66   9e-12
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    68   1e-11
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    68   1e-11
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    67   1e-11
Scas_613.13*                                                           65   2e-11
Scas_668.22                                                            67   2e-11
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    67   2e-11
Kwal_56.22788                                                          66   2e-11
Scas_711.15                                                            67   2e-11
Scas_692.24                                                            67   2e-11
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    67   3e-11
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    66   3e-11
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    65   3e-11
Kwal_55.22001                                                          65   4e-11
Scas_716.73                                                            65   4e-11
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    66   4e-11
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    65   4e-11
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    65   5e-11
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    65   5e-11
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    65   6e-11
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    65   7e-11
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    65   7e-11
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    65   7e-11
Scas_634.5                                                             65   8e-11
Kwal_27.10004                                                          65   1e-10
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    64   1e-10
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    65   1e-10
Scas_660.20                                                            64   1e-10
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    64   1e-10
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    64   1e-10
CAGL0K01661g complement(146952..148400) some similarities with t...    64   1e-10
Scas_721.110                                                           64   1e-10
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    64   2e-10
Scas_673.20*                                                           64   2e-10
Scas_584.11                                                            64   2e-10
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    62   2e-10
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    64   2e-10
Scas_707.36                                                            64   2e-10
Kwal_26.7861                                                           64   2e-10
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    64   2e-10
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    63   2e-10
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    63   2e-10
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    64   3e-10
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    62   3e-10
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    62   3e-10
Scas_677.18                                                            63   3e-10
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    62   3e-10
Kwal_33.14192                                                          63   4e-10
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    62   4e-10
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    63   4e-10
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    62   4e-10
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    62   6e-10
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    61   6e-10
Kwal_26.8941                                                           62   6e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    62   6e-10
Scas_619.5*                                                            62   6e-10
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    62   8e-10
Kwal_33.13831                                                          62   9e-10
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    62   1e-09
Kwal_23.5290                                                           61   1e-09
Kwal_56.24584                                                          61   1e-09
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    61   1e-09
Scas_718.90                                                            61   1e-09
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    61   1e-09
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    61   1e-09
Scas_610.7                                                             61   2e-09
Scas_673.34*                                                           61   2e-09
Kwal_14.2497                                                           60   2e-09
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    60   2e-09
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    60   2e-09
KLLA0C03938g complement(358851..360632) some similarities with s...    60   2e-09
Scas_655.2                                                             60   2e-09
Scas_651.19                                                            60   2e-09
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    60   2e-09
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    60   2e-09
Scas_598.6                                                             60   2e-09
Kwal_26.7276                                                           60   3e-09
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    60   3e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    59   3e-09
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    59   3e-09
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    59   4e-09
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    59   4e-09
Scas_684.28                                                            59   5e-09
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    59   5e-09
Kwal_47.17263                                                          59   5e-09
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    58   5e-09
Scas_649.30                                                            59   5e-09
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    59   6e-09
Scas_544.6                                                             59   6e-09
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    59   6e-09
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    59   6e-09
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    58   6e-09
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    58   6e-09
KLLA0D09328g complement(788565..791705) some similarities with s...    59   6e-09
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    59   7e-09
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    58   8e-09
Scas_695.33                                                            59   8e-09
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    59   8e-09
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    59   8e-09
Kwal_33.14434                                                          59   8e-09
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    58   1e-08
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    58   1e-08
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    57   1e-08
Scas_573.10                                                            58   1e-08
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    58   1e-08
Scas_568.13                                                            57   1e-08
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    58   1e-08
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    58   1e-08
Kwal_23.5668                                                           58   1e-08
CAGL0M08360g complement(833220..835520) some similarities with s...    58   1e-08
Scas_678.24                                                            58   2e-08
Scas_635.1                                                             57   2e-08
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    57   2e-08
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    57   2e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    57   2e-08
Scas_671.16                                                            57   2e-08
Scas_685.24                                                            56   3e-08
Kwal_23.3471                                                           55   3e-08
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    55   4e-08
Scas_713.38                                                            56   4e-08
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    55   4e-08
Scas_683.12                                                            55   5e-08
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    56   5e-08
KLLA0A06820g complement(615686..618004) some similarities with s...    56   5e-08
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    56   5e-08
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    55   5e-08
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    56   6e-08
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    56   6e-08
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    56   6e-08
Kwal_56.23841                                                          55   9e-08
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    55   9e-08
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    55   1e-07
Kwal_55.21900                                                          55   1e-07
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    55   1e-07
Kwal_27.11542                                                          54   2e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    54   2e-07
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    54   2e-07
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    54   2e-07
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    54   2e-07
Kwal_47.17345                                                          54   2e-07
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    54   2e-07
Kwal_33.13112                                                          53   3e-07
Scas_633.29                                                            53   3e-07
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    54   3e-07
CAGL0K11990g complement(1155395..1158370) some similarities with...    53   4e-07
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    53   4e-07
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    53   4e-07
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    53   5e-07
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    52   5e-07
Scas_582.1                                                             53   5e-07
Scas_667.18                                                            52   5e-07
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    52   6e-07
Scas_707.3                                                             53   6e-07
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    52   6e-07
Scas_705.23                                                            52   6e-07
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    52   8e-07
Scas_601.6                                                             52   9e-07
Scas_713.21                                                            52   9e-07
Kwal_33.14167                                                          52   9e-07
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    51   1e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    51   1e-06
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    51   1e-06
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    51   1e-06
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    51   2e-06
Kwal_14.2554                                                           51   2e-06
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    50   2e-06
Scas_689.24                                                            51   2e-06
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    51   2e-06
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    51   2e-06
Kwal_27.11830                                                          51   2e-06
Scas_648.17                                                            50   2e-06
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    50   2e-06
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    50   2e-06
Kwal_23.3992                                                           50   2e-06
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    51   2e-06
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    50   2e-06
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    50   2e-06
KLLA0B06501g complement(576636..579089) some similarities with s...    50   2e-06
Scas_602.11                                                            50   3e-06
Scas_710.28                                                            50   3e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    50   3e-06
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    50   3e-06
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    50   3e-06
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    50   3e-06
Kwal_23.5576                                                           50   4e-06
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    50   4e-06
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    50   5e-06
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    50   5e-06
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    50   5e-06
Scas_651.3                                                             50   5e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    49   5e-06
Scas_688.14                                                            49   5e-06
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    49   5e-06
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    50   5e-06
Kwal_27.10945                                                          49   6e-06
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    49   6e-06
Kwal_47.17868                                                          49   7e-06
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    49   8e-06
Scas_661.27                                                            49   9e-06
Scas_716.33                                                            49   9e-06
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    48   9e-06
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    49   1e-05
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    48   1e-05
Kwal_26.8347                                                           48   1e-05
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    48   1e-05
Kwal_14.1249                                                           47   1e-05
Kwal_14.1159                                                           48   1e-05
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    48   1e-05
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    47   1e-05
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    48   2e-05
Scas_721.46                                                            47   2e-05
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    48   2e-05
Kwal_27.12559                                                          47   2e-05
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    48   2e-05
Kwal_55.21709                                                          47   2e-05
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    47   2e-05
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    47   2e-05
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    47   2e-05
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    47   2e-05
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    47   3e-05
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    47   3e-05
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    47   3e-05
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    47   3e-05
Kwal_27.11777                                                          47   3e-05
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    46   3e-05
Scas_704.50                                                            47   3e-05
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    47   3e-05
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    46   3e-05
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    47   3e-05
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    47   3e-05
Kwal_47.18098                                                          46   3e-05
Kwal_33.13984                                                          47   4e-05
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    47   4e-05
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    46   4e-05
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    46   4e-05
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    47   5e-05
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    46   5e-05
Scas_721.61                                                            46   5e-05
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    45   6e-05
Scas_568.9*                                                            45   6e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    45   6e-05
KLLA0C16577g complement(1451181..1452695) some similarities with...    46   6e-05
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    46   7e-05
Scas_698.37                                                            45   7e-05
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    45   8e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    45   8e-05
Kwal_27.11919                                                          44   8e-05
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    45   9e-05
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    45   9e-05
Kwal_27.11803                                                          44   1e-04
Scas_623.11                                                            45   1e-04
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    45   1e-04
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    45   1e-04
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    44   1e-04
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    44   1e-04
Scas_703.47                                                            45   1e-04
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    45   1e-04
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    44   2e-04
Kwal_17.2687                                                           44   2e-04
Scas_584.8                                                             45   2e-04
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    44   2e-04
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    44   2e-04
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    44   2e-04
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    44   2e-04
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    44   3e-04
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    43   3e-04
Scas_683.6                                                             44   3e-04
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    43   3e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    43   4e-04
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    44   4e-04
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    43   4e-04
Scas_654.12                                                            43   4e-04
Kwal_33.14554                                                          43   4e-04
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    43   5e-04
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    43   5e-04
Scas_697.12                                                            43   6e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    43   6e-04
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    42   8e-04
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    42   9e-04
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    42   9e-04
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    42   0.001
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    42   0.001
Scas_707.7                                                             41   0.001
Kwal_33.13225                                                          42   0.001
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    42   0.002

>YKL116C (PRR1) [3148] chr11 complement(220990..222546)
           Serine/threonine protein kinase potentially involved in
           pheromone response, has similarity to S. pombe Nim1p
           [1557 bp, 518 aa]
          Length = 518

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/509 (100%), Positives = 509/509 (100%)

Query: 1   MDEYSSIYSQPKTPRLKQEGFPDSIGDQHEKALIDENGEEDKKMASTEGTTGDSRSTPLT 60
           MDEYSSIYSQPKTPRLKQEGFPDSIGDQHEKALIDENGEEDKKMASTEGTTGDSRSTPLT
Sbjct: 1   MDEYSSIYSQPKTPRLKQEGFPDSIGDQHEKALIDENGEEDKKMASTEGTTGDSRSTPLT 60

Query: 61  VSIPTFENVQALPTPMTYTPLSPGNLSMSPIDQSSLNIPKRRSHARLLDDMLSVTQPNQR 120
           VSIPTFENVQALPTPMTYTPLSPGNLSMSPIDQSSLNIPKRRSHARLLDDMLSVTQPNQR
Sbjct: 61  VSIPTFENVQALPTPMTYTPLSPGNLSMSPIDQSSLNIPKRRSHARLLDDMLSVTQPNQR 120

Query: 121 VVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDNYTKEPYFPESSSSTEKCDDDIFQG 180
           VVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDNYTKEPYFPESSSSTEKCDDDIFQG
Sbjct: 121 VVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDNYTKEPYFPESSSSTEKCDDDIFQG 180

Query: 181 FLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQIN 240
           FLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQIN
Sbjct: 181 FLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQIN 240

Query: 241 TSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRAL 300
           TSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRAL
Sbjct: 241 TSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRAL 300

Query: 301 PPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENI 360
           PPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENI
Sbjct: 301 PPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENI 360

Query: 361 LLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVP 420
           LLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVP
Sbjct: 361 LLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVP 420

Query: 421 YDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTN 480
           YDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTN
Sbjct: 421 YDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTN 480

Query: 481 VGKQIVENTLTRKNQRWSINEIYESPFVK 509
           VGKQIVENTLTRKNQRWSINEIYESPFVK
Sbjct: 481 VGKQIVENTLTRKNQRWSINEIYESPFVK 509

>Scas_721.132
          Length = 584

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/489 (59%), Positives = 363/489 (74%), Gaps = 26/489 (5%)

Query: 34  IDENGEEDKKMASTEGTTGDSRSTPLTVSIPTFENVQALPTPMTYTPLSPGNLSMSPI-D 92
           + E GEE++  +  +       +TPL+++IPTF+NVQ LPTPMTYTPLSP  LS+SPI D
Sbjct: 101 VTEAGEENEDDSQQQ----QEETTPLSLTIPTFDNVQTLPTPMTYTPLSPAGLSLSPIKD 156

Query: 93  QSS----LNIPKRRSHA--RL---LDDMLSVTQPNQRVVSELIAPANLSPQRVVSLPTVT 143
           Q      L I K+R+H   R+   LD +L  +Q  QRV+SELI   +   QRVVSLPTV 
Sbjct: 157 QKQPDQPLQIKKKRAHGSPRIGGGLDSVLLESQ--QRVISELIPAPSFQQQRVVSLPTVN 214

Query: 144 EEALVNDSVDSDNYTKEPYFPESSSST-EKCDDDIFQGFLLDHWDRP--LLWKKVRPIGS 200
           EE +   S + D   KE  F  ++  T +   +    G+ L H D+   L WKKV+ IG 
Sbjct: 215 EEPI--PSFEPDIIPKE--FAHTNIDTFDNHAESTLVGYPLQHLDKAHVLRWKKVKKIGE 270

Query: 201 GNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTREL 260
           GNFS VLLYE +DQ++PK+ Q+AVKR+KYP E++++    T  +Y +TLSRLE+SLTREL
Sbjct: 271 GNFSDVLLYESLDQTDPKMMQIAVKRIKYPVEVTDITFRGTP-QYNDTLSRLESSLTREL 329

Query: 261 QVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVM 320
            VLK L++PCIVKL GINNPIFV SK PL DL+ K P ALPPCDMIMSYC  GDLLAA+ 
Sbjct: 330 GVLKLLDYPCIVKLYGINNPIFVQSKTPLRDLLAKNP-ALPPCDMIMSYCSGGDLLAAIS 388

Query: 321 ARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCK 380
              G L+ WLIQR+FTE+V+AV YLH+N+IIHRDLKLENILLKY  + I + +DSP++  
Sbjct: 389 RCLGELDIWLIQRLFTELVMAVNYLHDNNIIHRDLKLENILLKYPLEHIIALKDSPVFTS 448

Query: 381 QNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFE 440
            N IELADFGLCK+I+  E+CTARCGSEDYVSPEILMGVPYDGHL+DTWALGVILYS+ E
Sbjct: 449 LNMIELADFGLCKQIQPGELCTARCGSEDYVSPEILMGVPYDGHLTDTWALGVILYSILE 508

Query: 441 DRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSIN 500
           DRLPFDPPPNA++RQR+RATSHRIARFDW W+RL++ + +  K+IV NTLTRKNQRW I 
Sbjct: 509 DRLPFDPPPNATSRQRNRATSHRIARFDWHWFRLANTELD-AKEIVANTLTRKNQRWDIK 567

Query: 501 EIYESPFVK 509
           +I ES FVK
Sbjct: 568 QIMESIFVK 576

>CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 538

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/537 (50%), Positives = 368/537 (68%), Gaps = 46/537 (8%)

Query: 7   IYSQPKTPRLKQEGF--PD---------SIGDQHEKALIDENGEEDKKMASTEGTTGD-- 53
           +++ PKTPR+ Q GF  P+         S G+      IDE    D  ++    +  D  
Sbjct: 6   LHNDPKTPRIPQTGFDIPEGTMTGFNGTSEGNTSVAGSIDELTSRDTNVSEFGASVPDIT 65

Query: 54  -------------SRSTPLTVSIPTFENVQALPTPMTYTPLSPGNLSMSPIDQSS----L 96
                           TPL+VSIPTFENV  LPTPM Y+P+SP  L+ SP    S    +
Sbjct: 66  MNTEVGADETEDVKVVTPLSVSIPTFENVATLPTPMVYSPMSPAVLNKSPQAIKSTEMKI 125

Query: 97  NIPKRRSHARLLDDMLSVTQPNQRVVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDN 156
           NIPKRR+  +   D L  ++P  R++SE++   + + QRV+SLPTV+EE     + ++D 
Sbjct: 126 NIPKRRAQYKPNLDGLIGSKP-IRIISEVVPTPDTAQQRVISLPTVSEET----TTENDK 180

Query: 157 YTKEPYFPESSS----STEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELM 212
           +   P   + ++    S  + DD +  G+ +  + + L W+KV+ IG GNFS VLLYE +
Sbjct: 181 F---PIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWRKVKTIGVGNFSDVLLYESI 237

Query: 213 DQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIV 272
           DQ++P+L QVAVKR++YP+EL ++   N S  + E L RL+NSLTRE+ VL SLNHPCIV
Sbjct: 238 DQNDPELLQVAVKRIRYPQELKDIR--NRSANFDELLGRLDNSLTREISVLNSLNHPCIV 295

Query: 273 KLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQ 332
           KL G+N+P+F+ S +PL D++ K  + L PC++IMSYC  GDLLAA+   +G L+ WLIQ
Sbjct: 296 KLFGVNDPLFIESCRPLYDML-KLRQKLVPCNLIMSYCVGGDLLAAMSQCSGNLDRWLIQ 354

Query: 333 RIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLC 392
           R+FTE++L VKYLHE++IIHRDLKLENILLK    +I S +D  IY + +F+E+ADFGLC
Sbjct: 355 RLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRSLKDKDIYYEHSFVEIADFGLC 414

Query: 393 KKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNAS 452
           KKIE +E+CTARCGSEDYVSPEILMGVPYDGHLSDTWA+GVILYSL EDRLPFDP P AS
Sbjct: 415 KKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWAMGVILYSLLEDRLPFDPLPGAS 474

Query: 453 ARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFVK 509
            RQ++R T+HRIARF+W+W+++ +  ++  K+IV NTLTRKNQRW+ N+I+ S F++
Sbjct: 475 IRQKNRPTAHRIARFEWKWHKMIEDDSS-AKEIVNNTLTRKNQRWNCNDIFNSAFIQ 530

>Scas_336.1
          Length = 486

 Score =  420 bits (1080), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 235/483 (48%), Positives = 300/483 (62%), Gaps = 41/483 (8%)

Query: 57  TPLTVSIPTF--ENVQALPTPMTYTPLSPGNLSMSPIDQSSLNIPKRR------------ 102
           TP  ++IP+F   +V  LPTPMTY P SP  L  SP+DQ  L IPK+R            
Sbjct: 7   TPPMLTIPSFVDTDVNLLPTPMTYGPHSPVCLR-SPVDQHPLFIPKKRIVPDKKVDNALK 65

Query: 103 ----SHARLLDDMLSVTQPNQRVVSE---------LIAPANLSPQRVVSLPTVTEEALVN 149
               + +  LD   + T    R++SE         ++A A    QRV SLP V E   + 
Sbjct: 66  SDLLATSTTLDVNQAGTNTKTRIISEYVPHSSRNTVVAHAASRAQRVASLPGVDENLEIK 125

Query: 150 DSVDSDNYTKEPYFPESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLY 209
                 N +K         S     D    G+ +DH    +  KK++ IGSGNFS V LY
Sbjct: 126 LESQEANKSK-------GHSVTFDQDLTITGYDIDHPGETVKLKKIKLIGSGNFSDVYLY 178

Query: 210 ELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHP 269
           E + +S     QVAVK ++YP EL N    + S  YK+TLSRLE+SLTREL VLKS++HP
Sbjct: 179 EALGESRSHFAQVAVKHIRYPSELVNAPNPD-SPSYKDTLSRLESSLTRELDVLKSISHP 237

Query: 270 CIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAW 329
           CI+KL  IN+  F  +K+PL          LPPCDM+MSYC  GDL    MA    L  W
Sbjct: 238 CIIKLYAINDLKFFETKRPLSSRKHGDKGFLPPCDMVMSYCSGGDLFD--MASKNNLPQW 295

Query: 330 LIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADF 389
           LIQRIF E+ + +KYLHEN IIHRDLKLEN+LLK   + I + +D P++ +QN IEL DF
Sbjct: 296 LIQRIFAELTMGMKYLHENLIIHRDLKLENVLLKLPLEQILAMKDVPLFKRQNLIELGDF 355

Query: 390 GLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPP 449
           GLCKKI+ +EMCT RCGSEDYVSPEILMG+PYDG LSD WALGVILY+L EDRLPFDP P
Sbjct: 356 GLCKKIQPDEMCTTRCGSEDYVSPEILMGLPYDGRLSDAWALGVILYALLEDRLPFDPLP 415

Query: 450 NASA--RQRSRATSHRIARFDWRWYR-LSDYKTNVGKQIVENTLTRKNQRWSINEIYESP 506
           + ++  R+R R+T+HRIAR++WRW + L+D +    K+IVE+ L RK +RW I +I +S 
Sbjct: 416 SHASHTRKRPRSTAHRIARYEWRWVKLLNDTEQEAAKEIVEHCLVRKIERWDIFKISQST 475

Query: 507 FVK 509
           +VK
Sbjct: 476 YVK 478

>Kwal_26.7682
          Length = 518

 Score =  391 bits (1005), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/528 (43%), Positives = 314/528 (59%), Gaps = 50/528 (9%)

Query: 5   SSIY--SQPKTPRLKQEGFPDSIGDQHEKALIDENGEEDKKMASTEGTTGDSRSTPLTVS 62
           +S+Y  S    P+L+Q  FP ++ +    A+  +      K+++++   G          
Sbjct: 6   ASMYRNSTVHAPKLRQNEFP-ALEESDSIAVSQQFATTPPKLSTSQFVDG---------- 54

Query: 63  IPTFENVQALPTPMTYTPLSPGNLSMSPIDQ------SSLNIPKRRSHARLLD------D 110
                 +  LPTP+ YTP SPG  + SP++       SS  I  ++ +  L        +
Sbjct: 55  -----GMNMLPTPLVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFN 109

Query: 111 MLSVTQPNQRVVSEL-----IAPANLS--PQRVVSLPTVTEEALVNDSVDSDNYTKEPYF 163
              V +  QR++SE      +APA  S   QR+ SL  V ++      V  +  T   + 
Sbjct: 110 RSHVLEDKQRMLSEYAPHSALAPATASTLSQRISSLSGVDQKL----DVVYEPPTSAAHH 165

Query: 164 PESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVA 223
             S    E    +   GF L      L W+KVR IG GNFS V LYE ++Q+   L++VA
Sbjct: 166 VGSQHIIEPEAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVA 225

Query: 224 VKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFV 283
           VK +KYPE L        S R++E LSRLE+SLTRE++ L  + HPCI+ L  IN+  F+
Sbjct: 226 VKHVKYPEALVQSSS-PKSPRFRELLSRLESSLTREIEALSGIWHPCIIHLHAINDLTFL 284

Query: 284 TSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVK 343
            S +PL    +   R LPPCDMIMSYC  GDL    +A    L  WL++RIF E+ L VK
Sbjct: 285 NSPRPLSSRDLT--RGLPPCDMIMSYCAGGDLFE--LASQNTLPEWLLRRIFAELTLGVK 340

Query: 344 YLHENSIIHRDLKLENILLKYSFDDINSFRDS-PIYCKQNFIELADFGLCKKIENNEMCT 402
           YLHEN I+HRDLKLEN+L+K+  DDI +  +   +   Q+ +ELADFGLC++IE +EMCT
Sbjct: 341 YLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCT 400

Query: 403 ARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNAS--ARQRSRAT 460
            RCGSEDYVSPEILMGVPYDG LSD+WA+GVILY+L EDRLPFDP P A+   RQR  +T
Sbjct: 401 TRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSST 460

Query: 461 SHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFV 508
           +HRI+RF+WRW ++++ +    K+IVEN LTRKN R +I +IYE+P+V
Sbjct: 461 AHRISRFEWRWIKMAESEYP-AKEIVENCLTRKNIRCNIEKIYENPYV 507

>ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH]
           (295497..297107) [1611 bp, 536 aa]
          Length = 536

 Score =  375 bits (964), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/489 (45%), Positives = 295/489 (60%), Gaps = 53/489 (10%)

Query: 62  SIPTFENVQALPTPMTYT-PLSPGNLSMSPIDQSSLNIPKRRS------------HARLL 108
           S+ + +N   LPTP   T P+   N+S   ++   L+IPK+R+            H   +
Sbjct: 48  SLRSGDNSNELPTPTNSTFPVDVRNVSFKDLE---LHIPKKRAGNKWYPASELPPHKSRM 104

Query: 109 D----------DMLSVTQPNQRVVSELI--------APANLSPQRVVSLPTVTEEALVND 150
           +          +M +      RV S+          A  N +  RVVSLP +  E     
Sbjct: 105 ERDFSNLPSTMEMDARGSRGNRVTSDYFSEGTASFPADVNGNRARVVSLPGIESEGDQQG 164

Query: 151 SVDSDNYTKEPYF-------PESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNF 203
           S    +   EP          +++++     +D   GF+L + +  L W+ V+ +GSGNF
Sbjct: 165 SACVTHNNGEPTVLQDATGGSDAAATRNGMAEDKLTGFILPNLNSQLSWRLVKLVGSGNF 224

Query: 204 STVLLYELMDQSNP--KLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQ 261
           S V LYE    S+   K +QVAVK  +YP EL N  Q  T+ +YKE LSRLE+SLTREL 
Sbjct: 225 SDVYLYENTSASSTEEKFQQVAVKVTRYPAELQN-PQARTATKYKEMLSRLESSLTRELA 283

Query: 262 VLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMA 321
           VL+SL++PCIVKL GIN+  F+ S++PL D I +   +LP C MIMSYC  GD+L   +A
Sbjct: 284 VLRSLDYPCIVKLYGINDCSFLESRRPLIDHINEP--SLPSCKMIMSYCFGGDVLD--VA 339

Query: 322 RNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQ 381
           + G L  WL+QR+FTE+  AV YLHEN +IHRDLKLEN+LLKY  + + S R+    C  
Sbjct: 340 KRGLLPDWLLQRVFTELAHAVLYLHENLVIHRDLKLENVLLKYPLEQLLSMRED-FSC-- 396

Query: 382 NFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFED 441
           NFIELADFGLCK+I  NE+CT RCGSEDY+SPE+LMG+PYDG L DTWALGVILY+L ED
Sbjct: 397 NFIELADFGLCKRIRQNELCTTRCGSEDYISPEVLMGLPYDGRLCDTWALGVILYALLED 456

Query: 442 RLPFDPPPNASAR-QRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSIN 500
           RLPFDP P    R  R R+T+HRIAR++WRW RL +   +  K IVE  L  +  RWSI 
Sbjct: 457 RLPFDPLPLQGWRGNRPRSTAHRIARYEWRWLRLIN-NNHHAKVIVEKCLVTRQHRWSIK 515

Query: 501 EIYESPFVK 509
           +I E+ FV+
Sbjct: 516 DITEADFVR 524

>KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 541

 Score =  372 bits (955), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/529 (41%), Positives = 311/529 (58%), Gaps = 75/529 (14%)

Query: 40  EDKKMASTEGTTGDSRSTPLTVSIPTFE--------NVQALPTPMTYTPLSPGNLSMSPI 91
           E  K+A  E   GD+ S+ +   +P           +V  LPTP      SP  ++ SP 
Sbjct: 16  ETPKLAQREFAGGDAESS-VKNQLPEINSSLNREAIDVGMLPTPTANVFTSPVRVNKSPG 74

Query: 92  D-QSSLNIPKRR-------------------SHARLLDDMLS---------VTQP-NQRV 121
              + L + KRR                   +H  +LD+ LS         VT     R+
Sbjct: 75  GFDAGLQVEKRRNKDSASNSGVPSPTISSVDTHEEVLDEELSKLGTYMNRDVTHKIKGRM 134

Query: 122 VSELI-------APANLSPQRVVSL-------PTVTEEALVNDSVDSDNYTKEPYFPESS 167
           +SE I           ++ QR +SL       P++ +E ++N+ + S         P   
Sbjct: 135 LSEYIPNNSMGDGSGGVAVQRSISLNNRVVEKPSLKKETIINEVITS--------VPSDK 186

Query: 168 SSTEKCDDDIFQGFLLDHWDR-PLLWKKVRPIGSGNFSTVLLYELMDQS-----NPKLKQ 221
            + +K D  I +G++ +  +     W K++ IGSGNFSTV LYE +D +     NP+LK 
Sbjct: 187 ENEQKADGTIIRGYMANTPNHISFQWSKIKEIGSGNFSTVYLYECIDDNLNINLNPELKY 246

Query: 222 VAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPI 281
           VAVK +KYP EL  +    +S +YKE LSR+ +SL REL  L S++HPCIVKL  IN+  
Sbjct: 247 VAVKSIKYPRELL-MSSSPSSPKYKELLSRVVSSLKRELTTLISVHHPCIVKLFAINDTT 305

Query: 282 FVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLA 341
           F+T + PL     +   ALP CDMIMSYC  GDL    +A   ++  WL+ RI TE+ +A
Sbjct: 306 FITDEHPLYGR--RKLSALPRCDMIMSYCTGGDLFD--LASKTKIPNWLLTRIITELSVA 361

Query: 342 VKYLHENSIIHRDLKLENILLKYSFDDINSFR-DSPIYCKQNFIELADFGLCKKIENNEM 400
           +KYLH+N IIHRD+KLEN+LLKY+ DD+   + D   +  +NF+ELADFGLCKKI  +EM
Sbjct: 362 IKYLHDNFIIHRDIKLENVLLKYTLDDMMLLKEDESQFFSKNFVELADFGLCKKITPDEM 421

Query: 401 CTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRAT 460
           CT RCGSEDYVSPEIL+G+PYDG +SD WA GVI Y+L EDRLPFDP P  S+R R+R+ 
Sbjct: 422 CTTRCGSEDYVSPEILLGLPYDGRISDAWAFGVITYALLEDRLPFDPLPGQSSR-RTRSI 480

Query: 461 SHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFVK 509
           +HRIAR DW+W + +D   +  K+IV+NTL RK++RW+++++  +P+++
Sbjct: 481 AHRIARCDWKWLKNAD-TDHPAKEIVQNTLVRKSERWNMDQLCNTPYIR 528

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  115 bits (287), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 99/192 (51%), Gaps = 36/192 (18%)

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
            + RE+ ++K LNHP +++L  +    + TSK    DL            M++ Y   G+
Sbjct: 72  GIEREIIIMKLLNHPNVLRLYDV----WETSK----DLY-----------MVLEYVEKGE 112

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L   ++ R G L      R F ++++ + Y H   I+HRDLK EN+LL + F+       
Sbjct: 113 LFNLLVER-GPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN------- 164

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                    ++LADFG+      +++    CGS  Y +PEI+ G+PY G  SD W+ GVI
Sbjct: 165 ---------VKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVI 215

Query: 435 LYSLFEDRLPFD 446
           LY+L   RLPFD
Sbjct: 216 LYALLTGRLPFD 227

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 123/259 (47%), Gaps = 52/259 (20%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQ-VAVKRLKYPEELSNVEQINTSLRYKETLS 250
           WK    +GSG+   VLL      SN   KQ  AVK +      +  E +N S    +  +
Sbjct: 20  WKLGETLGSGSTGKVLLA-----SNETTKQQAAVKVISK----AVFEAMNNSESNGDATN 70

Query: 251 RLENSLTRELQVLKSLNHPCIVKLLGI---NNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
            L  ++ +E+ ++K LNHP +++L  +   N+ ++                      +++
Sbjct: 71  ALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLY----------------------LVL 108

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            Y   G+L   ++ R G L      R F ++++ + Y H   ++HRDLK EN+LL    +
Sbjct: 109 EYAEKGELFNMLVER-GPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLN 167

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSD 427
                           I++ADFG+      +++    CGS  Y +PEI+ G+PY+G  SD
Sbjct: 168 ----------------IKIADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSD 211

Query: 428 TWALGVILYSLFEDRLPFD 446
            W+ GVIL++L   RLPFD
Sbjct: 212 VWSCGVILFALLTGRLPFD 230

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  114 bits (284), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 126/260 (48%), Gaps = 44/260 (16%)

Query: 187 DRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYK 246
           DR   WK    +G+G+   VLL +     N +  Q+A  ++   + + N +   ++    
Sbjct: 14  DRIGPWKLGETLGAGSTGKVLLAQ-----NTETGQIAAVKV-ISKSVFNAQ--GSTFVGS 65

Query: 247 ETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMI 306
                L   + RE+ ++K LNHP +++L  +    + T++    DL            M+
Sbjct: 66  NDPDVLPYGIEREIIIMKLLNHPNVLRLYDV----WETAQ----DLY-----------MV 106

Query: 307 MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
           + Y   G+L   ++ R G L      R F ++++ + Y H   I+HRDLK EN+LL + F
Sbjct: 107 LEYVEKGELFNLLVQR-GPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKF 165

Query: 367 DDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLS 426
           +                I+LADFG+      +++    CGS  Y +PEI+ G+PY G  S
Sbjct: 166 N----------------IKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFES 209

Query: 427 DTWALGVILYSLFEDRLPFD 446
           D W+ GVILY+L   RLPFD
Sbjct: 210 DVWSCGVILYALLTGRLPFD 229

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  110 bits (274), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 42/195 (21%)

Query: 255 SLTRELQVLKSLNHPCIVKLLGI---NNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            + RE+ ++K LNHP +++L  +   N  ++                      +++ Y  
Sbjct: 77  GIEREIIIMKLLNHPNVLRLYDVWETNTDLY----------------------LVLEYAE 114

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   ++ R G L      R F ++++ V Y H   I+HRDLK EN+LL + ++    
Sbjct: 115 KGELFNLLVER-GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN---- 169

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                       I++ADFG+       ++    CGS  Y +PEI+ G+PY G  SD W+ 
Sbjct: 170 ------------IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSC 217

Query: 432 GVILYSLFEDRLPFD 446
           GVIL++L   RLPFD
Sbjct: 218 GVILFALLTGRLPFD 232

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  108 bits (270), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 117/255 (45%), Gaps = 46/255 (18%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           + RE+ ++K ++HP ++ LL +       +K  L               +++ Y   G+L
Sbjct: 173 IEREIVIMKLISHPNVMGLLEV-----WENKSELY--------------LVLEYVDGGEL 213

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++++ G+L        FT+++  V Y H  +I HRDLK EN+LL             
Sbjct: 214 FDYLVSK-GKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDK----------- 261

Query: 376 PIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVIL 435
               K   I++ADFG+      N++    CGS  Y SPEI+MG PY G  SD W+ G+IL
Sbjct: 262 ----KNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIIL 317

Query: 436 YSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTL-TRKN 494
           ++L    LPF+                 + +     ++L  Y TN  K ++   L T   
Sbjct: 318 FALLTGHLPFN----------DDNIKKLLLKVQAGRFQLPPYLTNDAKDLITRILVTNPE 367

Query: 495 QRWSINEIYESPFVK 509
           +R +INEI   P +K
Sbjct: 368 KRLTINEILNHPLIK 382

>Kwal_26.8751
          Length = 848

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 125/257 (48%), Gaps = 33/257 (12%)

Query: 256 LTRELQVLK--SLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAG 313
           LT +  VLK  S N P +V+ +  +     +    L ++I+          M + YCP  
Sbjct: 58  LTHQKVVLKMGSKNDPNVVREVFYHRQFDYSHITKLYEVIVTENYVW----MALEYCPGK 113

Query: 314 DLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFR 373
           +L   ++A+   +       +F+++V AV Y H    +HRDLKLENILL           
Sbjct: 114 ELYEYLLAKK-HIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLD---------- 162

Query: 374 DSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGV 433
                 K+   +L DFG  ++     +    CG+  Y++PE++   PY+G+  DTW+LG+
Sbjct: 163 ------KKGHAKLTDFGFTRECATKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGI 216

Query: 434 ILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRK 493
           ILY++    +PFD             T ++I  ++  +   +DY  + GK+++   L + 
Sbjct: 217 ILYTMIHGTMPFDEVDEV-------KTKYKIVHYNPTY--DNDYIDSNGKELISQLLEKD 267

Query: 494 -NQRWSINEIYESPFVK 509
            NQR S+ ++ + PF++
Sbjct: 268 PNQRPSLTQVLQHPFLQ 284

>Scas_493.2
          Length = 1117

 Score =  106 bits (265), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 76/142 (53%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           MI+ Y   G+L   ++   G L      R F ++++ + Y H   I+HRDLK EN+LL +
Sbjct: 111 MILEYAEKGELFN-LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDH 169

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
            F+                I++ADFG+      +++    CGS  Y +PEI+ G+PY G 
Sbjct: 170 KFN----------------IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGF 213

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
            SD W+ GVIL++L   RLPFD
Sbjct: 214 ESDVWSCGVILFALLTGRLPFD 235

>Scas_660.28
          Length = 623

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 113/230 (49%), Gaps = 39/230 (16%)

Query: 219 LKQVAVKRLKYPEELSNVEQINTSLRYKETLSR--LENSLTRELQVLKSLNHPCIVKLLG 276
           L + +  ++K    ++  +++   +  K+ L++  ++  + RE+  L+ L HP I+KL  
Sbjct: 52  LGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD 111

Query: 277 INNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFT 336
           +     + SK    D II          M+M Y  AG+ L   + +  ++     +R F 
Sbjct: 112 V-----IKSK----DEII----------MVMEY--AGNELFDYIVQRDKMSEDEARRFFQ 150

Query: 337 EVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIE 396
           +++ AV+Y H + I+HRDLK EN+LL    +                +++ADFGL   + 
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLN----------------VKIADFGLSNIMT 194

Query: 397 NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD 446
           +       CGS +Y +PE++ G  Y G   D W+ GVILY +   RLPFD
Sbjct: 195 DGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD 244

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 98/195 (50%), Gaps = 42/195 (21%)

Query: 255 SLTRELQVLKSLNHPCIVKLLGI---NNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           ++ RE+ ++K L+HP ++ L  +   NN ++                      +I+ Y  
Sbjct: 73  NIEREIVIMKLLSHPNVLSLYDVWETNNNLY----------------------LILEYAE 110

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   ++  +G L        F ++++ + Y H   I+HRDLK EN+LL       +S
Sbjct: 111 KGELFN-LLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL-------DS 162

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
           F +         I++ADFG+     + ++    CGS  Y +PEI+ G+PY+G  SD W+ 
Sbjct: 163 FYN---------IKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSC 213

Query: 432 GVILYSLFEDRLPFD 446
           GVIL++L   RLPFD
Sbjct: 214 GVILFALLTGRLPFD 228

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  102 bits (253), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 113/255 (44%), Gaps = 49/255 (19%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           WK  + +G G+   V L + M       K  A+K +       N +Q+ T+L Y      
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMQSG----KLAAIKIVPKRNVRHNQKQV-TALPY------ 109

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
               + RE+ ++K + HP I+ L  +       +K  L               +++ Y  
Sbjct: 110 ---GIEREIIIMKLITHPNIMALYEV-----WENKSELY--------------LVLEYVE 147

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   ++AR G+L        F ++V  V Y H  +I HRDLK EN+LL         
Sbjct: 148 GGELFDYLIAR-GKLPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDK------- 199

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                   K   +++ADFG+      N +    CGS  Y SPEI+MG  Y G  SD W+ 
Sbjct: 200 --------KNKTVKIADFGMAALETTNRLLETSCGSPHYASPEIVMGQKYHGSPSDVWSC 251

Query: 432 GVILYSLFEDRLPFD 446
           G+IL++L    LPF+
Sbjct: 252 GIILFALLTGHLPFN 266

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  100 bits (249), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 113/230 (49%), Gaps = 39/230 (16%)

Query: 219 LKQVAVKRLKYPEELSNVEQINTSLRYKETLSR--LENSLTRELQVLKSLNHPCIVKLLG 276
           L + +  ++K    +S  +++   +  K+ L++  ++  + RE+  L+ L HP I+KL  
Sbjct: 45  LGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD 104

Query: 277 INNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFT 336
           +     + SK    D II          M++ Y  AG+ L   + +  ++     +R F 
Sbjct: 105 V-----IKSK----DEII----------MVIEY--AGNELFDYIVQRDKMSENEARRFFQ 143

Query: 337 EVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIE 396
           +++ AV+Y H + I+HRDLK EN+LL    +                +++ADFGL   + 
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLN----------------VKIADFGLSNIMT 187

Query: 397 NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD 446
           +       CGS +Y +PE++ G  Y G   D W+ GVILY +   RLPFD
Sbjct: 188 DGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFD 237

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  100 bits (248), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 115/256 (44%), Gaps = 58/256 (22%)

Query: 192 WKKVRPIGSGNFSTV-LLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLS 250
           ++ V+ +G G+F  V L Y +       LK +  K L                      S
Sbjct: 39  YQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL--------------------AKS 78

Query: 251 RLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYC 310
            ++  + RE+  L+ L HP I+KL  +     + SK    D II          M++ Y 
Sbjct: 79  DMQGRIEREISYLRLLRHPHIIKLYDV-----IKSK----DEII----------MVIEY- 118

Query: 311 PAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
            AG+ L   + +  ++     +R F +++ AV+Y H + I+HRDLK EN+LL    +   
Sbjct: 119 -AGNELFDYIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLN--- 174

Query: 371 SFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWA 430
                        +++ADFGL   + +       CGS +Y +PE++ G  Y G   D W+
Sbjct: 175 -------------VKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWS 221

Query: 431 LGVILYSLFEDRLPFD 446
            GVILY +   RLPFD
Sbjct: 222 CGVILYVMLCRRLPFD 237

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 112/230 (48%), Gaps = 39/230 (16%)

Query: 219 LKQVAVKRLKYPEELSNVEQINTSLRYKETLSR--LENSLTRELQVLKSLNHPCIVKLLG 276
           L + +  ++K    +S  +++   +  K+ L++  ++  + RE+  L+ L HP I+KL  
Sbjct: 41  LGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD 100

Query: 277 INNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFT 336
           +     + SK    D II          M++ Y  AG+ L   + +  ++     +R F 
Sbjct: 101 V-----IKSK----DEII----------MVIEY--AGNELFDYIVQRDKMPEQEARRFFQ 139

Query: 337 EVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIE 396
           +++ AV Y H + I+HRDLK EN+LL    +                +++ADFGL   + 
Sbjct: 140 QIISAVDYCHRHKIVHRDLKPENLLLDEHLN----------------VKIADFGLSNIMT 183

Query: 397 NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD 446
           +       CGS +Y +PE++ G  Y G   D W+ GVILY +   RLPFD
Sbjct: 184 DGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFD 233

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 99.8 bits (247), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 114/256 (44%), Gaps = 58/256 (22%)

Query: 192 WKKVRPIGSGNFSTV-LLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLS 250
           ++ V+ +G G+F  V L Y         LK +  K L                      S
Sbjct: 55  YQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVL--------------------AKS 94

Query: 251 RLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYC 310
            ++  + RE+  L+ L HP I+KL  +     + SK    D II          M++ Y 
Sbjct: 95  DMQGRIEREISYLRLLRHPHIIKLYDV-----IKSK----DEII----------MVIEY- 134

Query: 311 PAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
            AG+ L   + +  ++     +R F +++ AV+Y H + I+HRDLK EN+LL    +   
Sbjct: 135 -AGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLN--- 190

Query: 371 SFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWA 430
                        +++ADFGL   + +       CGS +Y +PE++ G  Y G   D W+
Sbjct: 191 -------------VKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWS 237

Query: 431 LGVILYSLFEDRLPFD 446
            GVILY +   RLPFD
Sbjct: 238 CGVILYVMLCRRLPFD 253

>Kwal_47.18233
          Length = 598

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 111/230 (48%), Gaps = 39/230 (16%)

Query: 219 LKQVAVKRLKYPEELSNVEQINTSLRYKETLSR--LENSLTRELQVLKSLNHPCIVKLLG 276
           L + +  ++K    ++  +++   +  K+ L++  ++  + RE+  L+ L HP I+KL  
Sbjct: 37  LGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD 96

Query: 277 INNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFT 336
           +     V SK  +               M++ Y  AG+ L   + +  ++     +R F 
Sbjct: 97  V-----VKSKDEIV--------------MVIEY--AGNELFDYIVQRDKMSENEARRFFQ 135

Query: 337 EVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIE 396
           +++ AV+Y H + I+HRDLK EN+LL    +                +++ADFGL   + 
Sbjct: 136 QIISAVEYCHRHKIVHRDLKPENLLLDEHLN----------------VKIADFGLSNIMT 179

Query: 397 NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD 446
           +       CGS +Y +PE++ G  Y G   D W+ GVILY +   RLPFD
Sbjct: 180 DGNFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFD 229

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 99/199 (49%), Gaps = 38/199 (19%)

Query: 253 ENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPA 312
           E  + RE+  LK L+HP IVKL                + +++  + +    +++ Y   
Sbjct: 111 ETKIYREINALKHLSHPNIVKL----------------EEVLQNSKYI---GIVLEYAAG 151

Query: 313 GDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSF 372
           G+    +  R  RL+     R+F++++ AV Y+H   ++HRDLKLEN+LL          
Sbjct: 152 GEFYKFIQ-RKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLD--------- 201

Query: 373 RDSPIYCKQNFIELADFGLCKK-IENNEMCTARCGSEDYVSPEILMG-VPYDGHLSDTWA 430
                  ++N I + DFG   + +  N M    CGS  Y +PE+++   PYD   +DTW+
Sbjct: 202 ------NEENLI-ITDFGFVNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWS 254

Query: 431 LGVILYSLFEDRLPFDPPP 449
            G+IL+++    LP+D  P
Sbjct: 255 CGIILFAMLAGYLPWDDDP 273

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 99/206 (48%), Gaps = 27/206 (13%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M + YCP  +L   ++ +  R+     +R+F ++V AV Y H    +HRDLKLENILL  
Sbjct: 105 MALEYCPGNELYDYLLLKQ-RIPLDETRRLFAQIVSAVFYAHSLQCVHRDLKLENILLD- 162

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          K  +  L DFG  ++          CG+  Y++PE++    YDG+
Sbjct: 163 ---------------KNGYAMLTDFGFTRECATKTQLETVCGTTVYMAPELIKREAYDGY 207

Query: 425 LSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTNVGKQ 484
             DTW+LG+ILY++    +PFD   + + R   +      A  D       +Y +   K 
Sbjct: 208 KVDTWSLGIILYTMLHGYMPFD--EDDTVRTGLKIMHEEPAVLD-------EYTSPQAKD 258

Query: 485 IVENTLTRK-NQRWSINEIYESPFVK 509
           ++   L +   QR ++NE+ + PF++
Sbjct: 259 LIVRLLDKNAAQRPNLNEVLQHPFLQ 284

>Kwal_26.8709
          Length = 829

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 118/256 (46%), Gaps = 54/256 (21%)

Query: 198 IGSGNFSTVLL--YELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENS 255
           +G G F  V L   +  + S    KQVA+K ++      N E+              E  
Sbjct: 46  LGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEK--------------EIK 91

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           + RE+  LK LNHP IV+L                + +++  + +    +++ Y   G+ 
Sbjct: 92  IYREINALKHLNHPNIVRL----------------EEVLQNSKYI---GIVLEYASGGEF 132

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              +  +  RL+     R+F +++  V Y+H   ++HRDLKLEN+LL     D N     
Sbjct: 133 YKYIQKKR-RLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLL-----DKN----- 181

Query: 376 PIYCKQNFIELADFGLCKK-IENNEMCTARCGSEDYVSPEILMGV-PYDGHLSDTWALGV 433
                +N + + DFG   + +  NE+    CGS  Y +PE+++   PY+   +D W+ GV
Sbjct: 182 -----ENLL-ITDFGFVNEFLPENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGV 235

Query: 434 ILYSLFEDRLPFDPPP 449
           ILY++    LP+D  P
Sbjct: 236 ILYAMLAGYLPWDDDP 251

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 117/255 (45%), Gaps = 51/255 (20%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           WK  + +G G+   V L + M+    KL  + +     P++     QI           +
Sbjct: 73  WKLGKTLGKGSSGRVRLAKNMETG--KLSAIKI----VPKKFVKSNQI----------KQ 116

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           L   + RE+ ++K ++HP ++ L  +       +K  L               +++ Y  
Sbjct: 117 LPYGIEREIIIMKLISHPNVMGLYEV-----WENKSELY--------------LVLEYVE 157

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   ++++ G+L        F ++V AV Y H  +I HRDLK EN+LL         
Sbjct: 158 GGELFDYLVSK-GKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDK------- 209

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                   K+  I++ADFG+     ++++    CGS  Y SPEI++G  Y G  SD W+ 
Sbjct: 210 --------KKRSIKIADFGMAALETSDKLLETSCGSPHYASPEIVLGRKYHGSPSDVWSC 261

Query: 432 GVILYSLFEDRLPFD 446
           G+IL++L    LPF+
Sbjct: 262 GIILFALLTGHLPFN 276

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 77/152 (50%), Gaps = 17/152 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M + YCP  +L   +++++ RL       +F ++  AV Y H  + +HRDLKLEN+LL  
Sbjct: 110 MALEYCPGKELYDHLLSKS-RLPTLECAELFAQITGAVHYAHTLNCVHRDLKLENVLLD- 167

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          K    +L DFG  ++     +    CG+  Y++PE++   PYDG 
Sbjct: 168 ---------------KNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGF 212

Query: 425 LSDTWALGVILYSLFEDRLPFDPPPNASARQR 456
             D W+LGVILY+L    LPFD   +   +Q+
Sbjct: 213 KVDIWSLGVILYTLLCGCLPFDEDDDLLTKQK 244

>Scas_700.54
          Length = 698

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 124/281 (44%), Gaps = 63/281 (22%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G G F+TV   + +++S  K    AVK +   + + N+E                  ++
Sbjct: 229 VGQGAFATV--KKAVERSTGKT--FAVKIISKRKVMGNME-----------------GVS 267

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           REL+VL+ L+HP IV+L G     F   K                  M+M +   GDL+ 
Sbjct: 268 RELEVLQQLDHPRIVRLKG-----FYEDKDSYY--------------MVMEFVSGGDLMD 308

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            V A +G +     + I  +++ AVKY+H   I HRDLK +NIL++         +D P+
Sbjct: 309 FVAA-HGAVGEEAGKEISRQILEAVKYIHSKGISHRDLKPDNILIE---------QDDPV 358

Query: 378 YCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH-------LSDTWA 430
                 +++ DFGL K   N       CG+  YV+PE++ G             L D W+
Sbjct: 359 -----LVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEYSSLVDMWS 413

Query: 431 LGVILYSLFEDRLPFDPPPNASA-RQRSRATSHRIARFDWR 470
           +G ++Y +    LPF         +Q SR + H     D+R
Sbjct: 414 MGCLVYVILTGHLPFSGSTQEQLYKQISRGSYHEGPLKDFR 454

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 74/142 (52%), Gaps = 16/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++ Y   G+L   ++++ G+L        F ++V  V Y H  +I HRDLK EN+LL  
Sbjct: 191 LVLEYVDGGELFDYLVSK-GKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDK 249

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          K   I++ADFG+      N++    CGS  Y SPEI+MG PY G 
Sbjct: 250 ---------------KNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGG 294

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
            SD W+ G++L++L    LPF+
Sbjct: 295 PSDVWSCGIVLFALLTGHLPFN 316

>Kwal_26.7788
          Length = 1267

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 74/142 (52%), Gaps = 16/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++ Y   G+L   +++R GRL        F +++    Y H  +I HRDLK EN+LL  
Sbjct: 134 LVLEYVDGGELFDYLVSR-GRLPEKEAIHYFRQIIEGTAYCHGFNICHRDLKPENLLLDK 192

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          K   I++ADFG+     +N++    CGS  Y SPEI+MG  Y+G 
Sbjct: 193 ---------------KNKRIKIADFGMAALQTSNKLLETSCGSPHYASPEIVMGKNYNGG 237

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
            SD W+ G+IL++L    LPF+
Sbjct: 238 PSDVWSCGIILFALLTGHLPFN 259

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 130/301 (43%), Gaps = 71/301 (23%)

Query: 156 NYTKEPY--FPESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLL-YELM 212
           +YT+ PY   P +S S+       F  +++              +G G F  V L +   
Sbjct: 17  HYTRNPYSAAPRNSMSSRGKKHVTFGPYIVG-----------STLGEGEFGKVKLGWTRT 65

Query: 213 DQSNPKL-----KQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLN 267
             + P+      KQVA+K ++    + N E+              E  + RE+  LK L 
Sbjct: 66  PSTGPEQRPAVSKQVAIKLIRRDTIVKNSEK--------------EIKIYREINALKHLT 111

Query: 268 HPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLE 327
           HP +V+L                + +++  + +    +++ Y   G+    +  R  RL+
Sbjct: 112 HPNVVRL----------------EEVLQNSKYI---GIVLEYASGGEFYKYIQ-RKRRLK 151

Query: 328 AWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELA 387
                R+F +++  V Y+H  +++HRDLKLEN+LL                 K   + + 
Sbjct: 152 ESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLD----------------KNENLVIT 195

Query: 388 DFGLCKK-IENNEMCTARCGSEDYVSPEILMGV-PYDGHLSDTWALGVILYSLFEDRLPF 445
           DFG   + + +NE     CGS  Y +PE+++   PY    +D W+ G+ILY++    LP+
Sbjct: 196 DFGFVNEFLPDNEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

Query: 446 D 446
           D
Sbjct: 256 D 256

>Scas_640.14*
          Length = 728

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 92/199 (46%), Gaps = 38/199 (19%)

Query: 250 SRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSY 309
           S  E  + RE+  LK L HP IV+L                + +++  + +    +++ Y
Sbjct: 87  SEKEMKIFREINSLKHLTHPNIVRL----------------EEVLQNSKYI---GIVLEY 127

Query: 310 CPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDI 369
              G+    V  R  RL+     R+F +++  V Y+H   I+HRDLKLEN+LL       
Sbjct: 128 ASGGEFYKYVQ-RKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLD------ 180

Query: 370 NSFRDSPIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGV-PYDGHLSD 427
                     K   + + DFG   +   +NE+    CGS  Y +PE+++   PY    +D
Sbjct: 181 ----------KHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTEPYKARKAD 230

Query: 428 TWALGVILYSLFEDRLPFD 446
            W+ G+ILY +    LP+D
Sbjct: 231 IWSCGIILYGMLAGYLPWD 249

>Scas_700.34
          Length = 864

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 102/215 (47%), Gaps = 41/215 (19%)

Query: 237 EQINTSLRYKETLSR---LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLI 293
           +Q+   L  ++T+S+    E  + RE+  LK L HP IVKL                + +
Sbjct: 82  KQVAIKLIRRDTISKDSSKEIKIYREINALKHLTHPNIVKL----------------EEV 125

Query: 294 IKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHR 353
           ++  + +    +++ Y   G+    +  R  RL+     R+F +++  V Y+H   ++HR
Sbjct: 126 LQNSKYI---GIVLEYASGGEFYKYIQ-RKKRLKEGPACRLFAQLINGVHYIHSKGLVHR 181

Query: 354 DLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVS 412
           DLKLEN+LL                 K   + + DFG   +   + E+    CGS  Y +
Sbjct: 182 DLKLENLLLD----------------KHENLIITDFGFVSEFYSHGELMKTSCGSPCYAA 225

Query: 413 PEILMGV-PYDGHLSDTWALGVILYSLFEDRLPFD 446
           PE+++   PY+   +D W+ GVILY++    LP+D
Sbjct: 226 PELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWD 260

>Scas_616.10
          Length = 1461

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 73/142 (51%), Gaps = 16/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++ Y   G+L   ++++ G+L        F +++  V Y H  +I HRDLK EN+LL  
Sbjct: 213 LVLEYVDGGELFDYLVSK-GKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDK 271

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          K   I++ADFG+      N++    CGS  Y SPEI+MG  Y G 
Sbjct: 272 ---------------KNKSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGG 316

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
            SD W+ G+IL++L    LPF+
Sbjct: 317 PSDVWSCGIILFALLTGHLPFN 338

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 93.2 bits (230), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 117/268 (43%), Gaps = 49/268 (18%)

Query: 215 SNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKL 274
           S+  + Q A   +K   E S  +     + +K  +    + + REL VL+ LNHP IVKL
Sbjct: 194 SDSIVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKRELDVLQKLNHPRIVKL 253

Query: 275 LGI---NNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLI 331
                 N+  +                      M+M +   GDL+  V A +G +     
Sbjct: 254 KDFFEDNDNYY----------------------MLMEFVSGGDLMDFVAA-HGTVGEDAG 290

Query: 332 QRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGL 391
           + I  +V+ AVKY+H+  I HRDLK +NI+++         +D P+      I++ DFGL
Sbjct: 291 REITRQVLEAVKYMHDQGISHRDLKPDNIMIE---------QDDPV-----LIKITDFGL 336

Query: 392 CKKIENNEMCTARCGSEDYVSPEILMGVPYD--------GHLSDTWALGVILYSLFEDRL 443
            K    N      CG+  YV+PE++ G   +          L D W++G ++Y +    L
Sbjct: 337 AKVQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHL 396

Query: 444 PF-DPPPNASARQRSRATSHRIARFDWR 470
           PF     N   +Q  R + H     D+R
Sbjct: 397 PFSGQSQNELFKQIKRGSYHEGPLKDYR 424

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 98/201 (48%), Gaps = 43/201 (21%)

Query: 254 NSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAG 313
           + +TREL+VL+ LNHP IV L G     F    +                 ++M +   G
Sbjct: 258 DGVTRELEVLRRLNHPRIVSLKG-----FYEDDESYY--------------LLMEFVSGG 298

Query: 314 DLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFR 373
           DL+  V A +G +     + I  +++ AV+Y+HE  I HRDLK +NIL++         +
Sbjct: 299 DLMDFVAA-HGSVGEDAGREITRQILEAVRYIHEQGISHRDLKPDNILIE---------Q 348

Query: 374 DSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH--------- 424
           D P+      +++ DFGL K  +N       CG+  YV+PE++ G   +G+         
Sbjct: 349 DDPV-----LVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGNLYSS 403

Query: 425 LSDTWALGVILYSLFEDRLPF 445
           L D W++G ++Y +    LPF
Sbjct: 404 LVDMWSIGCLVYVILTGHLPF 424

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 111/253 (43%), Gaps = 51/253 (20%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G G F  V L     + +   + VA+K ++      N E+              E  + 
Sbjct: 51  LGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEK--------------EIKIY 96

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           REL  LK L+HP IV+L                + +++  + +    +++ Y   G+   
Sbjct: 97  RELNALKLLSHPNIVRL----------------EEVLQNSKYI---GIVLQYASGGEFYK 137

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +  +  RL+     R+F +++  V Y+H   + HRDLKLEN+LL               
Sbjct: 138 YIQKKR-RLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDE------------- 183

Query: 378 YCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGV-PYDGHLSDTWALGVILY 436
              +N I + DFG   +   N++    CGS  Y +PE+++   PY    +D W+ GVILY
Sbjct: 184 --HENLI-ITDFGFVNEFHKNDLMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILY 240

Query: 437 SLFEDRLPFDPPP 449
           ++    LP+D  P
Sbjct: 241 AMLAGYLPWDDDP 253

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 256 LTRELQVLKSLNH--PCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAG 313
           LT +  VLK+ N   P +V+ +  +          L ++I+   R      M++ YC   
Sbjct: 58  LTHQKVVLKTGNKRDPNVVREVFYHRQFDFPYITKLYEVIVTESRVW----MVLEYCSGH 113

Query: 314 DLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFR 373
           +L   ++ +  RL     +++F+++  AV Y HE   +HRDLKLEN+LL           
Sbjct: 114 ELYEHLL-KEQRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENVLL----------- 161

Query: 374 DSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGV 433
           D   + K     L DFG  +++         CG+  Y++PE++    YDG   D W+LG+
Sbjct: 162 DGNGHAK-----LTDFGFTREMATRSQLETICGTTVYMAPELIERKCYDGFKVDIWSLGI 216

Query: 434 ILYSLFEDRLPFD 446
           ILY++    +PFD
Sbjct: 217 ILYTMINGYMPFD 229

>Scas_700.28
          Length = 896

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 72/142 (50%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M + YCP  +L   V++ + R+      ++F ++V  V Y H  + +HRDLKLENILL  
Sbjct: 106 MALEYCPGKELYDRVLSMH-RVPTDECVQLFAQIVGGVHYAHSLNCVHRDLKLENILLDK 164

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S D                 +L DFG  ++          CG+  Y++PE++    YDG 
Sbjct: 165 SGD----------------AKLTDFGFTRECMTKTTLETICGTTVYMAPELIERKSYDGF 208

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+LGVILY++    +PFD
Sbjct: 209 KIDIWSLGVILYTMINGSMPFD 230

>Scas_707.34
          Length = 905

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 124/280 (44%), Gaps = 54/280 (19%)

Query: 196 RPIGSGNFSTVLLYELMDQSNPKLKQVAV--KRLKYPEELSNVEQINTSLRYKETLSRLE 253
           + IG G+F+TV    L+  ++P L Q  V    +  P   +      + L+ K+ L  LE
Sbjct: 42  KEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKKLLENLE 101

Query: 254 NSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAG 313
                E+ +LK ++HP IVKL+                      R      +IM YC  G
Sbjct: 102 ----IEIAILKKISHPHIVKLIDFE-------------------RTSKDFYLIMEYCSLG 138

Query: 314 DLLAAVMARNGRLEAW-LIQRIFT----------------------EVVLAVKYLHENSI 350
           DL   +  R   ++   L+++IF                       ++  A+K+L   ++
Sbjct: 139 DLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNL 198

Query: 351 IHRDLKLENILLK---YSFDDINSFRDSPIYCKQNF--IELADFGLCKKIENNEMCTARC 405
           +HRD+K +N+LL     +++D  SF D       N   +++ADFG  + + N  M    C
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSMAETLC 258

Query: 406 GSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           GS  Y++PEIL    Y+   +D W++G +LY +     PF
Sbjct: 259 GSPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCYGNPPF 297

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+  Y   G LL  ++ ++G L     ++    V  A++YLH N+I+HRDLK+ENI++  
Sbjct: 209 MLFEYVAGGQLLDYII-QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISN 267

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S +                I++ DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 268 SGE----------------IKIIDFGLSNVYDTRKQLHTFCGSLYFAAPELLKAHPYTGP 311

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ GV+LY L   ++PFD
Sbjct: 312 EVDVWSFGVVLYVLVCGKVPFD 333

>Scas_564.7
          Length = 1210

 Score = 90.5 bits (223), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+  Y   G LL  ++ ++G L     ++    +  A++Y+H N+I+HRDLK+ENI++  
Sbjct: 263 MLFEYVSGGQLLDYII-QHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMIST 321

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S +                I++ DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 322 SGE----------------IKIIDFGLSNVFDRKKQLHTFCGSLYFAAPELLKAHPYTGP 365

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ GV+LY L   ++PFD
Sbjct: 366 EVDVWSFGVVLYVLVCGKVPFD 387

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+  Y   G LL  ++ ++G L+    ++    +  A++YLH N+I+HRDLK+ENI++  
Sbjct: 200 MLFEYVSGGQLLDYII-QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISS 258

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S +                I++ DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 259 SGE----------------IKIIDFGLSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGP 302

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ G++LY L   ++PFD
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFD 324

>Scas_693.17
          Length = 1049

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 130/297 (43%), Gaps = 52/297 (17%)

Query: 165 ESSSSTEKCDDDIFQGFLLDHWDRPLL--WKKVRPIGSGNFSTVLL-----------YEL 211
           E ++S ++  ++  Q   L  + R  L  W  V  +G+G+   V L            ++
Sbjct: 42  EPATSKDQPSNNSKQSQKLRQFHRTSLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKI 101

Query: 212 MDQSNPKL--KQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHP 269
           ++++      K+ A K   Y   LS  E I      ++  SR + ++ RE  + + L HP
Sbjct: 102 VNRATKIFLSKEYAAKHNGYTIPLSEKEVIERQKNLEKEASRDKRTV-REASLGQILYHP 160

Query: 270 CIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAW 329
            I +L  ++          L +             M+  Y   G LL  ++ ++G L+  
Sbjct: 161 HICRLYEMHT---------LSNHFY----------MLFEYVSGGQLLDYII-QHGSLKES 200

Query: 330 LIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADF 389
             +    ++  A+KYLH ++I+HRDLK+ENI++                 K   I+L DF
Sbjct: 201 RARTFTRQICSALKYLHSHNIVHRDLKIENIMI----------------SKDGNIKLIDF 244

Query: 390 GLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFD 446
           GL    +        CGS  + +PE+L   PY G   D W+ GV+LY L   ++PFD
Sbjct: 245 GLSNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFD 301

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+  Y   G LL  ++ ++G L     ++    +  A++YLH N+I+HRDLK+ENI++  
Sbjct: 199 MLFEYVSGGQLLDYII-QHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMIST 257

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S +                I++ DFGL    +N +     CGS  + +PE+L   PY G 
Sbjct: 258 SGE----------------IKIIDFGLSNLYDNKKQLHTFCGSLYFAAPELLKANPYIGP 301

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ GV++Y L   ++PFD
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD 323

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 107/422 (25%), Positives = 180/422 (42%), Gaps = 101/422 (23%)

Query: 109 DDMLSVTQPNQRVVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDNYTKEPYFPESSS 168
           D  L+ T  N++V+S  + P  LS Q V+ LP   +                  F  S+ 
Sbjct: 77  DMSLNGTMVNEQVLSRDV-PYLLSNQDVIQLPNGAK------------------FKFSAV 117

Query: 169 STEKCDDDIFQGFLLDHWDRPLLWKKV-RPIGSGNFSTVLLYELMDQSNPKLKQVAVKRL 227
            +E     +    +   WDR   WK V R +GSG F  VL+ E +D +  +  QVA K +
Sbjct: 118 KSETMSQFMTGLRIKSEWDR---WKIVPRIVGSGTFGHVLVAEKVDHNMKR--QVAKKTV 172

Query: 228 KYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKK 287
            Y      V+ INT+          +  + +E  +L+ LNHP I++       I  +   
Sbjct: 173 SYA-----VKVINTA----------KTRMVKEATILEKLNHPNIIR-------IHQSCVD 210

Query: 288 PLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHE 347
            L ++ I   + L     + SY   GD L  +      +       I  +++LA+K+LH 
Sbjct: 211 ALGNVYI--FQDLISGGDLFSYLAKGDCLVPISETESLI-------IIYQILLALKFLHS 261

Query: 348 NSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENN--EMCTARC 405
           N I+HRDLKL+NILL            +P  C +  + LADFG+ K++  N  E      
Sbjct: 262 NGIVHRDLKLDNILLH-----------TPEPCTK--VVLADFGIAKELSQNTKERMHTVV 308

Query: 406 GSEDYVSPEILMGVPYDGHL--------------------SDTWALGVILYSLFEDRLPF 445
           G+ +Y +PE+  G   D ++                     D W+LGVI + +     PF
Sbjct: 309 GTPEYCAPEV--GFKADRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPF 366

Query: 446 DPPPNASARQRSRATSHRIARFDW---RWYRLSD-YKTNVGKQIVENTLTRKNQRWSINE 501
                    + S   + R  + ++   +W  ++D  K+ V K +  +T  R +   ++++
Sbjct: 367 ----YGDGSEASIIKNVRTGKLNFTARQWIAITDSAKSFVKKCLQVSTFNRCDVEEALHQ 422

Query: 502 IY 503
           ++
Sbjct: 423 VW 424

>Kwal_56.24059
          Length = 353

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 119/251 (47%), Gaps = 58/251 (23%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L   +       +  A+K LK  E++  ++QI  +            
Sbjct: 46  LRTLGTGSFGRVHLVRSVHNG----RYYAIKVLK-KEQVIRMKQIEHT------------ 88

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
               E ++LK ++HP ++++ G     F  S+                  M+M Y   G+
Sbjct: 89  --NDERRMLKLVDHPFLIRMWGT----FQDSRNLF---------------MVMDYIEGGE 127

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L + ++ ++ R    + +    EV+LA++YLH + II+RDLK ENILL            
Sbjct: 128 LFS-LLRKSQRFPNPVAKFYAAEVILALEYLHSHDIIYRDLKPENILLD----------- 175

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                +   I++ DFG  K+++   +    CG+ DY++PE++   PY+  + D W+LG++
Sbjct: 176 -----RNGHIKITDFGFAKEVDT--VTWTLCGTPDYIAPEVIATKPYNKSV-DWWSLGIL 227

Query: 435 LYSLFEDRLPF 445
           ++ +     PF
Sbjct: 228 IFEMLAGYTPF 238

>Kwal_26.8796
          Length = 796

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 109/238 (45%), Gaps = 43/238 (18%)

Query: 246 KETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDM 305
           K  +  + + + REL+VL+ L+HP IV L G     F   K                  +
Sbjct: 221 KRKVVGVMDGVARELEVLQRLDHPRIVSLKG-----FYEDKDSHY--------------L 261

Query: 306 IMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYS 365
           +M +   GDL+  V A +G +     + I  +++ AVKY+H   I HRDLK +NIL++  
Sbjct: 262 VMEFVSGGDLMDFVAA-HGSVGEDAGREITRQILEAVKYIHSMGISHRDLKPDNILIE-- 318

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMG---VPYD 422
                  RD P+      +++ DFGL K   N       CG+  YV+PE++ G      +
Sbjct: 319 -------RDDPV-----LVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVISGKNSGEKE 366

Query: 423 GH----LSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSD 476
           G+    L D W++G ++Y +    LPF         ++  A S+       + YR+SD
Sbjct: 367 GNTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSYHEGPL--KDYRISD 422

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 113/264 (42%), Gaps = 45/264 (17%)

Query: 192 WKKVRPIGSGNFSTVLLYE---LMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKET 248
           W  +  +G+G+   V L +     +    K+   A K   + ++L  +    T     E 
Sbjct: 54  WDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEELLER 113

Query: 249 LSRLENSLTRELQVLKS------LNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPP 302
             +LE  ++R+ + ++       L HP I +L              +C +          
Sbjct: 114 RKKLEKEVSRDKRTIREASLGQILYHPHICRLF------------EMCTMSNH------- 154

Query: 303 CDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILL 362
             M+  Y   G LL  ++ ++G L     ++    +  A++YLH N+I+HRDLK+ENI++
Sbjct: 155 FYMLFEYVSGGQLLDYII-QHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMI 213

Query: 363 KYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYD 422
             S +                I + DFGL    +  +     CGS  + +PE+L   PY 
Sbjct: 214 SSSGE----------------IRIIDFGLSNMYDPKKQLHTFCGSLYFAAPELLKAHPYT 257

Query: 423 GHLSDTWALGVILYSLFEDRLPFD 446
           G   D W+ GV+LY L   ++PFD
Sbjct: 258 GPEVDIWSFGVVLYVLVCGKVPFD 281

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 116/254 (45%), Gaps = 58/254 (22%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           ++ +R +G+G+F  V L     +SN   +  A+K LK           NT ++ K+    
Sbjct: 145 FQILRTLGTGSFGRVHLV----RSNHNGRFYAMKVLKK----------NTVVKLKQV--- 187

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
                  E  +L  ++HP I+++ G     F  S++                 MIM Y  
Sbjct: 188 --EHTNDERNMLSIVSHPFIIRMWGT----FQDSQQLF---------------MIMDYIE 226

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L + ++ ++ R    + +    EV LA++YLH   II+RDLK ENILL         
Sbjct: 227 GGELFS-LLRKSQRFPNPVAKFYAAEVCLALEYLHSKGIIYRDLKPENILLD-------- 277

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                   K   I+L DFG  K +   ++    CG+ DY++PE++   PY+  + D W+ 
Sbjct: 278 --------KNGHIKLTDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSF 326

Query: 432 GVILYSLFEDRLPF 445
           GV++Y +     PF
Sbjct: 327 GVLIYEMLAGYTPF 340

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M   +   G LL  ++ ++G L+    +++   ++ A++YLH N+I+HRDLK+ENI+L  
Sbjct: 168 MFFEFISGGQLLDYII-QHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIML-- 224

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          K   I+L DFGL    +  +     CGS  + +PE+L   PY G 
Sbjct: 225 --------------SKTGEIKLIDFGLSNMYDPRKSLQTFCGSLYFAAPELLKAHPYLGP 270

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ GV+LY L   ++PFD
Sbjct: 271 EVDVWSFGVVLYVLVCGKVPFD 292

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 115/253 (45%), Gaps = 62/253 (24%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPE--ELSNVEQINTSLRYKETLSRL 252
           +R +G+G+F  V L   +       +  A+K LK  +  ++  +E  N            
Sbjct: 54  MRTLGTGSFGRVHLVRSVHNG----RYYAIKVLKKAQVVKMKQIEHTND----------- 98

Query: 253 ENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPA 312
                 E ++LK + HP ++++ G     F  S+                  M+M Y   
Sbjct: 99  ------ERRMLKLVEHPFLIRMWGT----FQDSRNLF---------------MVMDYIEG 133

Query: 313 GDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSF 372
           G+L   ++ ++ R    + +    EV LA++YLH ++II+RDLK ENILL          
Sbjct: 134 GELFT-LLRKSQRFPNPVAKFYAAEVTLALEYLHFHNIIYRDLKPENILLD--------- 183

Query: 373 RDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                  +   I++ DFG  K++E   +    CG+ DY++PE++   PY+  + D W+LG
Sbjct: 184 -------RNGHIKITDFGFAKEVET--VTWTLCGTPDYIAPEVIATKPYNKSV-DWWSLG 233

Query: 433 VILYSLFEDRLPF 445
           V++Y +     PF
Sbjct: 234 VLIYEMLAGYTPF 246

>Kwal_56.23717
          Length = 858

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 72/142 (50%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+  Y   G LL  ++ ++G L     ++    +  A++YLH N+I+HRDLK+ENI++  
Sbjct: 10  MLFEYVSGGQLLDYII-QHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIST 68

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S +                I++ DFGL       +     CGS  + +PE+L   PY G 
Sbjct: 69  SGE----------------IKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGP 112

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ GV+L+ L   ++PFD
Sbjct: 113 EVDVWSFGVVLFVLVCGKVPFD 134

>Kwal_23.3590
          Length = 499

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 137/289 (47%), Gaps = 56/289 (19%)

Query: 166 SSSSTEKCDDDIFQGFLLDHWD---RPLLWKK---------VRPIGSGNFSTVLLYELMD 213
           S+S+TE+ +DD F+  LL   D   RPL  ++          + +GSG+++ V   E +D
Sbjct: 148 SASNTERANDDQFKKPLLSSQDVIRRPLANRRPSFFDRYIAGKELGSGHYAIV--KEAID 205

Query: 214 QSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVK 273
           + +  +  V +   ++ ++    +Q      ++E           E ++L S+ H  IVK
Sbjct: 206 KDSGDVVAVKIFHAQHNDDQKKTKQ------FRE-----------ETKILMSIQHKNIVK 248

Query: 274 LLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQR 333
           L+      FV   +P+    I+T        +++     G+L   ++ R  RL       
Sbjct: 249 LIDR----FV---EPVSKAQIQTF-------LVLEKVSDGELFDRIV-RKTRLREDETNA 293

Query: 334 IFTEVVLAVKYLHENSIIHRDLKLENILL---KYSFDD---INSFRDSPIYCKQNFIELA 387
           IF +++  ++YLH  +IIHRD+K ENILL   K    D   +  + D  I      I++A
Sbjct: 294 IFKQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDIT---IKIA 350

Query: 388 DFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILY 436
           DFGL K I   +     CG+  YV+PE+L    Y   + D W+ GV+LY
Sbjct: 351 DFGLAKFIGEMQFTNTLCGTPSYVAPEVLTKTGYTSRV-DMWSAGVLLY 398

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 115/253 (45%), Gaps = 62/253 (24%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L     +SN   +  A+K LK                 K T+ +L+ 
Sbjct: 91  LRTLGTGSFGRVHLI----RSNHNGRFYALKTLK-----------------KHTIVKLKQ 129

Query: 255 --SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPA 312
                 E ++L  ++HP I+++ G     F  S++                 M+M Y   
Sbjct: 130 VEHTNDERRMLSIVSHPFIIRMWGT----FQDSQQVF---------------MVMDYIEG 170

Query: 313 GDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSF 372
           G+L + ++ ++ R    + +    EV LA++YLH   II+RDLK ENILL          
Sbjct: 171 GELFS-LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD--------- 220

Query: 373 RDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                  K   I++ DFG  K +   ++    CG+ DY++PE++   PY+  + D W+ G
Sbjct: 221 -------KNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFG 270

Query: 433 VILYSLFEDRLPF 445
           V++Y +     PF
Sbjct: 271 VLIYEMLAGYTPF 283

>Scas_715.34
          Length = 1150

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 78/140 (55%), Gaps = 20/140 (14%)

Query: 307  MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
            M +   GDL+  V  +N RL     +    EV+LA+KY H+N +I+RDLKLENILL    
Sbjct: 903  MEFIGGGDLMWHV--QNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILL---- 956

Query: 367  DDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                    +P    Q  I++AD+GLCK ++  N   +  CG+ ++++PEIL    Y   +
Sbjct: 957  --------TP----QGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMAPEILKEQGYTRAV 1004

Query: 426  SDTWALGVILYSLFEDRLPF 445
             D WA GV+LY +   + PF
Sbjct: 1005 -DWWAFGVLLYQMLLCQSPF 1023

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 112/253 (44%), Gaps = 62/253 (24%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPE--ELSNVEQINTSLRYKETLSRL 252
           +R +G+G+F  V L     +SN   +  A+K LK     +L  VE  N   R        
Sbjct: 155 LRTLGTGSFGRVHLI----RSNHNGRFYALKALKKHTVVKLKQVEHTNDERR-------- 202

Query: 253 ENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPA 312
                    +L  ++HP I+++ G     F  S+                  M+M Y   
Sbjct: 203 ---------MLSIVSHPFIIRMWGT----FQDSQHVF---------------MVMDYIEG 234

Query: 313 GDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSF 372
           G+L + ++ ++ R    + +    EV LA++YLH   II+RDLK ENILL          
Sbjct: 235 GELFS-LLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENILLD--------- 284

Query: 373 RDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                  K   I++ DFG  K + +  +    CG+ DY++PE++   PY+  + D W+ G
Sbjct: 285 -------KNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFG 334

Query: 433 VILYSLFEDRLPF 445
           +++Y +     PF
Sbjct: 335 ILIYEMLAGYTPF 347

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 120/270 (44%), Gaps = 54/270 (20%)

Query: 254 NSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAG 313
           + ++REL+VL+ LNHP IV L       F   +                  M+M +   G
Sbjct: 229 DGVSRELEVLQKLNHPRIVSL-----KAFYEDEANYY--------------MVMEFISGG 269

Query: 314 DLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFR 373
           DL+  V A +G +     + I  +++ A++Y+H   I HRDLK +NIL++         +
Sbjct: 270 DLMDFVAA-HGAVGEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIE---------Q 319

Query: 374 DSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYD----------- 422
           D P+      +++ DFGL K   N  +    CG+  YV+PE++ G               
Sbjct: 320 DDPV-----LVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETEEERI 374

Query: 423 --GHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKTN 480
               L D W++G +++ +    LPF         ++ R  S+       + +R+SD    
Sbjct: 375 EYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIRKGSYHEGPL--KDFRISDE--- 429

Query: 481 VGKQIVENTL-TRKNQRWSINEIYESPFVK 509
             +  ++  L   +++R ++++    P++K
Sbjct: 430 -ARDFIDGLLQVDQSKRMTVDDALNHPWIK 458

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 73/142 (51%), Gaps = 17/142 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+  Y   G LL  ++ ++G +     ++    +  A+ YLH N+I+HRDLK+ENI++  
Sbjct: 221 MLFEYVSGGQLLDYII-QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISD 279

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
           S +                I++ DFGL    ++ +     CGS  + +PE+L   PY G 
Sbjct: 280 SSE----------------IKIIDFGLSNIYDSRKQLHTFCGSLYFAAPELLKANPYTGP 323

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
             D W+ GV+L+ L   ++PFD
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFD 345

>Kwal_47.18307
          Length = 621

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 83/172 (48%), Gaps = 30/172 (17%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y   G+LLA ++ R GRL   L + I  ++V  V Y+H   +IHRDLK EN+LL  
Sbjct: 89  FVLEYVSGGELLA-LIQRLGRLTEDLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLL-- 145

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLC-----KKIENNEMCTARCGSEDYVSPEILMGV 419
                          ++  + + DFG       +K EN +   +  G+ +YVSPE+L+  
Sbjct: 146 --------------SQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPELLLHS 191

Query: 420 PYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRW 471
              G  SD WALG I+Y L + + PF         +    T  +I   D++W
Sbjct: 192 QC-GFSSDIWALGCIIYQLNQGKPPFRG-------ENELQTFEKIVALDYKW 235

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 40/193 (20%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  E+Q+ KS++HP IV+        F+   +   ++ I           ++  CP G L
Sbjct: 126 LLSEIQIHKSMSHPNIVQ--------FIDCFEDDSNVYI-----------LLEICPNGSL 166

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
           +  ++ R   L    ++   T++  A+KY+H   +IHRDLKL NI    +++        
Sbjct: 167 ME-LLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYN-------- 217

Query: 376 PIYCKQNFIELADFGLCKKIEN-NEMCTARCGSEDYVSPEILMGVPYDGHL--SDTWALG 432
                   +++ DFGL   + N +E     CG+ +Y++PE+LMG  + GH    D W+LG
Sbjct: 218 --------LKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-KHSGHSFEVDIWSLG 268

Query: 433 VILYSLFEDRLPF 445
           V+LY+L   + PF
Sbjct: 269 VMLYALLIGKPPF 281

>Scas_651.18
          Length = 371

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 112/253 (44%), Gaps = 62/253 (24%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L     +SN   +  A+K LK                 K T+ +L+ 
Sbjct: 62  LRTLGTGSFGRVHLI----RSNHNGRFYALKVLK-----------------KHTIVKLKQ 100

Query: 255 --SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPA 312
                 E  +L  ++HP +V++ G                   T +      MIM Y   
Sbjct: 101 VEHTNDERLMLSVVSHPFLVRMWG-------------------TFQDFEQVFMIMDYIEG 141

Query: 313 GDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSF 372
           G+L + ++ ++ R    + +    EV LA++YLH   II+RDLK ENILL          
Sbjct: 142 GELFS-LLRKSQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILLD--------- 191

Query: 373 RDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                  K   I++ DFG  K +   ++    CG+ DY++PE++   PY+  + D W+ G
Sbjct: 192 -------KNGHIKITDFGFAKYVP--DITYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFG 241

Query: 433 VILYSLFEDRLPF 445
           +++Y +     PF
Sbjct: 242 ILIYEMLAGYTPF 254

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 105/250 (42%), Gaps = 50/250 (20%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G G F  V + +         K V+ +     E+L  V++     R  E+  +    LT
Sbjct: 322 LGKGAFGVVRICQK--------KNVSSQDGNKSEKLYAVKEFKR--RTSESAEKYSKRLT 371

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
            E  +  SL+H  IV  L     +F  +K   C+              +M YC  GDL  
Sbjct: 372 SEFCISSSLHHTNIVTTL----DLFQDAKGEYCE--------------VMEYCAGGDLFT 413

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            V+A  G+LE       F +++  V Y+HE  + HRDLK EN+LL +             
Sbjct: 414 LVVAA-GKLEYMEADCFFKQLIRGVVYMHEMGVCHRDLKPENLLLTH------------- 459

Query: 378 YCKQNFIELADFG--LCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                 +++ DFG   C K+   +N  +    CGS  Y++PE  +   +D    D WA G
Sbjct: 460 ---DGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAPEEYIKEEFDPRPVDIWACG 516

Query: 433 VILYSLFEDR 442
           VI  ++   R
Sbjct: 517 VIYMAMRTGR 526

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 108/251 (43%), Gaps = 58/251 (23%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L  +  + N +   + V + +    L  VE  N              
Sbjct: 90  LRTLGTGSFGRVHL--IRSRHNGRYYAMKVLKKEIVVRLKQVEHTND------------- 134

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
               E  +L  + HP I+++ G                   T +      MIM Y   G+
Sbjct: 135 ----ERLMLSIVTHPFIIRMWG-------------------TFQDAQQIFMIMDYIEGGE 171

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L + ++ ++ R    + +    EV LA++YLH   II+RDLK ENILL            
Sbjct: 172 LFS-LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD----------- 219

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                K   I++ DFG  K + +  +    CG+ DY++PE++   PY+  + D W+ G++
Sbjct: 220 -----KNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSI-DWWSFGIL 271

Query: 435 LYSLFEDRLPF 445
           +Y +     PF
Sbjct: 272 IYEMLAGYTPF 282

>Scas_627.7
          Length = 349

 Score = 82.0 bits (201), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 87/195 (44%), Gaps = 37/195 (18%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           L+    RE+++  SLNHP + KL G     F   K+                 ++M Y  
Sbjct: 132 LQKQFRREVEIQTSLNHPNLTKLYGH----FHDEKR---------------VYLLMEYLV 172

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   ++  +G     +  R   ++  A+ YLH+  IIHRDLK ENIL+ ++      
Sbjct: 173 YGELYK-LLRSHGPFNDVIASRFVFQIADALNYLHDKQIIHRDLKPENILIGFN------ 225

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                     N I+L DFG              CG+ DY+SPE++    YD  + D WAL
Sbjct: 226 ----------NVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDDKV-DVWAL 274

Query: 432 GVILYSLFEDRLPFD 446
           GV+ Y L     PF+
Sbjct: 275 GVLTYELIVGSPPFE 289

>Kwal_26.7355
          Length = 1446

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 103/403 (25%), Positives = 170/403 (42%), Gaps = 97/403 (24%)

Query: 48   EGTTGDSRSTPLTVSIPTFENVQALPTPMTYTPLSPGNLSMSPIDQSSLNIPKRRSHARL 107
            E  T +SRS P+   + T + + A PT  +   ++P          +SL IPKR    R+
Sbjct: 1041 ESPTSESRS-PVNSRMGTPQTMIAKPTNNSQEIITP--------RSNSLKIPKRTKTIRI 1091

Query: 108  LDDMLSVTQPNQRVVSELIAPANLSPQRVVSLPTVTEEALV--NDSVDSDNYTKEPYFPE 165
            +    S  + + +V S       +   RVV    VT++ +V  N S +S+   KE     
Sbjct: 1092 IAREASEARRDSKVRSMGRKNTKMWGTRVVE---VTDKKMVAINKSKNSNGEYKE----- 1143

Query: 166  SSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVK 225
                                      W K   IG G+F +V L   +       + +AVK
Sbjct: 1144 ------------------------FAWIKGEMIGKGSFGSVFLGLNVTTG----EMIAVK 1175

Query: 226  RLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTS 285
            +++ P   S  E          TLS LE +L  E+  LK L+H  IV+ LG  N  +V S
Sbjct: 1176 QVEVPRYGSQDET---------TLSVLE-ALRSEVATLKDLDHTNIVQYLGFENKNYVYS 1225

Query: 286  KKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYL 345
                               + + Y  AG  + +++   G+ +  LI+ +  +V+  + YL
Sbjct: 1226 -------------------LFLEYV-AGGSVGSLIRLYGKFDENLIRFLAVQVLRGLSYL 1265

Query: 346  HENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIEN---NEMCT 402
            H   I+HRD+K +N+LL     D++        CK     ++DFG+ KK  N   N   T
Sbjct: 1266 HSKKILHRDMKADNLLL-----DVDGI------CK-----ISDFGISKKSNNIYSNSDMT 1309

Query: 403  ARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             R G+  +++PE++          D W+LG ++  +F  + P+
Sbjct: 1310 MR-GTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPW 1351

>Kwal_27.10581
          Length = 1154

 Score = 84.0 bits (206), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 89/330 (26%), Positives = 141/330 (42%), Gaps = 81/330 (24%)

Query: 120  RVVSELIAPANLSPQRVVSLPTVTEEALVNDSVDSDNYTKEPYFPESSSSTEKCDDDIFQ 179
            ++  E I   ++SPQ+   +PT +E++    S  S  + +          T K       
Sbjct: 775  KIKDESITDPHVSPQKSTGVPTKSEQSSPQASHTSTRHKRR---------TPKRRKISLD 825

Query: 180  GFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQI 239
             F+L           ++ +G GNF  VLL E   ++N +L   A+K LK    + N   I
Sbjct: 826  DFVL-----------LKVLGKGNFGKVLLAE--SKNNERL--CAIKVLKKDHIIKN-HDI 869

Query: 240  NTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKL---LGINNPIFVTSKKPLCDLIIKT 296
             ++   K+            L   K+  HP +  L       N I+              
Sbjct: 870  ESARAEKKVF----------LLATKA-KHPFLTNLYCSFQTENRIYFA------------ 906

Query: 297  PRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLK 356
                      M +   GDL+  V  +N RL     +    EV+LA+KY H+N +I+RDLK
Sbjct: 907  ----------MEFIGGGDLMWHV--QNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLK 954

Query: 357  LENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEI 415
            LENILL            +P    +  I++AD+GLCK ++      +  CG+ ++++PEI
Sbjct: 955  LENILL------------TP----EGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEI 998

Query: 416  LMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            L    Y   + D WA GV+LY +   + PF
Sbjct: 999  LKEQEYTKAV-DWWAFGVLLYQMLLCQSPF 1027

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 75/140 (53%), Gaps = 20/140 (14%)

Query: 307  MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
            M +   GDL+  V  +N RL     +    EV+LA+KY H+N II+RDLKLENILL    
Sbjct: 902  MEFIGGGDLMWHV--QNQRLSVRRAKFYAAEVLLALKYFHDNGIIYRDLKLENILLTL-- 957

Query: 367  DDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                          +  I++AD+GLCK ++      +  CG+ ++++PEIL    Y   +
Sbjct: 958  --------------EGHIKIADYGLCKDEMWFGNRTSTFCGTPEFMAPEILREQAYTKAV 1003

Query: 426  SDTWALGVILYSLFEDRLPF 445
             D WA GV+LY +   + PF
Sbjct: 1004 -DWWAFGVLLYQMLLCQSPF 1022

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 122/272 (44%), Gaps = 55/272 (20%)

Query: 192  WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
            W+K   IG G F  V  Y  ++  N ++  +AVK +K  +                T+ +
Sbjct: 1034 WQKRSFIGGGTFGQV--YSAINLENGEI--LAVKEIKIHD--------------TTTMKK 1075

Query: 252  LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            +   +  E+ VL+ LNHP IV+  G+     V   K                ++ M YC 
Sbjct: 1076 IFPLIKEEMTVLEMLNHPNIVQYYGVE----VHRDK---------------VNIFMEYCE 1116

Query: 312  AGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYS----- 365
             G L  A +  +GR+E  ++ +++T E++  + YLH++ ++HRD+K ENILL ++     
Sbjct: 1117 GGSL--ASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKY 1174

Query: 366  --FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDG 423
              F    +   S     +N   + DFG+  K  N  M     G+  Y++PE + G    G
Sbjct: 1175 VDFGTARTVVGSRTRTVRN-AAVQDFGVETKSLNEMM-----GTPMYMAPETISGSAVKG 1228

Query: 424  HLS--DTWALGVILYSLFEDRLPFDPPPNASA 453
             L   D WALG ++  +   R P+    N  A
Sbjct: 1229 KLGADDVWALGCVVLEMATGRRPWSNLDNEWA 1260

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 116/251 (46%), Gaps = 58/251 (23%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L   +       +  A+K LK   ++  ++QI  +            
Sbjct: 65  MRTLGTGSFGRVHLVRSVHNG----RYYAIKVLK-KHQIIRMKQIEHT------------ 107

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
               E ++LK + HP ++++ G     F  S+                  M+M Y   G+
Sbjct: 108 --NDERRMLKLVEHPFLIRMWGT----FQDSRNLF---------------MVMDYIEGGE 146

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L + ++ ++ R    + +    EV LA++YLH ++II+RDLK ENILL            
Sbjct: 147 LFS-LLRKSQRFPNPVAKFYAAEVTLALEYLHSHNIIYRDLKPENILLD----------- 194

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                +   I++ DFG  K++    +    CG+ DY++PE++   PY+  + D W+LG++
Sbjct: 195 -----RNGHIKITDFGFAKEVIT--VTWTLCGTPDYIAPEVITTKPYNKSV-DWWSLGIL 246

Query: 435 LYSLFEDRLPF 445
           ++ +     PF
Sbjct: 247 IFEMLAGYTPF 257

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 118/251 (47%), Gaps = 58/251 (23%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L   +       +  A+K LK  +++  ++QI  +            
Sbjct: 39  MRTLGTGSFGRVHLVRSIHNG----RYYAIKVLK-KQQVIRMKQIEHT------------ 81

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
               E ++LK + HP ++++ G                  +  R L    ++M Y   G+
Sbjct: 82  --NDERRMLKVVEHPFLIRMWGT----------------FQDARNL---FIVMDYIEGGE 120

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L + ++ ++ R    + +    EV LA++YLH ++II+RDLK ENILL            
Sbjct: 121 LFS-LLRKSQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDLKPENILLD----------- 168

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                +   I++ DFG  K+++   +    CG+ DY++PE++   PY+  + D W+LG++
Sbjct: 169 -----RNGHIKITDFGFAKEVDT--VTWTLCGTPDYIAPEVITTKPYNKSI-DWWSLGIL 220

Query: 435 LYSLFEDRLPF 445
           ++ +     PF
Sbjct: 221 IFEMLAGYTPF 231

>Scas_690.13
          Length = 354

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 118/254 (46%), Gaps = 58/254 (22%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           ++ +R +G+G+F  V L   +       +  A+K LK  +++  ++QI  +         
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNG----RYYAIKVLK-KQQVVRMKQIEHT--------- 89

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
                  E ++LK + HP ++++ G     F  S+                  M+M Y  
Sbjct: 90  -----NDERRMLKLVEHPFLIRMWGT----FQDSRNLF---------------MVMDYIE 125

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L + ++ ++ R    + +    EV L ++YLH ++II+RDLK ENILL         
Sbjct: 126 GGELFS-LLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNIIYRDLKPENILLD-------- 176

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                   +   I++ DFG  K+++   +    CG  DY++PE++   PY+  + D W+L
Sbjct: 177 --------RNGHIKITDFGFAKEVDT--VTWTLCGPPDYIAPEVIATKPYNKSV-DWWSL 225

Query: 432 GVILYSLFEDRLPF 445
           GV+++ +     PF
Sbjct: 226 GVLIFEMLAGYTPF 239

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 77/140 (55%), Gaps = 20/140 (14%)

Query: 307  MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
            M +   GDL+  V  +N RL     +    EV+LA+KY H+N +I+RDLKLENILL    
Sbjct: 904  MEFIGGGDLMWHV--QNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILL---- 957

Query: 367  DDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                    +P    +  I++AD+GLCK ++      +  CG+ ++++PEIL    Y   +
Sbjct: 958  --------TP----EGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAV 1005

Query: 426  SDTWALGVILYSLFEDRLPF 445
             D WA GV+LY +   + PF
Sbjct: 1006 -DWWAFGVLLYQMLLCQSPF 1024

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 93/194 (47%), Gaps = 42/194 (21%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  E+Q+ KS+ HP IV+        F    +   ++ I           ++  CP G L
Sbjct: 117 LLSEIQIHKSMKHPNIVQ--------FTDCFEDDTNVYI-----------LLEICPNGSL 157

Query: 316 LAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           +  +  R    E  +  R FT ++V A+KY+H   IIHRDLKL NI     F+       
Sbjct: 158 MDLLKQRKQLTEPEV--RFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFN------- 208

Query: 375 SPIYCKQNFIELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHL--SDTWAL 431
                    +++ DFGL   + N+ E     CG+ +Y++PE+L G  + GH    D W++
Sbjct: 209 ---------LKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTG-KHTGHSFEVDIWSI 258

Query: 432 GVILYSLFEDRLPF 445
           GV++Y+L   + PF
Sbjct: 259 GVMIYALLIGKPPF 272

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 76/142 (53%), Gaps = 19/142 (13%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++++   G+L    + R GR +    +    E++ A++ LH+  II+RDLK ENILL Y
Sbjct: 457 LVLAFINGGELFYH-LQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDY 515

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDG 423
                           Q  I L DFGLCK  +++ E  T  CG+ +Y++PE+L+G  Y  
Sbjct: 516 ----------------QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYT- 558

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
            + D W LGV+LY +     P+
Sbjct: 559 KVVDWWTLGVLLYEMLTGLPPY 580

>Kwal_33.13846
          Length = 375

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 110/251 (43%), Gaps = 58/251 (23%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           +R +G+G+F  V L  +    N +   + V + +   +L  VE  N              
Sbjct: 68  LRTLGTGSFGRVHL--VRSNHNGRFYAMKVLKKRTIVKLKQVEHTND------------- 112

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
               E ++L  ++HP I+++ G                   T +      MIM Y   G+
Sbjct: 113 ----ERRMLSVVSHPFIIRMWG-------------------TFQDAEHVFMIMDYIEGGE 149

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L + ++ ++ R    + +    EV LA++YLH   II+RDLK EN+LL            
Sbjct: 150 LFS-LLRKSQRFPNPVAKFYAAEVCLALEYLHAQDIIYRDLKPENVLLD----------- 197

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                K   +++ DFG  K + +  +    CG+ DY++PE++   PY+  + D W+ G++
Sbjct: 198 -----KNGHVKITDFGFAKFVPD--VTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFGIL 249

Query: 435 LYSLFEDRLPF 445
           ++ +     PF
Sbjct: 250 IFEMLAGYTPF 260

>Kwal_23.6325
          Length = 1542

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 122/286 (42%), Gaps = 70/286 (24%)

Query: 192  WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
            W+K + +G G F TV     +D      + +AVK +K              ++ ++++ +
Sbjct: 1249 WQKRQFVGGGAFGTVFSAVNLDTG----EILAVKEIK--------------IQDRKSMKQ 1290

Query: 252  LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            +  ++  E+ VL+ LNHP +V+  G+     V   K                ++ M YC 
Sbjct: 1291 VFPAIKEEMSVLEMLNHPNVVQYYGVE----VHRDK---------------VNLFMEYCE 1331

Query: 312  AGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
             G L  A +  +GR+E  ++ +I+  +++  + YLH++S++HRD+K ENILL ++     
Sbjct: 1332 GGSL--AQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFN----- 1384

Query: 371  SFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSED-------------YVSPEILM 417
                         I+  DFG  + +  N       G+E              Y+SPE + 
Sbjct: 1385 -----------GVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESIT 1433

Query: 418  GVPYDGHLS-DTWALGVILYSLFEDRLPFDPPPNASARQRSRATSH 462
            G       S D W+LG ++  +   R P+    N  A     A  H
Sbjct: 1434 GAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGH 1479

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 76/140 (54%), Gaps = 20/140 (14%)

Query: 307  MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
            M +   GDL+  V  +N RL     +    EV+L++KY H+N +I+RDLKLENILL    
Sbjct: 914  MEFIGGGDLMWHV--QNRRLSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILL---- 967

Query: 367  DDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                    +P    +  I++AD+GLCK  +      +  CG+ ++++PEIL G  Y   +
Sbjct: 968  --------TP----EGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILKGQAYTKAV 1015

Query: 426  SDTWALGVILYSLFEDRLPF 445
             D W  GV+LY +   + PF
Sbjct: 1016 -DWWTFGVLLYQMLLCQSPF 1034

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 93/193 (48%), Gaps = 40/193 (20%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  E+Q+ KS++H  IV+        F+   +   ++ I           ++  CP G L
Sbjct: 125 LLSEIQIHKSMSHTNIVQ--------FIDCFEDNVNVYI-----------LLEICPNGSL 165

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
           +  +  R    E   ++   T++   ++Y+H N +IHRDLKL NI     ++        
Sbjct: 166 MELIKKRKTITEPE-VRFFMTQICGGIQYMHSNRVIHRDLKLGNIFFDEHYN-------- 216

Query: 376 PIYCKQNFIELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHL--SDTWALG 432
                   +++ DFGL   + N+ E     CG+ +Y++PE+LMG  + GH    D W++G
Sbjct: 217 --------LKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMG-KHSGHSYEVDIWSIG 267

Query: 433 VILYSLFEDRLPF 445
           V+LY+L   + PF
Sbjct: 268 VMLYALLIGKPPF 280

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 119/279 (42%), Gaps = 69/279 (24%)

Query: 196 RPIGSGNFSTVLL-YELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           + IG G+F+ V     L D  N  +K V+  +LK  + L N+E                 
Sbjct: 25  KEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEV---------------- 68

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
               E+ +LK + HP IV L+              C+      R      +IM YC  GD
Sbjct: 69  ----EIAILKKIKHPHIVGLID-------------CE------RTSSDFYLIMEYCALGD 105

Query: 315 LLAAVMAR-NGRLEAWLIQRIF----------------------TEVVLAVKYLHENSII 351
           L   +  R N  L+  LI+ +F                       ++  A+K+L   +++
Sbjct: 106 LTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNGLNRVLVVNYLQQLSSALKFLRSKNLV 165

Query: 352 HRDLKLENILL---KYSFDDINSFRDSPIYCKQNF--IELADFGLCKKIENNEMCTARCG 406
           HRD+K +N+LL      ++D  +F +       N   +++ADFG  + + N  +    CG
Sbjct: 166 HRDIKPQNLLLCTPLLDYNDPKTFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCG 225

Query: 407 SEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           S  Y++PEIL    Y+   +D W++G +LY +   R PF
Sbjct: 226 SPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCCGRPPF 263

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 120/273 (43%), Gaps = 58/273 (21%)

Query: 189 PLLWKKVRPIGSGNFSTVLLY------ELMDQSNPKLKQVAVKRLKYPEELSNVEQINTS 242
           P  W K   IGSG+F TV L       ELM      +KQV +K        +NVE  N  
Sbjct: 386 PKNWLKGARIGSGSFGTVYLGMNAQTGELM-----AVKQVEIKPAIAATADANVEDKNAE 440

Query: 243 LRYKETLS-----RLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTP 297
               +  S     ++ ++L  E+ +LK L H  IV   G                   + 
Sbjct: 441 KNVAKAPSTNLHRKMIDALQHEMSLLKELQHENIVTYYG-------------------SS 481

Query: 298 RALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKL 357
           +     ++ + Y P G + +++++  G  E  LI     ++++ V YLH  +IIHRD+K 
Sbjct: 482 QEGGNLNIFLEYVPGGSV-SSMLSNYGPFEEPLIVNFTRQILIGVAYLHRKNIIHRDIKG 540

Query: 358 ENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-----ENNEMCTARCGSEDYVS 412
            NIL+     DI         C    +++ DFG+ KK+     EN +  T+  GS  ++S
Sbjct: 541 ANILI-----DIKG-------C----VKITDFGISKKLSPLNQENQDKRTSLQGSVYWMS 584

Query: 413 PEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           PE++         +D W+ G ++  +F  + P+
Sbjct: 585 PEVVKQTATTSK-ADIWSTGCVVIEMFTGKHPY 616

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 88/187 (47%), Gaps = 39/187 (20%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E ++L  ++HP I+++ G                   T +      MIM Y   G+L + 
Sbjct: 124 ERKMLSVVSHPFIIRMWG-------------------TFQDAHQVFMIMDYIEGGELFS- 163

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           ++ ++ R    + +    EV LA++YLH   II+RDLK ENILL                
Sbjct: 164 LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD--------------- 208

Query: 379 CKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSL 438
            K   I+L DFG  K +   ++    CG+ DY++PE++   PY+  + D W+ G+++Y +
Sbjct: 209 -KNGHIKLTDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFGILIYEM 264

Query: 439 FEDRLPF 445
                PF
Sbjct: 265 LAGYTPF 271

>Scas_644.15
          Length = 726

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 91/191 (47%), Gaps = 42/191 (21%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E+Q+ KS+ HP IV         FV   +   ++ I           ++  C  G L+  
Sbjct: 139 EIQIHKSMKHPNIVH--------FVDCFEDDTNVYI-----------LLEICSNGSLMDL 179

Query: 319 VMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
           +  R    E  +  R FT ++  AVKY+H   +IHRDLKL NI     ++          
Sbjct: 180 MKKRKTLTEPEV--RFFTTQICGAVKYMHSRRVIHRDLKLGNIFFDKDYN---------- 227

Query: 378 YCKQNFIELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHL--SDTWALGVI 434
                 +++ DFGL   + NN E     CG+ +Y++PE+LMG  + GH    D W++GV+
Sbjct: 228 ------LKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMG-KHAGHSFEVDIWSIGVM 280

Query: 435 LYSLFEDRLPF 445
           +Y+L   + PF
Sbjct: 281 IYALLVGKPPF 291

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 121/266 (45%), Gaps = 67/266 (25%)

Query: 192  WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
            W+K   IG G+F +V     +D  +     +AVK +K+ +              ++T+ +
Sbjct: 1191 WQKRSFIGGGSFGSVYSAVNLDTGDI----LAVKEIKFND--------------RKTIKQ 1232

Query: 252  LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            +  S+  E+ VL+ LNHP +V+  G+                +   R     ++ M YC 
Sbjct: 1233 VFPSIRDEMTVLEMLNHPNVVQYYGVE---------------VHRDR----VNIFMEYCE 1273

Query: 312  AGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
             G L A+++A +GR+E  ++ ++++ +++  + YLHE+ + HRD+K ENILL ++     
Sbjct: 1274 GGSL-ASLLA-HGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFN----- 1326

Query: 371  SFRDSPIYCKQNFIELADFGLCK----------KIENNEMCTARCGSEDYVSPEILMGVP 420
                         I+  DFG  K           +E +       G+  Y+SPE + G  
Sbjct: 1327 -----------GIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTG 1375

Query: 421  YDGHLS-DTWALGVILYSLFEDRLPF 445
            Y    S D W+LG ++  +   R P+
Sbjct: 1376 YGKFGSDDIWSLGCVILEMVTGRRPW 1401

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 119/269 (44%), Gaps = 66/269 (24%)

Query: 183 LDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTS 242
           +DH     L++  R +G+G+F  V                     K  ++L + E +   
Sbjct: 58  MDHKKAGYLFQ--RTLGAGSFGVV---------------------KRAKQLHSDEDVAVK 94

Query: 243 LRYKETLSR---LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRA 299
           +  K  L +   LE  +  EL +++ L+HP IVK        F T  K            
Sbjct: 95  ILLKRALEKNGGLE-PIYDELNIIQHLDHPNIVKF----KDWFETESKFY---------- 139

Query: 300 LPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLEN 359
                ++      G+L   +M  +G+        I  +++ AV+YLH  +IIHRDLK EN
Sbjct: 140 -----IVTQLASGGELFDRIM-HDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRDLKPEN 193

Query: 360 ILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTAR-CGSEDYVSPEILMG 418
           +L       ++  +DS I        LADFG+ +++EN++    R  GS  YV+PE+   
Sbjct: 194 LLY------LDKSKDSRIV-------LADFGIARQLENDDDVIYRPAGSLGYVAPEVFTS 240

Query: 419 VPYDGHL--SDTWALGVILYSLFEDRLPF 445
              DGH   SD W++GVI Y+L     PF
Sbjct: 241 ---DGHGKPSDIWSVGVITYTLLCGYSPF 266

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 121/261 (46%), Gaps = 54/261 (20%)

Query: 188  RPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKE 247
            +   W K   IG G+F  V L   ++ +  ++  +AVK+++ P+  S  E I        
Sbjct: 1171 KEFAWMKGEMIGKGSFGAVYL--CLNVTTGEM--MAVKQVEVPKYSSQNEAI-------- 1218

Query: 248  TLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
             LS +E +L  E+  LK L+H  IV+ LG  N   + S                   + +
Sbjct: 1219 -LSTVE-ALRSEVSTLKDLDHLNIVQYLGFENKNNIYS-------------------LFL 1257

Query: 308  SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
             Y  AG  + +++   GR +  LI+ + T+V+  + YLH   I+HRD+K +N+LL     
Sbjct: 1258 EYV-AGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLL----- 1311

Query: 368  DINSFRDSPIYCKQNFIELADFGLCKK---IENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                  D    CK     ++DFG+ +K   I +N   T R G+  +++PE++        
Sbjct: 1312 ------DQDGICK-----ISDFGISRKSKDIYSNSDMTMR-GTVFWMAPEMVDTKQGYSA 1359

Query: 425  LSDTWALGVILYSLFEDRLPF 445
              D W+LG I+  +F  + P+
Sbjct: 1360 KVDIWSLGCIVLEMFAGKRPW 1380

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 114/282 (40%), Gaps = 74/282 (26%)

Query: 196 RPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENS 255
           + IG G+F+ V    L D S   +   AV R K              LR K+ L  LE  
Sbjct: 22  KEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSK--------------LRNKKLLENLE-- 65

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
              E+ +LK + HP IV LL                   +  R      ++M YC  GDL
Sbjct: 66  --IEIAILKKIKHPHIVGLL-------------------ECERTGTDFYLMMEYCALGDL 104

Query: 316 LAAVMAR------------------------NGRLEAWLIQRIFTEVVLAVKYLHENSII 351
              +  R                        NG L   L+     ++  A+K+L   +++
Sbjct: 105 TFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNG-LNRVLVVNYLQQLSSALKFLRSKNLV 163

Query: 352 HRDLKLENILLKYSFDDINSFRDSPIYCKQNFI--------ELADFGLCKKIENNEMCTA 403
           HRD+K +N+LL     D N   D   +  + F+        ++ADFG  + + N  +   
Sbjct: 164 HRDIKPQNLLLSTPLVDYN---DPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLAET 220

Query: 404 RCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            CGS  Y++PEIL    Y+   +D W++G +LY +   + PF
Sbjct: 221 LCGSPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCCGKPPF 261

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 91/191 (47%), Gaps = 35/191 (18%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  EL +L+ LNHP IV+        +  SK+                 ++      G+L
Sbjct: 92  LYDELSILQQLNHPNIVRF-----KDWFESKEKFY--------------IVTQLATGGEL 132

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++ +    E   +  I  +++  V+YLH+ +I+HRDLK ENIL       +N   DS
Sbjct: 133 FDRILEKGKFCEVDAV-FIVKQILQGVQYLHQRNIVHRDLKPENILY------LNKSDDS 185

Query: 376 PIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
           P+        + DFG+ K++ ++NE+     GS  YV+PE+L    + G   D W++GVI
Sbjct: 186 PLV-------IGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSGH-GKPCDIWSIGVI 237

Query: 435 LYSLFEDRLPF 445
            Y+L     PF
Sbjct: 238 TYTLLCGYSPF 248

>Kwal_56.24091
          Length = 381

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 85/195 (43%), Gaps = 37/195 (18%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           ++    RE+++  SL HP + +L G     F   K+                 ++M Y  
Sbjct: 164 VQKQFRREVEIQSSLKHPNLTRLYGY----FHDEKR---------------VYLLMEYLV 204

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   + + +G            ++  A+ Y+H  +I+HRD+K ENILL +       
Sbjct: 205 NGELYKHLRS-HGPFNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF------- 256

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                    QN ++L DFG       N      CG+ DY+SPE++    YD  + D WAL
Sbjct: 257 ---------QNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDNKV-DVWAL 306

Query: 432 GVILYSLFEDRLPFD 446
           GV+ Y L     PF+
Sbjct: 307 GVLTYELLVGSPPFE 321

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 109/248 (43%), Gaps = 53/248 (21%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G G F  V L      S+ + K VA+K ++      N E+              E  + 
Sbjct: 62  LGEGEFGKVKLGWSKSNSD-ESKNVAIKLIRRDTIPKNSEK--------------EVKIY 106

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           RE+  LK L HP IV L                + +++  + +    +++ Y   G+   
Sbjct: 107 REINALKHLAHPNIVTL----------------EEVLQNSKYI---GIVLHYASGGEFYK 147

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +  +  RL+     R+F +++  V Y+H   + HRDLKLEN+LL    D+         
Sbjct: 148 YIQKKR-RLKEPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLL----DE--------- 193

Query: 378 YCKQNFIELADFGLCKKIEN-NEMCTARCGSEDYVSPEILMGV-PYDGHLSDTWALGVIL 435
              +N I + DFG   +  + N++    CGS  Y +PE+++    Y+   +D W+ GVIL
Sbjct: 194 --HENLI-ITDFGFVNEFSSRNDLMKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVIL 250

Query: 436 YSLFEDRL 443
           Y++    L
Sbjct: 251 YAMLAGYL 258

>Kwal_47.17252
          Length = 872

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 121/277 (43%), Gaps = 66/277 (23%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQ-VAVKRLKYPEELSNVEQINTSLRYKETLSRLENSL 256
           IG G+F+TV  Y+    SN  L   +A+K +             + L+ K+ L  LE   
Sbjct: 26  IGKGSFATV--YKGRIASNRDLNDFIAIKAVS-----------RSKLKNKKLLENLE--- 69

Query: 257 TRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLL 316
             E+ +LK + HP IV L+              C+      R      +IM YC  GDL 
Sbjct: 70  -IEIAILKKIKHPHIVGLMD-------------CE------RTGADFFLIMEYCALGDLT 109

Query: 317 AAVMARNGRLEAW-LIQRIFTEV------------VLAVKYLHENS----------IIHR 353
             +  R G +E   L++ +F +             V+ V YL + S          ++HR
Sbjct: 110 FLIKKRGGLIEKHPLVRTMFEKYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHR 169

Query: 354 DLKLENILLK---YSFDDINSFRDSPIYCKQNF--IELADFGLCKKIENNEMCTARCGSE 408
           D+K +N+LL     ++ D  +F         N   +++ADFG  + + N  +    CGS 
Sbjct: 170 DIKPQNLLLSTPLVNYSDRETFHKMGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSP 229

Query: 409 DYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            Y++PEIL    Y+   +D W++G +LY +   R PF
Sbjct: 230 LYMAPEILDYQKYNAK-ADLWSVGTVLYEMCCGRPPF 265

>Scas_689.25*
          Length = 409

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 20/141 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           MIM Y   G+L + ++ R+ R    + +    EV LA+ YLH   II+RDLK EN+LL  
Sbjct: 174 MIMDYVEGGELFS-LLRRSQRFPNPVAKFYAAEVCLALDYLHSLDIIYRDLKPENLLLD- 231

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
                          +   I++ DFG  K +   ++    CG+ DY++PE++   PY+  
Sbjct: 232 ---------------RNGHIKVTDFGFAKYVP--DVTYTLCGTPDYIAPEVISAKPYNKS 274

Query: 425 LSDTWALGVILYSLFEDRLPF 445
           + D W+ G+++Y +     PF
Sbjct: 275 V-DWWSFGILIYEMLSGHTPF 294

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 94/187 (50%), Gaps = 25/187 (13%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
            T E ++L S+ HP IVKL+      FV   +P+    I+T        +++     G+L
Sbjct: 146 FTEETKILLSIQHPNIVKLIDR----FV---EPVSKTQIQTY-------LVLEKINDGEL 191

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD------DI 369
              ++ +N  L     + +F +++  +KYLH  +IIHRD+K ENILL  S         +
Sbjct: 192 FERIVRKNN-LREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIAL 250

Query: 370 NSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTW 429
             + D  +  +   +++ADFGL K     +     CG+  YV+PE+L+   Y   + D W
Sbjct: 251 GPWDDDELDIQ---VKIADFGLAKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTSRV-DMW 306

Query: 430 ALGVILY 436
           + GV+LY
Sbjct: 307 SAGVLLY 313

>Scas_711.25
          Length = 1515

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 120/259 (46%), Gaps = 54/259 (20%)

Query: 190  LLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETL 249
              W K   IG G+F  V  Y  ++ +  ++  +AVK+++ P+  S  E I         +
Sbjct: 1212 FAWMKGEMIGKGSFGAV--YLCLNVTTGEM--MAVKQVEVPKYSSQDEAI---------I 1258

Query: 250  SRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSY 309
            S +E +L  E+  LK L+H  IV+ LG  N   + S                   + + Y
Sbjct: 1259 STVE-ALRSEVSTLKDLDHLNIVQYLGFENKDNIYS-------------------LFLEY 1298

Query: 310  CPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDI 369
              AG  + +++   GR +  LI+ + T+V+  + YLH   I+HRD+K +N+LL       
Sbjct: 1299 V-AGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLL------- 1350

Query: 370  NSFRDSPIYCKQNFIELADFGLCKK---IENNEMCTARCGSEDYVSPEILMGVPYDGHLS 426
                D    CK     ++DFG+ +K   I +N   T R G+  +++PE++          
Sbjct: 1351 ----DQDGVCK-----ISDFGISRKSKDIYSNSDMTMR-GTVFWMAPEMVDTKQGYSAKV 1400

Query: 427  DTWALGVILYSLFEDRLPF 445
            D W+LG I+  +F  + P+
Sbjct: 1401 DIWSLGCIVLEMFAGKRPW 1419

>Scas_628.9
          Length = 621

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 105/254 (41%), Gaps = 54/254 (21%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G G F TV +    D    K    AVK  K               +  E   +    LT
Sbjct: 341 LGKGAFGTVRICHKKDPKQEKELLFAVKEFKK--------------KSSEPFEKYSKRLT 386

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
            E  +  SL+H  IV  L +    F  +K   C+              +M YC  GDL +
Sbjct: 387 SEFCISSSLHHINIVTTLDL----FQDAKGEYCE--------------VMEYCSGGDLFS 428

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +++  G+LE       F +++  V Y+H+  + HRDLK EN+LL  + D +        
Sbjct: 429 LIVSA-GKLEYAEADCFFKQLMRGVVYMHDMGVSHRDLKPENLLL--TSDGV-------- 477

Query: 378 YCKQNFIELADFG--LCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                 +++ DFG   C K+   ++  +    CGS  Y++PE  +   +D    D WA G
Sbjct: 478 ------LKITDFGNSECFKMAWEDDIHLSGGVCGSSPYIAPEEYIKEEFDPRCVDIWACG 531

Query: 433 VILYSLFEDRLPFD 446
           VI  ++   R  +D
Sbjct: 532 VIYMAMRTGRQLWD 545

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 76/140 (54%), Gaps = 20/140 (14%)

Query: 307  MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
            M +   GDL+  V  +N RL     +    EV+LA+K+ H+N +I+RDLKLENILL    
Sbjct: 897  MEFIGGGDLMWHV--QNQRLSVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENILL---- 950

Query: 367  DDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                    +P    +  I++AD+GLCK  +      +  CG+ ++++PE+L    Y   +
Sbjct: 951  --------TP----EGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELLREQDYTKAV 998

Query: 426  SDTWALGVILYSLFEDRLPF 445
             D WA GV+LY +   + PF
Sbjct: 999  -DWWAFGVLLYQMLLCQSPF 1017

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 91/188 (48%), Gaps = 39/188 (20%)

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
           +L  EL +L+ L+HP IV         +  SK                  +I      G+
Sbjct: 82  ALYDELDILQRLHHPNIVAF-----KDWFESKDKFY--------------IITQLAKGGE 122

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L   ++ + G+       RI  E++ AVKY+H  +I+HRDLK EN+L       I+   +
Sbjct: 123 LFDRIL-KKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLY------IDKSDE 175

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTAR-CGSEDYVSPEILMGVPYDGHLS--DTWAL 431
           SP+        +ADFG+ K+++++E    +  GS  YV+PE+L     DGH    D W++
Sbjct: 176 SPLV-------VADFGIAKRLKSDEELLYKPAGSLGYVAPEVLT---QDGHGKPCDIWSI 225

Query: 432 GVILYSLF 439
           GVI Y+L 
Sbjct: 226 GVITYTLL 233

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 103/251 (41%), Gaps = 55/251 (21%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQV-AVKRLKYPEELSNVEQINTSLRYKETLSRLENSL 256
           +G G F  V +       NPK++++ AVK  K               +  E   +    L
Sbjct: 300 LGKGAFGVVRICHKKVPENPKVEKLYAVKEFKR--------------KATEPKEKFAKRL 345

Query: 257 TRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLL 316
           T E  +  SL+H  IV  L     +F  +    C+              +M YC  GDL 
Sbjct: 346 TSEFCISSSLHHTNIVDTL----DLFQDANGDYCE--------------VMEYCAGGDLF 387

Query: 317 AAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSP 376
             ++A  G+LE       F +++  V Y+H+  + HRDLK EN++L +            
Sbjct: 388 TLIIAA-GKLEYMEADCFFKQLLRGVVYMHDMGVCHRDLKPENLILTH------------ 434

Query: 377 IYCKQNFIELADFG--LCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                  +++ DFG   C K+   E+  +    CGS  Y++PE  +   +D    D WA 
Sbjct: 435 ----DGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVLEEFDPRPVDIWAC 490

Query: 432 GVILYSLFEDR 442
           GVI  ++   R
Sbjct: 491 GVIYMAMRTGR 501

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 61/112 (54%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            +F +V   +K+LH+N I+HRD+K EN+++                  + F++L DFG   
Sbjct: 1083 LFKQVASGIKHLHDNGIVHRDIKDENVIVD----------------NKGFVKLIDFGSAA 1126

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             +++        G+ DY +PE+L G PY+G   D WA+GV+LY++     PF
Sbjct: 1127 YVKSGPF-DVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVLLYTIIYKENPF 1177

>Kwal_26.7635
          Length = 691

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 111/252 (44%), Gaps = 57/252 (22%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLEN 254
           ++ IG G+F  V+     D +    K  A+K ++    +S  E I+T L  +  L+R+EN
Sbjct: 361 LKVIGKGSFGKVMQVRKKDTN----KVYALKAIRKSYIVSKSEVIHT-LAERTVLARVEN 415

Query: 255 SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGD 314
                         P IV L                    ++P  L    +++++   G+
Sbjct: 416 --------------PFIVPL----------------KFTFQSPDKLY---IVLAFINGGE 442

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRD 374
           L    + R GR      +    E++ A++ LH   +I+RDLK ENILL +          
Sbjct: 443 LFYH-LQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDH---------- 491

Query: 375 SPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGV 433
                 Q  I L DFGLCK  ++  +     CG+ +Y++PE+L+G  Y   + D W LGV
Sbjct: 492 ------QGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGV 544

Query: 434 ILYSLFEDRLPF 445
           +LY +     P+
Sbjct: 545 LLYEMMTGLPPY 556

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 75/142 (52%), Gaps = 19/142 (13%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++++   G+L    + + GR +    +    E++ A++ LH  ++I+RDLK ENILL Y
Sbjct: 464 LVLAFINGGELFFH-LQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDY 522

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDG 423
                           Q  I L DFGLCK  +++ +     CG+ +Y++PE+L+G  Y  
Sbjct: 523 ----------------QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYS- 565

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
            + D W LGV+LY +     P+
Sbjct: 566 KVVDWWTLGVLLYEMLTGLPPY 587

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 71/137 (51%), Gaps = 18/137 (13%)

Query: 310 CPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDI 369
           C  G  L   + R G  +    +   +E++LA+  LH+  +++RDLK ENILL       
Sbjct: 456 CINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLD------ 509

Query: 370 NSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
                      Q  I L DFGLCK  +++NE  +  CG+ +Y++PE+L+G  Y   + D 
Sbjct: 510 ----------SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYT-KVVDW 558

Query: 429 WALGVILYSLFEDRLPF 445
           W LGV+LY +     P+
Sbjct: 559 WTLGVLLYEMLTGLPPY 575

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 86/195 (44%), Gaps = 37/195 (18%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           ++    RE+++  S  H  + +L G     F   K+                 ++M Y  
Sbjct: 141 IQKQFRREVEIQGSFKHKNLTQLYGF----FYDEKR---------------VYLLMEYVY 181

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L    +  NG L   L      ++  A+ Y+H  +I+HRD+K ENIL+ ++      
Sbjct: 182 YGELYK-FLKNNGPLNETLASYFVYQMANALDYMHSKNILHRDIKPENILIGFN------ 234

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                     N I+L DFG     E+ +     CG+ DY+SPE++    Y+  + D WAL
Sbjct: 235 ----------NTIKLTDFGWSVYNEDGQKRKTLCGTIDYLSPELIKSREYNNKV-DVWAL 283

Query: 432 GVILYSLFEDRLPFD 446
           GV+ Y L     PF+
Sbjct: 284 GVLTYELLVGSPPFE 298

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 19/142 (13%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++++   G+L    +   GR      +    E++ A+  LH+  +I+RDLK ENILL Y
Sbjct: 419 LVLAFINGGELFYH-LQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDY 477

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDG 423
                           Q  I L DFGLCK  +++N+     CG+ +Y++PEIL+G  Y  
Sbjct: 478 ----------------QGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTK 521

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
            + D W LG++LY +     P+
Sbjct: 522 TV-DWWTLGILLYEMMTGLPPY 542

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            +F +VV  VK+LH+  I+HRD+K ENI++                  Q F+++ DFG   
Sbjct: 1190 LFKQVVSGVKHLHDQGIVHRDIKDENIIVD----------------SQGFVKIIDFGSAA 1233

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             +++        G+ DY +PE+L G PY+G   D WA+G++LY++     PF
Sbjct: 1234 YVKSGPF-DVFVGTIDYAAPEVLGGSPYEGKPQDIWAIGILLYTIVFKENPF 1284

>Kwal_56.22476
          Length = 697

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 93/193 (48%), Gaps = 40/193 (20%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  E+Q+ KS+ H  IV+        FV   +   ++ I           ++  CP G L
Sbjct: 123 LLSEIQIHKSMRHTNIVQ--------FVDCFEDDTNVYI-----------LLEICPNGSL 163

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
           +  ++ R   L    ++   T++V AVKY+H   +IHRDLKL NI     FD        
Sbjct: 164 MD-LLKRRKMLTEPEVRFFTTQIVGAVKYMHSRRVIHRDLKLGNIF----FD-------- 210

Query: 376 PIYCKQNFIELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHL--SDTWALG 432
               K   +++ DFGL   + N+ E     CG+ +Y++PE+L G  + GH    D W+ G
Sbjct: 211 ----KHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG-KHTGHSYEVDIWSCG 265

Query: 433 VILYSLFEDRLPF 445
           V++Y+L   + PF
Sbjct: 266 VMIYALLIGKPPF 278

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 143/334 (42%), Gaps = 59/334 (17%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEEL-----SNVEQINTSLRYK 246
           +K +R +G G +  V+L  + D+   KL   A+K+LK  E L     +N E ++      
Sbjct: 145 FKPIRVLGQGAYGKVIL--VKDKQTSKL--YAMKQLKKAEILIAPTDANTESMDKLAELD 200

Query: 247 ETLSRLENSLTRELQ-------VLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRA 299
           + +   +  L++ ++       +L  L HP IVKL         TSK  L          
Sbjct: 201 KPVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLF---YSFHDTSKLYL---------- 247

Query: 300 LPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLEN 359
                 ++ Y P G+L    +  +G LE   +     E+  A+K+LH   +++RDLK EN
Sbjct: 248 ------LLQYIPGGELFFH-LKEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPEN 300

Query: 360 ILLKYS----FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEI 415
            LL  +      D    + S     Q      D G   + E+     +  G+ +Y +PEI
Sbjct: 301 CLLNQNGHLVLTDFGLSKSSASNASQE-----DLGAGNEGEDVNELHSIIGTPEYCAPEI 355

Query: 416 LMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRW-YRL 474
           L+G PY  +  D ++LG +LY +   +     PP   A  +  A   +  +   +  Y L
Sbjct: 356 LLGQPYTAN-CDWYSLGCLLYDMLTGK-----PPYTGANHKVIANKIKNDKQGPKIPYYL 409

Query: 475 SDYKTNVGKQIVENTLTRKN--QRWSINEIYESP 506
           SD     G + V   L + +  +RW +++ +  P
Sbjct: 410 SD-----GMKDVLGALLKSDPKKRWDVDKYWSEP 438

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 117/261 (44%), Gaps = 54/261 (20%)

Query: 188  RPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKE 247
            +   W K   IG G+F  V  Y  ++ +  ++  +AVK++  PE  S  E          
Sbjct: 1034 KEFAWIKGEIIGKGSFGAV--YLALNVTTGEM--LAVKQVTVPEFSSQDES--------- 1080

Query: 248  TLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
             +S +E +L  E+  LK LNH  IV+ LG      + S                   + +
Sbjct: 1081 AISMVE-ALKSEVSTLKDLNHVNIVQYLGFEEKNGIYS-------------------LFL 1120

Query: 308  SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
             Y  AG  + +++   GR +  LI+ +  +V+  + YLH   I+HRD+K +N+LL     
Sbjct: 1121 EYV-AGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLL----- 1174

Query: 368  DINSFRDSPIYCKQNFIELADFGLCKKIEN---NEMCTARCGSEDYVSPEILMGVPYDGH 424
                  D+   CK     ++DFG+ +K  N   N   T R G+  +++PE++        
Sbjct: 1175 ------DNDGVCK-----ISDFGISRKSNNIYSNSDMTMR-GTVFWMAPEMVDTAHGYSA 1222

Query: 425  LSDTWALGVILYSLFEDRLPF 445
              D W+LG ++  +F  + P+
Sbjct: 1223 KVDIWSLGCVVLEMFAGKRPW 1243

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 18/137 (13%)

Query: 310 CPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDI 369
           C  G  L   + R GR +    +    E++ A+  LH+  +I+RDLK ENILL Y     
Sbjct: 449 CINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDY----- 503

Query: 370 NSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
                      Q  I L DFGLCK  +++ +     CG+ +Y++PE+L+G  Y   + D 
Sbjct: 504 -----------QGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY-SKVVDW 551

Query: 429 WALGVILYSLFEDRLPF 445
           W LGV+LY +     P+
Sbjct: 552 WTLGVLLYEMLTGLPPY 568

>Scas_653.25
          Length = 666

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 95/214 (44%), Gaps = 48/214 (22%)

Query: 247 ETLSRLENSLTRELQVLKSLNHPCIVKLLGI-NNPIFVTSKKPLCDLIIKTPRALPPCDM 305
           ET  + +    +E  +   L+HP I++ L I  NP    S+                   
Sbjct: 307 ETTKQYQKRCIKEFILSSHLSHPNIIETLDIFYNPSGQISE------------------- 347

Query: 306 IMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYS 365
           IM +CP  D    VM+R   L        F ++   V+YLH   I HRDLKL+N ++ Y+
Sbjct: 348 IMEWCPH-DFFNIVMSRTHLLTRRETFCYFKQLCNGVRYLHTLGIAHRDLKLDNCVITYN 406

Query: 366 FDDINSFRDSPIYCKQNFIELADFG------LCKKIENN-EMCTAR--CGSEDYVSPEIL 416
                             ++L DFG      L K  E   E+  +R   GS+ Y++PE+L
Sbjct: 407 ----------------GILKLIDFGSATIFQLNKSTEEKPELIPSRGIVGSDPYLAPEVL 450

Query: 417 MG--VPYDGHLSDTWALGVILYSLFEDRLPFDPP 448
           +   +PYD  L+D W+LG+I  ++   R P+  P
Sbjct: 451 LSKEIPYDASLADVWSLGIIFCAIMLKRFPWRIP 484

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 119/278 (42%), Gaps = 66/278 (23%)

Query: 196 RPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENS 255
           + IG G+F+TV    L   ++ K + VA+K      E+S  +  N  L        LEN 
Sbjct: 28  KEIGKGSFATVYRGHL---TSDKSQHVAIK------EVSRAKLKNKKL--------LEN- 69

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  E+ +LK + HP IV L                   I   R      +IM YC  GDL
Sbjct: 70  LEIEIAILKKIKHPHIVGL-------------------IDCERTSTDFYLIMEYCALGDL 110

Query: 316 LAAVMARNGRLEAW-LIQRIF----------------------TEVVLAVKYLHENSIIH 352
              +  R   +E   L++ +F                       ++  A+K+L   +++H
Sbjct: 111 TFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVH 170

Query: 353 RDLKLENILLK---YSFDDINSFRDSPIYCKQNF--IELADFGLCKKIENNEMCTARCGS 407
           RD+K +N+LL      + D  SF +       N   +++ADFG  + + N  +    CGS
Sbjct: 171 RDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLPNTSLAETLCGS 230

Query: 408 EDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             Y++PEIL    Y+   +D W++G +++ +     PF
Sbjct: 231 PLYMAPEILNYQKYNAK-ADLWSVGTVVFEMCCGTPPF 267

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 88/204 (43%), Gaps = 48/204 (23%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGI-----NNPIFVTSKKPLCDLIIKTPRALPPCDMI 306
            +  L RELQ  KS     IV+  G+     N+ I++                       
Sbjct: 220 FQKQLLRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIA---------------------- 257

Query: 307 MSYCPAGDLLA---AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLK 363
           M Y     L A    +++R GR+   ++ +I   V+  + YLHE  +IHRD+K +NILL 
Sbjct: 258 MEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLN 317

Query: 364 YSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDG 423
                           +   ++L DFG+  +  N+ + T   G+  Y++PE + G PY  
Sbjct: 318 ----------------EDGQVKLCDFGVSGEAVNS-LATTFTGTSYYMAPERIQGQPYS- 359

Query: 424 HLSDTWALGVILYSLFEDRLPFDP 447
              D W+LG+ +  + +   PF P
Sbjct: 360 VTCDVWSLGLTILEVAQGHFPFGP 383

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 63/112 (56%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            IF ++V  +K+LH+  I+HRD+K EN+++           DS     + F++L DFG   
Sbjct: 1060 IFKQIVSGIKHLHDQGIVHRDIKDENVIV-----------DS-----KGFVKLIDFGSAA 1103

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             +++        G+ DY +PE+L G PY+G   D WA+G++LY+L     PF
Sbjct: 1104 YVKSGPF-DVFVGTIDYAAPEVLGGNPYEGKSQDIWAIGILLYTLIYKENPF 1154

>Scas_613.5
          Length = 517

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 143/311 (45%), Gaps = 53/311 (17%)

Query: 143 TEEALVNDSVDSDNYTKEPY--FPESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGS 200
           T E++V     S+   K+P   F  S ++T+K    I +   L  +D+ +L K    +GS
Sbjct: 160 TGESVVATKSASEVVFKKPQLGFTSSQNATKK----IVRTKQLSFFDKYVLGK---DLGS 212

Query: 201 GNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTREL 260
           G+++TV      +  N    Q    ++ +P++  + ++   S +++E           E 
Sbjct: 213 GHYATV-----KEGINKVTGQTVAVKIFHPQQNDDEKK---SKQFRE-----------ET 253

Query: 261 QVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVM 320
            +L  ++HP IV LL      F+   +P+    I+    L   D        G+L   ++
Sbjct: 254 NILMRIHHPNIVNLL----DFFI---EPVSKSQIQKYLVLDKID-------DGELFERIV 299

Query: 321 ARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF------DDINSFRD 374
            +   L     + IF ++++ +K+LH+ +IIHRD+K ENILL  +         +  + +
Sbjct: 300 KKTC-LRQDETKAIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDE 358

Query: 375 SPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
             I  +   +++ADFGL K     +     CG+  YV+PE+L    Y   + D W+ GVI
Sbjct: 359 DEIDIQ---VKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKV-DMWSAGVI 414

Query: 435 LYSLFEDRLPF 445
           LY       PF
Sbjct: 415 LYVCLCGFPPF 425

>Kwal_47.16761
          Length = 744

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 97/209 (46%), Gaps = 28/209 (13%)

Query: 257 TRELQVLKSLNHPCIVK------LLGINNPIFVTSKKPLCDLIIKTPRAL-PPCDM--IM 307
           T+ +  +K L+   IVK       +G  N +  T+ K  C  I+    +   P D+  + 
Sbjct: 356 TKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKS-CPFIVGLKFSFQTPADLYLVT 414

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            +   G+L    + + GR      +    E+VLA++YLHEN I++RDLK ENILL     
Sbjct: 415 DFMSGGELFWH-LQKEGRFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILL----- 468

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSD 427
           D N             I L DFGL K    +   T  CG+ +Y++PE+L+       + D
Sbjct: 469 DANG-----------NIALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDESGYTKMVD 516

Query: 428 TWALGVILYSLFEDRLPFDPPPNASARQR 456
            W+LGV+++ +     PF    N    Q+
Sbjct: 517 FWSLGVLIFEMCCGWSPFFAEDNQKMYQK 545

>Scas_720.94
          Length = 1683

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 84/283 (29%)

Query: 192  WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
            W+K   IG G F TV  Y  ++  N ++  +AVK +K              ++  +T+ +
Sbjct: 1361 WQKRNFIGGGTFGTV--YSAVNLDNGEI--LAVKEIK--------------IQDSKTMKK 1402

Query: 252  LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            +   +  E+ VL+ LNHP IV+  G+     V   K                ++ M YC 
Sbjct: 1403 IFPLVKEEMTVLEMLNHPNIVQYYGVE----VHRDK---------------VNIFMEYCE 1443

Query: 312  AGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
             G +  A +  +GR+E  ++ +++T E++  + YLH+  ++HRD+K ENILL ++     
Sbjct: 1444 GGSM--ASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFN----- 1496

Query: 371  SFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSED--------------------- 409
                         I+  DFG  +KI  N        S+                      
Sbjct: 1497 -----------GIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDM 1545

Query: 410  -----YVSPEILMGVPYDGHLS--DTWALGVILYSLFEDRLPF 445
                 Y++PE + G          D W+ G ++  +   R P+
Sbjct: 1546 LGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPW 1588

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 90/187 (48%), Gaps = 31/187 (16%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E ++L  LNH  IVKLL      FV   +PL    ++T        +++     G+L   
Sbjct: 203 ETKILMGLNHENIVKLL----ERFV---EPLSKSQVQTY-------LVLEKIQDGELFDK 248

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           ++ R  +L     + +F +++  +KYLH+ +IIHRD+K ENILL          R SP  
Sbjct: 249 IV-RKTKLHQDETRALFKQILAGLKYLHDRNIIHRDIKPENILLSI------RRRTSPDQ 301

Query: 379 CKQN---------FIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTW 429
            +            +++ADFGL K     +  T  CG+  YV+ E+L    Y   + D W
Sbjct: 302 VQLGPWDEDELDITVKIADFGLAKFTGEMQFTTTLCGTPSYVAAEVLTKTGYTSKV-DLW 360

Query: 430 ALGVILY 436
           + GV+LY
Sbjct: 361 SAGVLLY 367

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 40/193 (20%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  E+Q+ KS+ HP IV+        F    +   ++ I           ++  CP G +
Sbjct: 134 LLSEIQIHKSMKHPNIVQ--------FTDCFEDDTNVYI-----------LLEICPNGSV 174

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
           +  +  R    E   ++    +++ A++Y+H   +IHRDLKL NI     FD        
Sbjct: 175 MELLRQRKHLTEPE-VRFCMIQIIGAIRYMHSRRVIHRDLKLGNIF----FD-------- 221

Query: 376 PIYCKQNFIELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHL--SDTWALG 432
               K+  +++ DFGL   + N+ E     CG+ +Y++PE+L G  + GH    D W++G
Sbjct: 222 ----KEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG-KHTGHSYEVDIWSIG 276

Query: 433 VILYSLFEDRLPF 445
           V+LY+L   + PF
Sbjct: 277 VMLYALLFGKPPF 289

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 128/293 (43%), Gaps = 64/293 (21%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G G++STV  Y+ +D+S  +L  + V   K+    + V+ +      K TL+ L +   
Sbjct: 16  LGHGSYSTV--YKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIE---KNTLNLLAHG-- 68

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
                    NHP I+KL       F  S+                   ++ + P G+LL 
Sbjct: 69  ---------NHPGIIKLYYT----FHDSEN---------------LYFVLDFAPGGELLQ 100

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +  +    EAW  +    +++ A++Y+H   ++HRDLK EN+LL               
Sbjct: 101 LLQTQGRFNEAW-TKHFMCQLIDALEYIHGCKVVHRDLKPENLLL--------------- 144

Query: 378 YCKQNFIELADFGLCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
              +  + + DFG+   +   +N    ++  G+ +YVSPE+L+    +   SD WA+G +
Sbjct: 145 -SSEGKLMITDFGVASNLAATDNLSSTSSFVGTAEYVSPELLLQNKSN-FCSDIWAVGCM 202

Query: 435 LYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRW-YRLSDYKTNVGKQIV 486
           LY   +   PF         +   A   +I   D+ W Y +S + T++  +I+
Sbjct: 203 LYQFTQGTPPF-------RGENELAAFEKIVNLDYHWIYMVSQHITDLVSKIL 248

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 117/269 (43%), Gaps = 68/269 (25%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQI----NTSLRYKETLS 250
           +R +G G +  VLL  + D  + KL   A+K+LK  E L + + I    NT++       
Sbjct: 173 IRCLGEGAYGKVLL--VKDSLSSKL--YAMKQLKKAEILISEDSIEKDANTTVE-----K 223

Query: 251 RLENSLTRELQVLKSLNHPCIVKLL---GINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
           R+E +   E  +L  L HP IVKL      N+ ++                      +++
Sbjct: 224 RIERTFA-ERTILSQLEHPNIVKLFYSFHDNHKLY----------------------LVL 260

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            Y P G+L    +   G L+   +     E+  A+K+LH   I++RDLK EN LL     
Sbjct: 261 QYIPGGELFYH-LKEQGTLDEGTVAFYAAELSCALKFLHSKGIVYRDLKPENCLLN---- 315

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKI-----------ENNEMCTARCGSEDYVSPEIL 416
                       ++  + L DFGL KK            EN     +  G+ +Y +PEIL
Sbjct: 316 ------------ERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLYSIIGTPEYCAPEIL 363

Query: 417 MGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            G PY  +  D ++LG ++Y +   + PF
Sbjct: 364 AGEPYTQN-CDWYSLGCLVYDMLIGKPPF 391

>Scas_721.124
          Length = 684

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 71/137 (51%), Gaps = 18/137 (13%)

Query: 310 CPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDI 369
           C  G  L   + + GR +    +    E++ A++ LH  ++I+RDLK ENILL Y     
Sbjct: 430 CINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLDY----- 484

Query: 370 NSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
                      Q  I L DFGLCK  +++++     CG+ +Y++PE+L+G  Y   + D 
Sbjct: 485 -----------QGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGQGYT-KVVDW 532

Query: 429 WALGVILYSLFEDRLPF 445
           W LGV+LY +     P+
Sbjct: 533 WTLGVLLYEMLTGLPPY 549

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (52%), Gaps = 19/142 (13%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++++   G+L    + + GR +    +    E++ A+  LH+  +++RDLK ENILL Y
Sbjct: 422 FVLAFINGGELFYH-LQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDY 480

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDG 423
                           Q  I L DFGLCK  +++++     CG+ +Y++PE+L+G+ Y  
Sbjct: 481 ----------------QGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTK 524

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
            + D W LGV+LY +     P+
Sbjct: 525 AV-DWWTLGVLLYEMLTGLPPY 545

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 114/269 (42%), Gaps = 70/269 (26%)

Query: 188  RPLLWKKVRPIGSGNFSTVLLY------ELMDQSNPKLKQVAVKRLKYPEELSNVEQINT 241
            +   W K   IG G+F  V L       E+M      +KQV V +     EL        
Sbjct: 1147 KEFAWMKGEMIGKGSFGAVYLSLNITTGEMM-----AVKQVEVPKYGTQNEL-------- 1193

Query: 242  SLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLG--INNPIFVTSKKPLCDLIIKTPRA 299
                   +  +  +L  E+  LK L+H  IV+ LG  I   I+                 
Sbjct: 1194 -------VKDMVEALKSEVATLKDLDHLNIVQYLGSEIRGNIY----------------- 1229

Query: 300  LPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLEN 359
                 + + Y  AG  + +++   GR +  LI+ + T+V+  +KYLH   I+HRD+K +N
Sbjct: 1230 ----SLFLEYV-AGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLKYLHSKGILHRDMKADN 1284

Query: 360  ILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIEN---NEMCTARCGSEDYVSPEIL 416
            +LL           D    CK     ++DFG+ KK +N   N   T R G+  +++PE++
Sbjct: 1285 LLL-----------DEDGICK-----ISDFGISKKSKNIYSNSDMTMR-GTVFWMAPEMV 1327

Query: 417  MGVPYDGHLSDTWALGVILYSLFEDRLPF 445
                      D W+LG ++  +F  + P+
Sbjct: 1328 DTKQGYSAKVDIWSLGCVVLEMFAGKRPW 1356

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 63/112 (56%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            IF +VV  +K+LH+  I+HRD+K EN+++           DS     + F+++ DFG   
Sbjct: 1210 IFKQVVAGIKHLHDQGIVHRDIKDENVIV-----------DS-----KGFVKIIDFGSAA 1253

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             +++        G+ DY +PE+L G PY+G   D WA+G++LY++     PF
Sbjct: 1254 YVKSGPF-DVFVGTIDYAAPEVLGGNPYEGQPQDIWAIGILLYTVVFKENPF 1304

>Scas_640.16
          Length = 505

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 102/223 (45%), Gaps = 42/223 (18%)

Query: 226 RLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTS 285
           +LK+ +++  ++ +NT      T    +  + RELQ  KS     IV+  G+ N +  +S
Sbjct: 228 KLKHGKKVFALKIVNTL----NTDPEFQKQIFRELQFNKSFKSDYIVRYYGMFNDVNSSS 283

Query: 286 KKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA---VMARNGRLEAWLIQRIFTEVVLAV 342
                              + M Y     L A    +++R GR+   ++ +I   V+  +
Sbjct: 284 -----------------IYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGL 326

Query: 343 KYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCT 402
            YLHE  +IHRD+K +NIL                + ++  ++L DFG+  +  N+ + T
Sbjct: 327 SYLHEQKVIHRDIKPQNIL----------------FNEKGQVKLCDFGVSGEAVNS-LAT 369

Query: 403 ARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
              G+  Y++PE + G PY     D W+LG+ +  + + R PF
Sbjct: 370 TFTGTSFYMAPERIQGQPYS-VTCDIWSLGLTILEVAQGRFPF 411

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 109/249 (43%), Gaps = 63/249 (25%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQ-VAVKRLKYPEELSNVEQINTSLRYKETLSRLENSL 256
           IG G++  V        +N K  Q VA+K + Y ++   V+                  +
Sbjct: 28  IGRGSYGVV-----YKATNKKTAQEVAIKEVNYQDDDELVD------------------I 64

Query: 257 TRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLL 316
             E+ +LK+LNH  IVK  G     F+  +  L               +I+ YC  G L 
Sbjct: 65  MSEIDLLKNLNHINIVKYHG-----FIQKQHNLY--------------IILEYCAKGSL- 104

Query: 317 AAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSP 376
             +++RN  +     +    + +  + YLHE  +IHRD+K  NILL           DS 
Sbjct: 105 KNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGVIHRDIKAANILL-----------DS- 152

Query: 377 IYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILY 436
               +N ++LADFG+  K+ N  M  A  GS ++++PEI+ G      LSD W+LG  + 
Sbjct: 153 ----ENVVKLADFGVSTKVNNTAMTLA--GSLNWMAPEII-GNRGASTLSDIWSLGATVV 205

Query: 437 SLFEDRLPF 445
            L     PF
Sbjct: 206 ELLTGNPPF 214

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 19/109 (17%)

Query: 335 FTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKK 394
           F ++  AV+YLH   I+HRDLKLENI+L                C+   I+L DFG+   
Sbjct: 147 FLQICEAVQYLHSRGIVHRDLKLENIML------------CADACQ---IKLIDFGVAVN 191

Query: 395 IEN----NEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLF 439
            ++       C   CG+E  ++PE+L  + Y G  +D W++G+I++ +F
Sbjct: 192 RQDPQSLTTACKGMCGTEALMAPEVLGSISYVGEYADCWSVGIIMFQIF 240

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 97/209 (46%), Gaps = 28/209 (13%)

Query: 257 TRELQVLKSLNHPCIVK------LLGINNPIFVTSKKPLCDLIIKTPRAL-PPCDM--IM 307
           T+ +  +K L+   IVK       +G  N +  T+ K  C  I+    +   P D+  + 
Sbjct: 326 TKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKS-CPFIVGLKFSFQTPTDLYLVT 384

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            +   G+L    + + GR      +    E+VLA++YLH+N I++RDLK ENILL     
Sbjct: 385 DFLSGGELFWH-LQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILL----- 438

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSD 427
           D N             I L DFGL K    +   T  CG+ +Y++PE+L+       + D
Sbjct: 439 DANG-----------NIALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDETGYTKMVD 486

Query: 428 TWALGVILYSLFEDRLPFDPPPNASARQR 456
            W+LGV+++ +     PF    N    Q+
Sbjct: 487 FWSLGVLIFEMCCGWSPFFAEDNQKMYQK 515

>Kwal_0.96
          Length = 427

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 89/191 (46%), Gaps = 35/191 (18%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  EL +L+ L+HP IVK        +  SK                  ++      G+L
Sbjct: 92  LYDELSILQKLDHPNIVKF-----KDWFESKDKFY--------------IVTQLATGGEL 132

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++ + G+       RI  +++ AV+YLH  +I+HRDLK EN+L       +    DS
Sbjct: 133 FDRIL-KQGKFTEEDAVRIVYQILKAVEYLHSRNIVHRDLKPENLLY------LTEAADS 185

Query: 376 PIYCKQNFIELADFGLCKKIEN-NEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
            +        L DFG+ K+++N +E+     GS  YV+PE++    + G   D W+LGV+
Sbjct: 186 QLV-------LGDFGIAKELKNDDELIHKAAGSMGYVAPEVVTTSGH-GKPCDIWSLGVV 237

Query: 435 LYSLFEDRLPF 445
            Y+L     PF
Sbjct: 238 TYTLLCGYSPF 248

>Kwal_26.7154
          Length = 1213

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            IF ++   +K LH+N I+HRD+K EN+++     D N F           +++ DFG   
Sbjct: 1067 IFKQIASGIKNLHDNGIVHRDIKDENVIV-----DCNGF-----------VKIVDFGSAA 1110

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             +++        G+ DY +PE+L G PY+G   D WA+GV+LY++     PF
Sbjct: 1111 YVKSGPF-DVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVLLYTIIYKENPF 1161

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 119/275 (43%), Gaps = 74/275 (26%)

Query: 196 RPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENS 255
           + IG G+F+TV  Y     ++PK   +AVK +             + L+ K+ L  LE  
Sbjct: 15  KEIGKGSFATV--YRGHVTTDPK-SHIAVKAVA-----------RSKLKNKKLLENLE-- 58

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
              E+ +LK + HP IV L                   I   R      ++M YC  GDL
Sbjct: 59  --IEIAILKKIKHPHIVGL-------------------IDCERTTTDFYLVMDYCALGDL 97

Query: 316 LAAVMAR------------------------NGRLEAWLIQRIFTEVVLAVKYLHENSII 351
              +  R                        NG   A+++  +  ++  A+K+L   +++
Sbjct: 98  TFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYL-QQLASALKFLRSKNLV 156

Query: 352 HRDLKLENILLKYSFDDINSFRDSPIYCKQNFI--------ELADFGLCKKIENNEMCTA 403
           HRD+K +N+LL      + ++RDS  + +  ++        ++ADFG  + + +  +   
Sbjct: 157 HRDIKPQNLLLATP---LTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAET 213

Query: 404 RCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSL 438
            CGS  Y++PEIL    Y+   +D W++G +L+ +
Sbjct: 214 LCGSPLYMAPEILNYQKYNAK-ADLWSVGTVLFEM 247

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 122/286 (42%), Gaps = 70/286 (24%)

Query: 192  WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
            W+K   IGSG+F TV     +D  +     +AVK +K              ++  +++ +
Sbjct: 1259 WQKRSFIGSGSFGTVYSAVNLDTGDI----LAVKEIK--------------IQDAKSMKQ 1300

Query: 252  LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            +  SL  E++V++ LNHP IV+  G+     V   K                ++ M +C 
Sbjct: 1301 IFPSLKEEMRVMEILNHPNIVQYYGVE----VHRDK---------------VNIFMEFCE 1341

Query: 312  AGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
               L  A +  +GR+E  ++ +++T +++  +  LH++ ++HRD+K ENILL        
Sbjct: 1342 GSSL--ASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDIKPENILLD------- 1392

Query: 371  SFRDSPIYCKQNFIELADFGLCKKIENN-------EMCTARCGSED------YVSPEILM 417
                     +   I+  DFG  K I  N       +      G +D      Y++PE + 
Sbjct: 1393 ---------RNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVT 1443

Query: 418  GVPYDGHLS-DTWALGVILYSLFEDRLPFDPPPNASARQRSRATSH 462
            G  +    S D W+LG ++  +   R P+    N  A     A  H
Sbjct: 1444 GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGH 1489

>Scas_580.6
          Length = 1015

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 77/143 (53%), Gaps = 21/143 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM YC  G L +  + R G+++   I  I  E+++A+KY+H++++IHRD+K  N+L+  
Sbjct: 111 IIMEYCAGGSLRS--LLRPGKIDEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLI-- 166

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEM-CTARCGSEDYVSPEILM-GVPYD 422
                           +  ++L DFG+  ++  + +      G+  +++PE++M GV YD
Sbjct: 167 --------------TNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYD 212

Query: 423 GHLSDTWALGVILYSLFEDRLPF 445
             + D W+LG+  Y +     P+
Sbjct: 213 TKV-DIWSLGITAYEIATGNPPY 234

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 95/208 (45%), Gaps = 26/208 (12%)

Query: 257 TRELQVLKSLNHPCIVK------LLGINNPIFVTSKKPLCDLIIKTPRALPPCDM--IMS 308
           T+ +  +K L+   IVK       +G  N +  TS K    ++        P D+  +  
Sbjct: 362 TKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKASPFIVGLKFSFQTPTDLYLVTD 421

Query: 309 YCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDD 368
           Y   G+L    + R GR      +    E+VLA+++LH+N I++RDLK ENILL     D
Sbjct: 422 YMSGGELFWH-LQREGRFTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL-----D 475

Query: 369 INSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
            N             I L DFGL K    +   T  CG+ +Y++PE+L+       + D 
Sbjct: 476 ANG-----------NIALCDFGLSKADLKDRTNTF-CGTTEYLAPELLLDESGYTKMVDF 523

Query: 429 WALGVILYSLFEDRLPFDPPPNASARQR 456
           W+LGV+++ +     PF    N    Q+
Sbjct: 524 WSLGVLIFEMCCGWSPFYAEDNQKMYQK 551

>Scas_700.35
          Length = 439

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 87/198 (43%), Gaps = 38/198 (19%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            +  L REL+  KS     IV   G+ N     S                   + M Y  
Sbjct: 190 FQKQLFRELEFNKSFKSNYIVTYYGMFNDTLNGS-----------------IYIAMEYMG 232

Query: 312 AGDL---LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDD 368
              L     ++++R GR+   ++ +I   V+  + YLHE  IIHRD+K +NILL      
Sbjct: 233 GQSLDTIYKSLLSRGGRIGEKILGKIAESVLRGLSYLHERKIIHRDIKPQNILLN----- 287

Query: 369 INSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
                      ++  ++L DFG+  +  N+ + T   G+  Y++PE + G PY     D 
Sbjct: 288 -----------EEGEVKLCDFGVSGEAVNS-LATTFTGTSFYMAPERIQGHPYS-VTCDV 334

Query: 429 WALGVILYSLFEDRLPFD 446
           W+LG+ +  + + R PFD
Sbjct: 335 WSLGLTILEVAQGRFPFD 352

>KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 292

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 80/186 (43%), Gaps = 39/186 (20%)

Query: 257 TRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLL 316
            +E ++LK LNH CI++ L  N                K     P     + Y     +L
Sbjct: 61  VKEYELLKKLNHKCIIEALDCNKR--------------KHTITFPYYSYTVLYLMKMSML 106

Query: 317 AAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSP 376
                R      W     F ++   + YLH ++I+HRDLKLENI++  S  +I       
Sbjct: 107 PTFEER----ALW-----FCQICEGIAYLHSHNIVHRDLKLENIMVDESLCNI------- 150

Query: 377 IYCKQNFIELADFGLCKKIE-NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVIL 435
                   ++ DFG    +  N E C    GSE  ++PE+   + Y+G   D W+LG+++
Sbjct: 151 --------KIIDFGSAVDVGPNKEACHGIRGSEQLMAPEVFQRLKYEGTPVDMWSLGIMM 202

Query: 436 YSLFED 441
           +  F +
Sbjct: 203 FEFFNN 208

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 113/261 (43%), Gaps = 54/261 (20%)

Query: 188  RPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKE 247
            R   W K   IG G+F  V L   +       + +AVK+++ P+  S            E
Sbjct: 1120 REFAWIKGEMIGKGSFGAVYLGLNVTTG----EMMAVKQVEVPKFGSQ----------DE 1165

Query: 248  TLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
            T      +L  E+  LK L+H  IV+ LG  N   + S                   + +
Sbjct: 1166 TTVNNAEALISEVSTLKDLDHLNIVQYLGFENKNCIYS-------------------LFL 1206

Query: 308  SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
             Y  AG  + +++   G  +  LI+ + T+V+  + YLH   I+HRD+K +N+LL     
Sbjct: 1207 EYV-AGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLL----- 1260

Query: 368  DINSFRDSPIYCKQNFIELADFGLCKKIEN---NEMCTARCGSEDYVSPEILMGVPYDGH 424
                  D+   CK     ++DFG+ +K  N   N   T R G+  +++PE++        
Sbjct: 1261 ------DNDGVCK-----ISDFGISRKSNNIYSNSEMTMR-GTVFWMAPEMVDTTQGYSA 1308

Query: 425  LSDTWALGVILYSLFEDRLPF 445
              D W+LG ++  +F  + P+
Sbjct: 1309 KVDIWSLGCVVLEMFAGKRPW 1329

>Scas_703.5
          Length = 749

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 96/209 (45%), Gaps = 28/209 (13%)

Query: 257 TRELQVLKSLNHPCIVK------LLGINNPIFVTSKKPLCDLIIKTPRAL-PPCDM--IM 307
           T+ +  +K L+   IVK       +G  N I VT+       I+    +   P D+  + 
Sbjct: 366 TKRIYAMKVLSKKVIVKKNEVAHTIGERN-ILVTTATKASPFIVGLKFSFQTPTDLYLVT 424

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            +   G+L    + + GR      +    E+VLA++YLH+N I++RDLK ENILL     
Sbjct: 425 DFMSGGELFWH-LQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILL----- 478

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSD 427
           D N             I L DFGL K  +  +     CG+ +Y++PE+L+       + D
Sbjct: 479 DANG-----------NIALCDFGLSKA-DLKDRTNTFCGTTEYLAPELLLDEAGYTKMVD 526

Query: 428 TWALGVILYSLFEDRLPFDPPPNASARQR 456
            W+LGV+++ +     PF    N    Q+
Sbjct: 527 FWSLGVLIFEMCCGWSPFFAEDNQKMYQK 555

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 137/333 (41%), Gaps = 55/333 (16%)

Query: 192 WKKVRPIGSGNFSTVLLYELM---DQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKET 248
           +K +  IG G FS V     +   DQ+   +K +  K +     L   ++I  S R    
Sbjct: 121 YKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSR---- 176

Query: 249 LSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMS 308
                          K LN   I KL+  NNP         C   I    +     ++  
Sbjct: 177 --------------KKVLNEVAIHKLVSKNNP--------HCTKFIAFQESANYYYLVTE 214

Query: 309 YCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLK----Y 364
               G++   ++      E  L + + T+V +A+K++H   I+HRD+K EN+L +    Y
Sbjct: 215 LVTGGEIFDRIVQLTCFSED-LARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFY 273

Query: 365 SFD-DI---NSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVP 420
             D D+   + F           ++L DFGL KK+ NN   T  CG+ +YV+ E+     
Sbjct: 274 GLDGDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTP-CGTIEYVASEVFTSKR 332

Query: 421 YDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWR-----WYRLS 475
           Y   + D W++G +L++L     PF         +  +    +I+R D+      W  +S
Sbjct: 333 YSMKV-DMWSIGCVLFTLLCGYPPF-------YEKNEKTLLKKISRGDYEFLAPWWDNIS 384

Query: 476 DYKTNVGKQIVENTLTRKNQRWSINEIYESPFV 508
               N    ++E      N+R+ I++    P++
Sbjct: 385 SGAKNAVTHLLE---VDPNKRYDIDDFLNDPWL 414

>Kwal_14.1273
          Length = 415

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 111/260 (42%), Gaps = 60/260 (23%)

Query: 191 LWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLS 250
           ++ ++  I SG+FSTV  Y   D    + + VA+K LK P E                 S
Sbjct: 1   MYSQLVKIQSGSFSTV--YRAYDTE--RARDVALKILKKPSE-------------PAMAS 43

Query: 251 RLENSLTRELQVLKSLN--HPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMS 308
           +L   +  EL+VL+ L   HP +  LL          ++  C +             +M 
Sbjct: 44  KLATLVGSELEVLRVLGTGHPNVCALLDFY-------ERETCYV------------FVME 84

Query: 309 YCPAGDLLAAVMA---RNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYS 365
           Y   GDL   +      +       + R+  ++  A++Y H   I HRD+K EN+LL  +
Sbjct: 85  YAARGDLYDVIRGWKRHSAERVPVELARVVLQLCSAIEYAHSCGIAHRDIKPENVLLDSA 144

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
            +                ++LAD+GL  ++  +  C  R G+E Y++PE     P+D  L
Sbjct: 145 GN----------------VKLADWGLSTRMRVS--CDTRIGTEKYLAPEAYAS-PHDTFL 185

Query: 426 SDTWALGVILYSLFEDRLPF 445
           +D W+LGV L  +     PF
Sbjct: 186 ADFWSLGVTLLFVMFGACPF 205

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 85/195 (43%), Gaps = 37/195 (18%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           +E    RE+++  SL HP + +L G     F   K+                 ++M Y  
Sbjct: 150 IEKQFRREVEIQSSLRHPNLTQLYGY----FHDEKR---------------VYLLMEYLV 190

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L   +  R+      +      ++  A+ Y+HE +I+HRD+K ENI++ ++      
Sbjct: 191 NGELYKHLKGRS-HFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGFN------ 243

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                     N I+L DFG              CG+ DY+SPE++    Y+  + D WAL
Sbjct: 244 ----------NTIKLTDFGWSVITPKGSKRKTLCGTVDYLSPELIRSREYNEKV-DVWAL 292

Query: 432 GVILYSLFEDRLPFD 446
           GV+ Y L     PF+
Sbjct: 293 GVLTYELLVGSPPFE 307

>Kwal_55.20326
          Length = 750

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 122/273 (44%), Gaps = 53/273 (19%)

Query: 189 PLLWKKVRPIGSGNFSTVLLY------ELMDQSNPKLK--QVAVKRLKYPEELS---NVE 237
           P  W K   IGSG+F +V L       ELM     +L+   VA   +  P+E+    N  
Sbjct: 455 PKNWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQN 514

Query: 238 QINTSLRYKETLSR-LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKT 296
              ++++    + R + ++L  E+ +LK L H  IV   G                   +
Sbjct: 515 ANGSAVKNSSQVHRKMVDALQHEMGLLKELQHENIVTYYG-------------------S 555

Query: 297 PRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLK 356
            +     ++ + Y P G + ++++   G  E  LI+    ++++ + YLH   IIHRD+K
Sbjct: 556 SQEGGNLNIFLEYVPGGSV-SSMLNSYGPFEEPLIRNFTRQILIGLSYLHRKDIIHRDIK 614

Query: 357 LENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIEN-NEMCTARC---GSEDYVS 412
             NIL+     DI           +  +++ DFG+ KK+   N+    R    GS  +++
Sbjct: 615 GANILI-----DI-----------KGCVKITDFGISKKLSPLNQQQNKRASLQGSVYWMA 658

Query: 413 PEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           PE++  V      +D W++G ++  +F  + PF
Sbjct: 659 PEVVKQV-VTTKKADIWSVGCVIIEMFTGKHPF 690

>Scas_618.8
          Length = 427

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 109/253 (43%), Gaps = 57/253 (22%)

Query: 196 RPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENS 255
           + +G+G+F  V   E   +SN +  +VA+K L       N  Q+                
Sbjct: 31  KTLGAGSFGVV--REATKKSNNE--EVAIKILLKKALEGNQVQLQM-------------- 72

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  EL +LK L+HP IV+        F T  K                 ++      G+L
Sbjct: 73  LYDELTILKKLHHPNIVEF----KNWFETDDKIY---------------IVTQLATGGEL 113

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++ + GR       +I  +++ AV+Y+H   I+HRDLK EN+L       +    DS
Sbjct: 114 FDRII-KKGRFSEDDAVKILIQILSAVEYIHSRDIVHRDLKPENLLY------LTEKEDS 166

Query: 376 PIYCKQNFIELADFGLCKKIENNEMCTAR-CGSEDYVSPEILMGVPYDGHLS--DTWALG 432
            +        +ADFG+ K+++  E    +  GS  YV+PE+L     DGH    D W++G
Sbjct: 167 ELV-------IADFGIAKELKKGEQLIFKAAGSLGYVAPEVLT---VDGHGKPCDIWSIG 216

Query: 433 VILYSLFEDRLPF 445
           VI Y+L      F
Sbjct: 217 VITYTLLSGYAAF 229

>Scas_675.2
          Length = 527

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 74/149 (49%), Gaps = 22/149 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHEN-SIIHRDLKLENILLK 363
           MIM     GDL   +    G +++ + Q  F ++V A+ YLHE   + HRD+K ENILL 
Sbjct: 93  MIMEMADGGDLFDKIEPDVG-VDSEVAQFYFQQLVRAISYLHEECGVAHRDIKPENILLD 151

Query: 364 YSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNE----MCTARCGSEDYVSPEILMGV 419
                           K   ++LADFGL  +    +    + T + GS  Y++PEIL   
Sbjct: 152 ----------------KNGNLKLADFGLSSQYRRKDGTLRISTDQRGSPPYMAPEILHSR 195

Query: 420 PYDGHLSDTWALGVILYSLFEDRLPFDPP 448
            Y  H +D W++G++L+ L     P++ P
Sbjct: 196 GYYAHSTDIWSIGILLFVLLTGETPWELP 224

>CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces
           cerevisiae YKL139w CTK1 carboxy-terminal domain kinase,
           hypothetical start
          Length = 553

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 84/186 (45%), Gaps = 39/186 (20%)

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           RE+++L+S NH  +  +      I V S+K +               MI  Y    DL  
Sbjct: 267 REIKLLQSFNHENVSTI----KEIMVESQKIIY--------------MIFEYAD-NDLGG 307

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            ++ +   + A   + IF +++  ++YLH+N+I+HRD+K  NIL+               
Sbjct: 308 LLLNKQININAAQSKHIFKQILHGIEYLHDNNILHRDIKGSNILID-------------- 353

Query: 378 YCKQNFIELADFGLCKKIENNEMC----TARCGSEDYVSPEILMGVPYDGHLSDTWALGV 433
              Q  ++L DFGL +KI+ N       T R  +  Y  PE+L+G    G   D W  G 
Sbjct: 354 --NQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPPELLLGTTNYGPEVDMWGCGC 411

Query: 434 ILYSLF 439
           IL  LF
Sbjct: 412 ILVELF 417

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 121/260 (46%), Gaps = 47/260 (18%)

Query: 183 LDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTS 242
           L  +D+ LL K    +GSG+++ V      +  N    +    ++ +P++ ++ ++ N  
Sbjct: 187 LSFFDKYLLGK---DLGSGHYAIV-----KEAKNKTTGETVAVKIFHPQQ-NDDQKKNKQ 237

Query: 243 LRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPP 302
            R              E  +L  ++HP IV LL      FV   +P+    I+    L  
Sbjct: 238 FR-------------EETTILMKIHHPNIVNLLDS----FV---EPISKTQIQKYLVLEK 277

Query: 303 CDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILL 362
            D        G+L   ++ +   L     + IF +++  +KYLH  +IIHRD+K ENILL
Sbjct: 278 ID-------DGELFDRIVKKTS-LPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILL 329

Query: 363 ----KYSFDD--INSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEIL 416
               + S D+  +  + +  I  +   +++ADFGL K     +     CG+  YV+PE+L
Sbjct: 330 NIRRRQSPDERQLGPWDEDEIDIQ---VKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVL 386

Query: 417 MGVPYDGHLSDTWALGVILY 436
           +   Y   + D W+ GVILY
Sbjct: 387 VKKGYTSKV-DLWSAGVILY 405

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 114/270 (42%), Gaps = 58/270 (21%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPE------ELSNVEQINTSLRY 245
           +K VR +G G +  VLL  + DQ   KL   A+K+LK  E      E  + +  +  L  
Sbjct: 146 FKPVRVLGRGAYGKVLL--VKDQLTSKL--FAMKQLKKAEIVVTAPEEESTDGEDAVLLP 201

Query: 246 KETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDM 305
                R+E +   E  +L  L HP IVKL       F    K                 +
Sbjct: 202 AVVEKRVERTFA-ERTILSQLEHPNIVKLF----YSFHDHHKLY---------------L 241

Query: 306 IMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYS 365
           ++ Y P G+L    +   G L+   +     E+  A+K+LH   I++RDLK EN LL   
Sbjct: 242 VLQYIPGGELFYH-LKEQGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLL--- 297

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIENN----------EMCTARCGSEDYVSPEI 415
            DD            +  + L DFGL K+  N           E   +  G+ +Y +PEI
Sbjct: 298 -DD------------KGHLVLTDFGLSKRGVNQADSPLGGEQVEELYSIIGTPEYCAPEI 344

Query: 416 LMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           L G PY  +  D ++LG + Y +   + PF
Sbjct: 345 LCGQPYTQN-CDWYSLGSLTYDMLIGKPPF 373

>Scas_618.15
          Length = 620

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 101/222 (45%), Gaps = 26/222 (11%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLK- 363
           ++  Y   G++   ++ R       L + +  ++  AVK+LH   IIHRD+K EN+L + 
Sbjct: 254 IVQEYLHGGEIYDQIV-RLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEP 312

Query: 364 -----------------YSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCG 406
                            ++  D   FR +        ++L DFGL K++ + E     CG
Sbjct: 313 IQHIPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSKQL-STETTNTPCG 371

Query: 407 SEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIAR 466
           +  Y +PE++    YD  + D W +G +LY+L     PF    + S  ++ R   +    
Sbjct: 372 TISYAAPELIRNHQYDNKI-DLWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLS 430

Query: 467 FDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFV 508
             W W  +S    N  K ++E  +++   R++I+++   P++
Sbjct: 431 -PW-WDEISSGAKNCVKHLLEVDVSK---RYNIDDLLADPWL 467

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 123/300 (41%), Gaps = 65/300 (21%)

Query: 188 RPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKE 247
           +P  +K +  IG G+F +V           K+  V   +L           +   ++Y  
Sbjct: 23  QPNEFKVLEEIGRGSFGSV----------RKVLHVPTSKL----------MVRKEIKYGH 62

Query: 248 TLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
             S+    L  E  +L  L H  IV+    ++     S +    +       L    + M
Sbjct: 63  MNSKERQQLIAECTILAGLRHENIVEFYNWDH----ASSRTGNSVDYGNGEVLY---LYM 115

Query: 308 SYCPAGDLLAAVMARNGRLEAWL----IQRIFTEVVLAVKYLHEN--------------- 348
            YC  GDL   +    G +  ++    I RI  +++LA+   H +               
Sbjct: 116 EYCSCGDLSQMIKHYKG-MRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISK 174

Query: 349 -----------SIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIEN 397
                      S+IHRDLK  NI L  + D +   R S  Y K   ++L DFGL K +++
Sbjct: 175 SAIESEAGKVTSVIHRDLKPGNIFL--TGDGVGG-RGSVDYSKVE-VKLGDFGLAKSLQS 230

Query: 398 N-EMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQR 456
             E  T   G+  Y+SPE+LM  PY   LSD W+LG ++Y L   R+PF P  N    QR
Sbjct: 231 AIEFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVIYELCALRVPF-PARNFMELQR 288

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 126/281 (44%), Gaps = 65/281 (23%)

Query: 187 DRPLLWKKVRPIGSGNFSTVLL------YELMDQSNPKLKQVAV-----------KRLKY 229
           + P  W K   IGSG+F +V L       ELM     +LK  AV           K+   
Sbjct: 434 EAPKSWLKGARIGSGSFGSVYLGMNAETGELMAVKQVELKPTAVTAGVVSIADESKKAHS 493

Query: 230 PEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPL 289
           P    N    NTS  +++ +    ++L  E+ +LK L+H  IV   G             
Sbjct: 494 PGG-GNTAVKNTSQIHRKMI----DALQHEMNILKELHHENIVTYYG------------- 535

Query: 290 CDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENS 349
                 + +     ++ + Y P G  +++++   G  +  L++    ++++ + YLH+ +
Sbjct: 536 ------SSQEGGNLNIFLEYVPGGS-VSSMLNNYGPFDEPLVKNFTRQILIGLAYLHKRN 588

Query: 350 IIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-----ENNEMCTAR 404
           IIHRD+K  NIL+     DI           +  +++ DFG+ KK+     + N+  + +
Sbjct: 589 IIHRDIKGANILI-----DI-----------KGGVKITDFGISKKLSPLNKQQNKRASLQ 632

Query: 405 CGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            GS  +++PE++  V      +D W++G ++  +F  + PF
Sbjct: 633 -GSVYWMAPEVVKQV-VTTEKADIWSVGCVIVEMFTGKHPF 671

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 79/175 (45%), Gaps = 34/175 (19%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            +M   P G+LL  +  +    EAW  +    ++V  V+Y+H   +IHRDLK EN+LL  
Sbjct: 88  FVMDLAPGGELLQLLRRQRVFSEAW-ARHYMCQLVDTVEYIHSMGVIHRDLKPENVLLD- 145

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKI-------ENNEMCTARCGSEDYVSPEILM 417
                          K+  + +ADFG    +       + ++  T+  G+ +YVSPE+L+
Sbjct: 146 ---------------KEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVSPELLL 190

Query: 418 -GVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRW 471
               Y  + SD WALG +LY   +   PF         Q    T  +I   D+ W
Sbjct: 191 ENKSY--YSSDVWALGCMLYQFLQGTPPFR-------GQNEMETFEQIVNLDYTW 236

>Scas_717.69
          Length = 674

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 18/137 (13%)

Query: 310 CPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDI 369
           C  G  L   + + GR E    +    E++ A++ LH   +I+RDLK ENILL Y     
Sbjct: 424 CINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDY----- 478

Query: 370 NSFRDSPIYCKQNFIELADFGLCK-KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
                      Q  I L DFGLCK  +++ +     CG+ +Y++PE+L+   Y   + D 
Sbjct: 479 -----------QGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY-SKVVDW 526

Query: 429 WALGVILYSLFEDRLPF 445
           W LG++LY +     P+
Sbjct: 527 WTLGILLYEMLTGLPPY 543

>Kwal_0.307
          Length = 490

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 101/251 (40%), Gaps = 55/251 (21%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQV-AVKRLKYPEELSNVEQINTSLRYKETLSRLENSL 256
           +G G F  V +     Q +P  +++ AVK  +               +  E+  +    L
Sbjct: 273 VGKGAFGVVRICHKKSQDDPNGEKLYAVKEFRR--------------KPSESPEKYSRRL 318

Query: 257 TRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLL 316
           T E  +  SL H  I+  L     +F  +K   C               +M YC  GDL 
Sbjct: 319 TSEFCISSSLKHTNIIMTL----DLFQDAKGDYCQ--------------VMEYCFGGDLF 360

Query: 317 AAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSP 376
             ++A  G+LE       F +++  V Y+H+  + HRDLK EN+LL              
Sbjct: 361 TLIIA-AGKLEYMEADCFFKQLIRGVVYMHDMGVCHRDLKPENLLLS------------- 406

Query: 377 IYCKQNFIELADFG--LCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                  +++ DFG   C ++   ++  +    CGS  Y++PE  +   +D    D WA 
Sbjct: 407 ---SNGTLKITDFGNSECFRMAWEKDIHLSGGVCGSSPYIAPEEYVHEEFDPRPVDIWAC 463

Query: 432 GVILYSLFEDR 442
           GVI  ++   R
Sbjct: 464 GVIYMAMRTGR 474

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 89/197 (45%), Gaps = 41/197 (20%)

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           L   L RE+ +   ++HP I+KL       F   K+                 ++M +  
Sbjct: 141 LLKQLKREVDIQLGMDHPNIIKLYAH----FHDEKR---------------VYLLMEHSI 181

Query: 312 AGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINS 371
            G+L  + +  NG     L      ++  A+ Y+H+  IIHRD+K EN+L+   FD    
Sbjct: 182 NGELYKS-LKNNGPFNDVLASHYIYQIADALHYMHKKRIIHRDVKPENVLI--GFD---- 234

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTAR--CGSEDYVSPEILMGVPYDGHLSDTW 429
                     N ++LADFG    I N E    +  CG+ DY+SPE++    YD  + D W
Sbjct: 235 ----------NVVKLADFGWS--ILNPEGSKRKTLCGTIDYLSPEMITPREYDEQV-DVW 281

Query: 430 ALGVILYSLFEDRLPFD 446
           ALGV+ Y L     PF+
Sbjct: 282 ALGVLAYELVVGVPPFE 298

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 49/188 (26%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLK 363
            ++ + P G+LL+ +       + W   R FT +++ A++++H + IIHRDLK EN+LL 
Sbjct: 90  FVLDFAPGGELLSLLHKMGTFNDIWT--RHFTAQLIDALEFIHSHGIIHRDLKPENVLLD 147

Query: 364 YSFDDINSFRDSPIYCKQNFIELADFGLCKKIE------------------NNEMCTARC 405
                    RD  +        + DFG    I+                  +N+ C +  
Sbjct: 148 ---------RDGRLM-------ITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCASFV 191

Query: 406 GSEDYVSPEILMGVPYD--GHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHR 463
           G+ +YVSPE+L+   Y+  G+ SD WALG ++Y   + + PF         +    T  +
Sbjct: 192 GTAEYVSPELLL---YNQCGYGSDIWALGCMIYQFVQGQPPF-------RGENELKTFEK 241

Query: 464 IARFDWRW 471
           I   D+ W
Sbjct: 242 IVALDYPW 249

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 70/150 (46%), Gaps = 27/150 (18%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y P GD L+ VM R G L     +    +++ A+ +LH+  IIHRD+K ENILL  
Sbjct: 278 FLLEYAPNGDFLS-VMKRFGTLSEECTKYYGAQILDAIHHLHKQGIIHRDVKPENILLDK 336

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKI----EN-----NEMCTARCGSEDYVSPEI 415
           +                  I+L DFG  K I    EN     N    +  G+ +YVSPE+
Sbjct: 337 TMK----------------IKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPEL 380

Query: 416 LMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           L     D    D WA G IL+ +   + PF
Sbjct: 381 LNDNYVDSRC-DIWAFGCILFQMVAGKPPF 409

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 90/202 (44%), Gaps = 48/202 (23%)

Query: 253 ENSLTRELQVLKSLNHPCIVKLLGI-----NNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
           E  + RELQ  KS     IV+  G+      + IF+                       M
Sbjct: 219 EKQIFRELQFNKSCKSDFIVRYYGMFACEETSTIFIA----------------------M 256

Query: 308 SYCPAGDLLAA---VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            Y     L +    ++++ GR+   ++ +I   V+  + YLHE  IIHRD+K +NIL   
Sbjct: 257 EYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGLFYLHERKIIHRDIKPQNIL--- 313

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGH 424
            F++I              I+L DFG+  +  N+ + T   G+  Y++PE + G PY   
Sbjct: 314 -FNEIGQ------------IKLCDFGVSGEAVNS-LATTFTGTSYYMAPERIQGQPYS-V 358

Query: 425 LSDTWALGVILYSLFEDRLPFD 446
            SD W+LG+ L  + +   PFD
Sbjct: 359 TSDVWSLGLTLLEVAQGHSPFD 380

>KLLA0C07535g 658746..660620 some similarities with sgd|S0005793
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 624

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 89/201 (44%), Gaps = 42/201 (20%)

Query: 257 TRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLL 316
           T E  V   L+HP I++ L I    F  +K+                  +M YCP  D  
Sbjct: 264 TSEFCVGSMLHHPNIIETLDI----FSDAKQT-------------QYYQVMEYCPV-DFF 305

Query: 317 AAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSP 376
           A VM+  G +    I   F ++V AV YLH     HRDLKL+N ++              
Sbjct: 306 AVVMS--GEMSRGEINCCFKQLVEAVNYLHSKGYAHRDLKLDNCVM-------------- 349

Query: 377 IYCKQNFIELADFGLC----KKIENN-EMCTARCGSEDYVSPEILMGV-PYDGHLSDTWA 430
              K+  ++L DFG         EN+ ++     GS+ Y++PE+L+    YD  + D W+
Sbjct: 350 --TKEGILKLIDFGSAFVYKYTYENDTKLAHGIVGSDPYLAPEVLVHSNGYDAPMVDIWS 407

Query: 431 LGVILYSLFEDRLPFDPPPNA 451
           +G+I   +   R P+  P ++
Sbjct: 408 MGIIFCCMMLKRFPWKVPKDS 428

>YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain
           (CTD) kinase alpha subunit, cyclin-dependent protein
           kinase that phosphorylates C-terminal domain of RNA
           polymerase II large subunit Rpo21p [1587 bp, 528 aa]
          Length = 528

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 85/188 (45%), Gaps = 35/188 (18%)

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           RE+++L+S +HP +  +      I V S+K +               MI  Y    DL  
Sbjct: 229 REIKLLQSFDHPNVSTI----KEIMVESQKTVY--------------MIFEYAD-NDLSG 269

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            ++ +  ++     + +F +++L ++YLH+N I+HRD+K  NIL+               
Sbjct: 270 LLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILID-------------- 315

Query: 378 YCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYS 437
              Q  +++ DFGL +K+ +    T R  +  Y  PE+L+G    G   D W  G +L  
Sbjct: 316 --NQGNLKITDFGLARKMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVE 373

Query: 438 LFEDRLPF 445
           LF     F
Sbjct: 374 LFNKTAIF 381

>Scas_502.2
          Length = 1116

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 71/150 (47%), Gaps = 27/150 (18%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y P GDLL+ +M + G L          +++ A+K++H   IIHRD+K ENILL  
Sbjct: 250 FLLEYAPNGDLLS-LMKKFGSLNEECCCYYGAQIIDAIKFMHSKGIIHRDIKPENILLD- 307

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTAR---------CGSEDYVSPEI 415
                          K   +++ DFG  K ++N    T+           G+ +YVSPE 
Sbjct: 308 ---------------KDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPE- 351

Query: 416 LMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           L+   Y    SD WA G I++ +   + PF
Sbjct: 352 LLNDNYTDARSDIWAFGCIVFQMIAGKPPF 381

>Scas_720.103
          Length = 804

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 95/205 (46%), Gaps = 43/205 (20%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E ++L + NHP IV L                    +T   L  C   M YC  G+   A
Sbjct: 453 EQEILATSNHPFIVTLYHS----------------FQTEDYLYLC---MEYCMGGEFFRA 493

Query: 319 VMARNGRLEAWLIQRIF-TEVVLAVKYLHENSIIHRDLKLENILLKYS-------FDDIN 370
           +  R+ +       R + +EV+ A++YLH    I+RDLK ENILL  S       FD   
Sbjct: 494 LQTRDSKCICEDDARFYASEVLAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSV 553

Query: 371 SFRDS--PIYCKQNFIELADFGLCKKIENNEMCT------ARCGSEDYVSPEILMGVPYD 422
             +DS  PI+ K   +   +  L   I + ++C+      +  G+E+Y++PE++ G   +
Sbjct: 554 HAKDSKNPIFMKDGILPTTNSNL---IVDTKICSEGFRTNSFVGTEEYIAPEVIRG---N 607

Query: 423 GH--LSDTWALGVILYSLFEDRLPF 445
           GH    D W LG++++ +   + PF
Sbjct: 608 GHTVAVDWWTLGILIFEMLFGKTPF 632

>Kwal_55.20189
          Length = 812

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 124/294 (42%), Gaps = 44/294 (14%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVK---------RLKYPEELSNVEQINTS 242
           +KK+  I  G++  V L    D    KL  VAVK         +    EE   +   N+S
Sbjct: 18  YKKLDDISEGSYGYVSLAN--DTQTKKL--VAVKYIFKNDDDGKASNYEEDGAIGSNNSS 73

Query: 243 LRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPP 302
           ++ K  L + + SL  E    +   + C   L  ++    V   K + +L          
Sbjct: 74  VQKKNELLKHQKSLISEKVRSRLSKNICFEALYEVDIHTKVGKHKNITELY-----DFFD 128

Query: 303 CDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILL 362
             ++M YC  GDL  A+ A        +I  I ++++ A++++H+  I HRDLK ENIL+
Sbjct: 129 SFIVMEYCSGGDLYEAIKADLIPKRTKVITHIASQIMEAIEFVHQKGIYHRDLKPENILI 188

Query: 363 KYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEIL------ 416
           + S                  I+L D+GL      +       GSE Y++PE+       
Sbjct: 189 EGS---------------DWTIKLTDWGLATTEPTS--LDRSVGSERYMAPELFEENLDR 231

Query: 417 --MGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFD 468
                PYD    D WA+G++L ++   + PF    N S +      ++R A FD
Sbjct: 232 DERSEPYDCSKVDLWAIGIVLLNIVFQKNPFS-VANQSDKSFCYFAANREALFD 284

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 94/215 (43%), Gaps = 32/215 (14%)

Query: 240 NTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRA 299
           N+SL  ++ L R + SL  E    +  NH C   L  ++    +   K + +L       
Sbjct: 71  NSSLEKRQMLLRRQRSLISEKVRSRLSNHICFEALYEVDIQSKIGKHKNITELY-----D 125

Query: 300 LPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLEN 359
                +IM YC  GDL  A+ A     +   +  I ++++ AV+++H   I HRD+K EN
Sbjct: 126 YFDSYIIMEYCSGGDLYEAIKADTIPRKTRQLTHIISQILDAVEFVHSKGIYHRDIKPEN 185

Query: 360 ILLKYSFDDINSFRDSPIYCKQNF-IELADFGLCKKIENNEMCTARCGSEDYVSPEIL-- 416
           IL+                   N+ ++L D+GL     +        GSE Y++PE+   
Sbjct: 186 ILI----------------ADSNWTVKLTDWGLA--TTDQTSMDRNVGSERYMAPELFES 227

Query: 417 ------MGVPYDGHLSDTWALGVILYSLFEDRLPF 445
                    PY+    D WA+G++L ++   + PF
Sbjct: 228 NLDYDERNEPYECSKVDIWAIGIVLLNIVFHKNPF 262

>Kwal_27.9763
          Length = 868

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 88/195 (45%), Gaps = 40/195 (20%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E+ +LK+L H  IVK  G     F+     L               +++ YC  G L   
Sbjct: 68  EIDLLKNLKHENIVKYHG-----FIQKSHQLF--------------ILLEYCSQGSLRDL 108

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           +  + G +E    +    + +  +KYLH+  +IHRD+K  N+LL                
Sbjct: 109 I--KRGPVEEQQCKTYIRQTLHGLKYLHDQGVIHRDIKAANLLLD--------------- 151

Query: 379 CKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSL 438
             QN ++LADFG+  ++ N  M  A  GS ++++PE++MG      +SD W+LG  +  +
Sbjct: 152 -AQNVVKLADFGVSTRVNNLAMTYA--GSPNWMAPEVMMGQGAST-VSDIWSLGATVVEI 207

Query: 439 FEDRLPFDPPPNASA 453
                PF    N +A
Sbjct: 208 LTGNPPFHNLVNEAA 222

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 148/336 (44%), Gaps = 67/336 (19%)

Query: 186 WDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKL-KQVAVKRLKYPEELSNVEQINTSLR 244
           +D+ LL K+   +G+G+++ V      +  N K  +QVAVK   +  + ++ ++ N   R
Sbjct: 197 FDKYLLGKE---LGAGHYALV-----KEAKNKKTGQQVAVK--IFHAQQNDDQKKNKQFR 246

Query: 245 YKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCD 304
                         E  +L  + HP IV LL      FV   +P+    I+    L   D
Sbjct: 247 -------------EETNILMRVQHPNIVNLLDS----FV---EPISKSQIQKYLVLEKID 286

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
                   G+L   ++ R   L     + +F +++  +KYLHE +IIHRD+K ENILL  
Sbjct: 287 -------DGELFERIV-RKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNI 338

Query: 365 SFDDINSFRDSPIYCKQN---------FIELADFGLCKKIENNEMCTARCGSEDYVSPEI 415
                 + R++P   +            +++ADFGL K     +     CG+  YV+PE+
Sbjct: 339 ------TRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEV 392

Query: 416 LMGVPYDGHLSDTWALGVILYSLFEDRLPFD---PPPNASARQRSRATSHRIARFDWRWY 472
           L    Y   + D W+ GVILY       PF     PP+     + +    + A +   W 
Sbjct: 393 LTKKGYTSKV-DLWSAGVILYVCLCGFPPFSDQLGPPSL----KEQILQAKYAFYSPYWD 447

Query: 473 RLSDYKTNVGKQIVENTLTRK-NQRWSINEIYESPF 507
           ++ D   +    ++ N L    ++R++I+E    P+
Sbjct: 448 KIDDSVLH----LISNLLVLNPDERYNIDEALNHPW 479

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/347 (24%), Positives = 147/347 (42%), Gaps = 55/347 (15%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNP------KLKQVAVKRL-KYPEELSNVEQINTSLR 244
           +K +  IG G FS V    + D+++         KQVAVK + K+  ++SN EQ     R
Sbjct: 150 YKLIEKIGEGAFSKVFC-GIPDKNSDSAYLARNYKQVAVKVISKHDLDVSNKEQQAKDKR 208

Query: 245 YKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCD 304
                    N ++   QV+K +    I K +    P  V          I          
Sbjct: 209 AGRDKQNNTNRMSSREQVMKEVR---IHKAVAAGCPYIVG--------FIDFQETKHYYY 257

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILL-- 362
           +I      G++   ++ R   L   L + +  +V LAV+++H   I+HRD+K EN+L   
Sbjct: 258 LIQELLDGGEIFNEIV-RLTYLSEDLSRHVIKQVALAVRHMHSLGIVHRDIKPENLLFKS 316

Query: 363 -------KYSF---DDINSFRDSPIYC------KQNFIELADFGLCKKIENNEMCTARCG 406
                  K +F   DD  +  D  ++           ++LADFGL K+I      T  CG
Sbjct: 317 IEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADFGLSKQIFQKNTKTP-CG 375

Query: 407 SEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIAR 466
           +  Y +PE++    Y   + D W +G +LY++     PF         ++    + +I+R
Sbjct: 376 TIGYTAPEVVKDEKYSMQV-DMWGIGCVLYTMLCGFPPF-------YDEKIDVLTEKISR 427

Query: 467 FDWR-----WYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFV 508
            ++      W  +S    +  K+++E       +R++I+E    P++
Sbjct: 428 GEYTFLEPWWDEISPGAKHCVKKLLE---VDPRKRYTIDEFLADPWL 471

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 139/334 (41%), Gaps = 61/334 (18%)

Query: 189 PLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKET 248
           P  ++K+R +G G+   V L          +K+    RL   +  S  E I      ++ 
Sbjct: 494 PQSFEKIRLLGQGDVGKVYL----------VKEKRTNRLYALKIFSKSEMIK-----RKK 538

Query: 249 LSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMS 308
           + R+      E ++L + NHP +V L                    ++   L  C   M 
Sbjct: 539 IKRI----LAEQEILATSNHPFVVTLYHS----------------FQSEDYLYLC---ME 575

Query: 309 YCPAGDLLAAVMARNGRLEAWLIQRIF-TEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
           YC  G+   A+  R  +  +    + + +EV  A++YLH    I+RDLK ENILL  S  
Sbjct: 576 YCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGH 635

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCT------ARCGSEDYVSPEILMGVPY 421
            + S  D  I  K   + +        + + ++C+      +  G+E+Y++PE++ G   
Sbjct: 636 IMLSDFDLSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVIRG--- 692

Query: 422 DGHLS--DTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDYKT 479
           +GH +  D W LG+++Y +     PF         + +  T   I + D  +   ++   
Sbjct: 693 NGHTAAVDWWTLGILIYEMLFGFTPFKG-------ENTNETFSNILKKDVTFPNNNEVSR 745

Query: 480 N----VGKQIVENTLTRKNQRWSINEIYESPFVK 509
           N    + K +++N   R   +    +I + PF K
Sbjct: 746 NCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFK 779

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 75/143 (52%), Gaps = 21/143 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM YC  G L +  + R G+++   I  I  E+++A+K +H++++IHRD+K  N+L+  
Sbjct: 90  IIMEYCAGGSLRS--LLRPGKIDEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLI-- 145

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEM-CTARCGSEDYVSPEILM-GVPYD 422
                           +  ++L DFG+  ++    +      G+  +++PE++M GV YD
Sbjct: 146 --------------TNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYD 191

Query: 423 GHLSDTWALGVILYSLFEDRLPF 445
             + D W+LG+  Y +     P+
Sbjct: 192 TKV-DIWSLGITAYEIATGNPPY 213

>Scas_593.14d
          Length = 495

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 119/282 (42%), Gaps = 80/282 (28%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEEL------SNVEQ-INTSLR 244
           ++ VR +G G +  V+L  + D+   KL   A+K+LK  E L      SN E  +N   R
Sbjct: 136 FRPVRVLGQGAYGKVIL--VKDKLTNKL--YAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 245 YKETLSRLENSLTRELQVLKSLNHPCIVKLL---GINNPIFVTSKKPLCDLIIKTPRALP 301
            + T +        E  +L  L HP IVKL      N+ ++                   
Sbjct: 192 IERTFA--------EKSILAELEHPNIVKLFYSFHDNSKLY------------------- 224

Query: 302 PCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENIL 361
              +++ Y P G+L    +   G L+   +     E+  A+K+LH+  I++RDLK EN L
Sbjct: 225 ---LLLQYIPGGELFFH-LKEQGTLDEDTVAFYAAEISCALKFLHDKGIVYRDLKPENCL 280

Query: 362 LKYSFDDINSFRDSPIYCKQNFIELADFGLCKK------------------IENNEMCTA 403
           L                  +  + L DFGL KK                   E+     +
Sbjct: 281 LN----------------DKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEPSEDLSTLHS 324

Query: 404 RCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             G+ +Y +PEIL G+PY+ +  D ++LG ++Y +   + P+
Sbjct: 325 IIGTPEYCAPEILQGLPYNKN-CDWYSLGCLIYDMLSGKPPY 365

>Scas_548.6
          Length = 1382

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            IF ++V  +K+LH+  I+HRD+K EN+++                  +  +++ DFG   
Sbjct: 1236 IFKQIVSGIKHLHDQGIVHRDIKDENVIVD----------------SKGCVKIIDFGSAA 1279

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             +++        G+ DY +PE+L G PY+G   D WA+G++LY++     PF
Sbjct: 1280 YVKSGPF-DVFVGTIDYAAPEVLSGEPYEGKPQDIWAIGILLYTIVFKENPF 1330

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 84/160 (52%), Gaps = 25/160 (15%)

Query: 305 MIMSYCPAGDLLA----AVMARNGRLEAWLIQRIFTEVVLAVKYLHEN-SIIHRDLKLEN 359
           ++  +C  G+L A     V+A+  RLE W I +I  E+ LA++++H++ SI+H DLK  N
Sbjct: 477 IMTEFCENGNLDAFIQEHVIAKQQRLEDWRIWKIIVEICLALRFIHDSCSIVHLDLKPAN 536

Query: 360 ILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGV 419
           +L+ +                +  ++LADFG+  K+   +      G  +Y++PEI+   
Sbjct: 537 VLITF----------------EGNLKLADFGMATKLPIEDKSFENEGDREYIAPEIIRDG 580

Query: 420 PYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRA 459
            YD   +D ++LG+++  +  + +    P N SA  + R+
Sbjct: 581 IYDFR-ADIFSLGLMMIEIAANVI---LPDNGSAWHKLRS 616

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 96/209 (45%), Gaps = 28/209 (13%)

Query: 257 TRELQVLKSLNHPCIVK------LLGINNPIFVTSKKPLCDLIIKTPRAL-PPCDM--IM 307
           T+ +  +K L+   IVK       +G  N I VT+       I+    +   P D+  + 
Sbjct: 434 TQRIYAMKVLSKKVIVKKNEIAHTIGERN-ILVTTASKSSPFIVGLKFSFQTPTDLYLVT 492

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            Y   G+L    + + GR      +    E+VLA+++LH+N I++RDLK ENILL     
Sbjct: 493 DYMSGGELFWH-LQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL----- 546

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSD 427
           D N             I L DFGL  K +  +     CG+ +Y++PE+L+       + D
Sbjct: 547 DANG-----------NIALCDFGLS-KADLKDRTNTFCGTTEYLAPELLLDETGYTKMVD 594

Query: 428 TWALGVILYSLFEDRLPFDPPPNASARQR 456
            W+LGV+++ +     PF    N    Q+
Sbjct: 595 FWSLGVLIFEMCCGWSPFFAENNQKMYQK 623

>Kwal_33.13681
          Length = 715

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 115/253 (45%), Gaps = 63/253 (24%)

Query: 195 VRPIGSGNFSTVLLYEL-MDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLE 253
           V  IGSG FSTV  Y++  +Q+N K    ++K  KY          NTS R         
Sbjct: 380 VSSIGSGQFSTV--YQVTFEQTNTKYAVKSMKPNKY----------NTSAR--------- 418

Query: 254 NSLTRELQVLKSLNHPCI---VKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYC 310
             + +E+ +L  ++   +    K   +N   F++S K      + T            YC
Sbjct: 419 --ILQEIDILSKISETTLDEEGKEYVLN---FISSWKYQGFFYVMT-----------EYC 462

Query: 311 PAGDL----LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHEN-SIIHRDLKLENILLKYS 365
             GDL       ++++N RLE W I +I  E+ LA++++H++  I H DLK  N+L+ + 
Sbjct: 463 ENGDLDTFLKKQIISKNTRLEDWRIWKIIVELSLALRFVHDSCQIAHLDLKPANVLITF- 521

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                          +  ++LADFG+  K+          G  +Y++PEI+    YD   
Sbjct: 522 ---------------EGNLKLADFGMAAKLPVGHTGIENEGDREYIAPEIISECVYD-FR 565

Query: 426 SDTWALGVILYSL 438
           +D ++LG+++  +
Sbjct: 566 ADIFSLGLMIVEI 578

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 122/285 (42%), Gaps = 50/285 (17%)

Query: 170 TEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKY 229
           +E+  +  F     D    P  ++K+R +G G+   V L     Q+N   +  A+K    
Sbjct: 357 SERLRNKSFSNKFQDILVGPQSFEKIRLLGQGDVGRVYLVR-EKQTN---RLYALKIFSK 412

Query: 230 PEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPL 289
           PE +            ++ + R+   LT E ++L + NHP IV L               
Sbjct: 413 PEMIK-----------RKKIKRI---LT-EQEILATSNHPFIVTLYHS------------ 445

Query: 290 CDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHEN 348
                +T   L  C   M YC  G+   A+  R  +  +    R ++ EV  A++YLH  
Sbjct: 446 ----FQTEDYLYLC---MEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 349 SIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCT------ 402
             I+RDLK ENILL  S   + S  D  +  K              + + ++C+      
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLSVQAKDTKNPQVKGNASHSLVDTKICSDGFRTN 558

Query: 403 ARCGSEDYVSPEILMGVPYDGHLS--DTWALGVILYSLFEDRLPF 445
           +  G+E+Y++PE++ G   +GH +  D W LG+++Y +     PF
Sbjct: 559 SFVGTEEYIAPEVIRG---NGHTAAVDWWTLGILIYEMLFGFTPF 600

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (52%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            +F +V   +++LHEN I+HRD+K EN+++                  +  +++ DFG   
Sbjct: 1113 LFKQVASGLRHLHENGIVHRDIKDENVIVD----------------NRGRVKIIDFGSAA 1156

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             ++         G+ DY +PE+L G PY+G   D WA+GV+LY++     PF
Sbjct: 1157 YVKRGPF-DVFVGTIDYAAPEVLGGDPYEGKPQDVWAVGVLLYTIIYKENPF 1207

>Kwal_23.4276
          Length = 521

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 20/160 (12%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVL-AVKYLHENSIIHRDLKLENILLK 363
           ++   C  GDL   ++   G L+     + +T  +L A+ +LHEN ++HRD+K EN+L +
Sbjct: 118 LVTQLCSHGDLYEKII-EAGSLDISKQVKSYTACLLSALDFLHENKVVHRDVKAENVLFR 176

Query: 364 YSFDDINSF--RDSPIYCKQNFIELADFGLCKKIENNEMCTARC-GSEDYVSPEILM--G 418
               +++ F  R S      + + LADFGL  + ++ +     C G+  Y++PE++   G
Sbjct: 177 CRVSELSEFSRRGSHYDHTSHDLILADFGLATRCDSKDDERRECVGTISYIAPEVVRCSG 236

Query: 419 V------------PYDGHLSDTWALGVILYSLFEDRLPFD 446
           +            PY   + D WALGV+ Y +    +PFD
Sbjct: 237 IARLAPSQAKLIKPYGASI-DIWALGVLAYFMMTGYMPFD 275

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 94/208 (45%), Gaps = 26/208 (12%)

Query: 257 TRELQVLKSLNHPCIVK------LLGINNPIFVTSKKPLCDLIIKTPRALPPCDM--IMS 308
           T  +  +K L+   IVK       +G  N +  T+ K    ++        P D+  +  
Sbjct: 347 TMRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTD 406

Query: 309 YCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDD 368
           +   G+L    + + GR      +    E+VLA++YLH+N I++RDLK ENILL     D
Sbjct: 407 FMSGGELFWH-LQKEGRFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILL-----D 460

Query: 369 INSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDT 428
            N             I L DFGL K  +  +     CG+ +Y++PE+LM       + D 
Sbjct: 461 ANG-----------NIALCDFGLSKA-DLKDRTNTFCGTTEYLAPELLMDETGYTKMVDF 508

Query: 429 WALGVILYSLFEDRLPFDPPPNASARQR 456
           W+LGV+++ +     PF    N    Q+
Sbjct: 509 WSLGVLIFEMCCGWSPFFASDNQKMYQK 536

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 105/262 (40%), Gaps = 71/262 (27%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRL--KYPEELSNVEQINTSLRYKETLSRLENS 255
           +G G +STV+L    D      K+ AVK L  +Y  +   V+ +N     K  L RL NS
Sbjct: 188 VGDGAYSTVMLATAKDSG----KKYAVKVLNKEYLIKQKKVKYVNIE---KNALQRLNNS 240

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
                          IVKL       F T +                   ++ Y P GD 
Sbjct: 241 R-------------GIVKL-------FFTFQDESS------------LYFLLEYAPNGDF 268

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
           L+ VM + G L     +    +++  +KYLH   IIHRD+K ENILL             
Sbjct: 269 LS-VMKKYGSLSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKPENILLD------------ 315

Query: 376 PIYCKQNFIELADFGLCKKIE-NNE-----------MCTARCGSEDYVSPEILMGVPYDG 423
               K   +++ DFG  K +E  NE              +  G+ +YVSPE+L     D 
Sbjct: 316 ----KDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSYVDA 371

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
              D WA G +++ +   + PF
Sbjct: 372 RC-DIWAFGCMVFQMIAGKPPF 392

>Kwal_55.21545
          Length = 865

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 35/177 (19%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM YC  G L    + R G++    I  I  E++ A+ ++H++ +IHRD+K  N+L+  
Sbjct: 93  VIMEYCAGGSL--RTLLRPGKIGEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLI-- 148

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEM-CTARCGSEDYVSPEILM-GVPYD 422
                              I+L DFG+  ++   ++      G+  +++PE++M GV YD
Sbjct: 149 --------------TNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYD 194

Query: 423 GHLSDTWALGVILYSLFEDRLPF--------------DPPPNASARQRSRATSHRIA 465
             + D W+LG+  Y +     P+                PP    RQ S A    IA
Sbjct: 195 TKV-DIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIA 250

>Kwal_26.7552
          Length = 461

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 108/250 (43%), Gaps = 55/250 (22%)

Query: 191 LWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLS 250
           ++++++ +G G +  V  Y+  +    +L  VA+KRL+   E        TS+R      
Sbjct: 130 VYERIQQVGEGTYGKV--YKARNTVTGQL--VALKRLRLEGEREGFPI--TSIR------ 177

Query: 251 RLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYC 310
                   E+++L+S +H  I  L    + I V S+K +               MI  Y 
Sbjct: 178 --------EIKLLQSFDHRNISTL----SEIMVESQKTVY--------------MIFEYA 211

Query: 311 PAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
              DL   +M     L     + +F  ++  + YLH+N I+HRD+K  NIL+        
Sbjct: 212 -DNDLSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGILHRDIKGSNILID------- 263

Query: 371 SFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWA 430
                     +  +++ DFGL +K+ ++   T R  +  Y  PE+LMG    G   D W 
Sbjct: 264 ---------NKGQLKITDFGLARKMRDDSDYTNRVITLWYRPPELLMGSTNYGTAVDMWG 314

Query: 431 LGVILYSLFE 440
            G +L  LF+
Sbjct: 315 CGCLLVELFK 324

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 78/172 (45%), Gaps = 26/172 (15%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM YC  GDL  A+ A     +   I  I T+++ A++Y+H   I HRD+K ENIL+  
Sbjct: 158 IIMEYCSGGDLYEAIKADAVPKKTKSITHIITQIMDAIEYVHNKGIYHRDIKPENILI-- 215

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEIL-------- 416
                     S I      I+L D+GL     +        GSE Y+SPE+         
Sbjct: 216 ----------SGIDWT---IKLTDWGLA--TTDKTSMDRNVGSERYMSPELFDSNLDIKE 260

Query: 417 MGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFD 468
              PYD    D WA+G++  ++   + PF    N S +      ++R A FD
Sbjct: 261 RKEPYDCAKVDLWAMGIVFLNIVFHKNPFS-IANQSDKSFCYFAANREALFD 311

>Kwal_56.22693
          Length = 984

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y P GD L+ V+ + G L          +++ A+ YLH   I+HRD+K ENILL  
Sbjct: 234 FLLEYAPNGDFLS-VIKKFGSLSQECAVYYSAQILDAIDYLHHKGIVHRDIKPENILLD- 291

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMC---------TARCGSEDYVSPEI 415
                          K   ++L DFG  + +E +E            +  G+ +YVSPE 
Sbjct: 292 ---------------KDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSPE- 335

Query: 416 LMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           L+   Y  +  D WA G IL+ +   + PF
Sbjct: 336 LLNDNYVDYKCDIWAFGCILFQMIAGKPPF 365

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 108/259 (41%), Gaps = 60/259 (23%)

Query: 189 PLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKET 248
           P L+K+   IG G F  V  Y+       ++  V V  L  PE+   VE +         
Sbjct: 22  PQLFKRTEVIGRGKFGVV--YKAYHAKTKQVYAVKVLNLDCPED--EVEDVQ-------- 69

Query: 249 LSRLENSLTRELQVLKSLNH-PCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
                    +E+Q L SL   P I +  G            L D  +          +IM
Sbjct: 70  ---------KEIQFLASLKQVPNITRYYG----------SYLYDTKLW---------VIM 101

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
            YC  G L    + R G+++   +  I  ++++A+ Y+H++++IHRD+K  N+L+     
Sbjct: 102 EYCAGGSL--RTLLRPGKIDEKYLGVIVRKLLIALVYIHKDNVIHRDIKAANVLI----- 154

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGVPYDGHLS 426
                        +  ++L DFG+  ++   N       G+  +++PE++M   Y    +
Sbjct: 155 -----------TNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNTKA 203

Query: 427 DTWALGVILYSLFEDRLPF 445
           D W+LG+  Y +     P+
Sbjct: 204 DIWSLGITAYEIATGNPPY 222

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 87/191 (45%), Gaps = 35/191 (18%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  EL +L+ L+HP IVK        F + +K                 ++      G+L
Sbjct: 100 LYDELSILQKLDHPNIVKF----KDWFESREKFY---------------IVTQLATGGEL 140

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++ + G+       +I  +++ AV+Y+H  +++HRDLK EN+L     D+       
Sbjct: 141 FDRIL-KKGKFTETDAVKIVVQMLTAVEYMHSQNVVHRDLKPENVLYLDPSDESQ----- 194

Query: 376 PIYCKQNFIELADFGLCKKIENNEMCTAR-CGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                   + ++DFG+ K++ +      R  GS  YV+PE+L    + G   D W+LGVI
Sbjct: 195 --------LVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH-GKPCDIWSLGVI 245

Query: 435 LYSLFEDRLPF 445
            Y+L     PF
Sbjct: 246 TYTLLCGYSPF 256

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 99/263 (37%), Gaps = 55/263 (20%)

Query: 228 KYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLL-----GINNPIF 282
           K   E  N   +   +RY    ++    L  E  +L  L H  IV+         +N +F
Sbjct: 26  KVVREADNKVMVRKEVRYGHMNAKERQQLISECAILSQLKHDNIVEFFHWDHDAKSNTLF 85

Query: 283 VTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVM---ARNGRLEAWLIQRIFTEVV 339
                                 + M YC  GDL   +     +   +    + RI  +++
Sbjct: 86  ----------------------LYMEYCSKGDLSQMIRYYKHQRKYVPEEYVWRIMVQIL 123

Query: 340 LAVKYLHENS----------------------IIHRDLKLENILLKYSFDDINSFRDSPI 377
           +A+   H                         +IHRDLK  NI L    D+ N       
Sbjct: 124 MALFKCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRDLKPGNIFLTGYDDEFNQNASDVD 183

Query: 378 YCKQNFIELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILY 436
           Y K   I+L DFGL K ++ + E  T   G+  Y+SPE+L   PY   LSD W+LG ILY
Sbjct: 184 YSKV-IIKLGDFGLAKSLQASIEFATTYVGTPYYMSPEVLRDQPYSP-LSDIWSLGCILY 241

Query: 437 SLFEDRLPFDPPPNASARQRSRA 459
            L    +PF        + + +A
Sbjct: 242 ELCSLHVPFQAKTYTELQGKVKA 264

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 88/185 (47%), Gaps = 35/185 (18%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  EL +L+ L HP IV+        +  SK                  ++      G+L
Sbjct: 91  LYDELSILQMLKHPNIVEF-----KDWFESKDKFY--------------IVTQLAVGGEL 131

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++A+ G+        I  +++ AV Y+H  +++HRDLK EN+L       I+   DS
Sbjct: 132 FDRILAK-GKFTERDAVSITMQILSAVDYMHSKNVVHRDLKPENVLY------IDKSDDS 184

Query: 376 PIYCKQNFIELADFGLCKKIE-NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
            +        +ADFG+ K+++ N+++     GS  YV+PE+L    + G   D W++GVI
Sbjct: 185 QLV-------IADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNNGH-GKPCDIWSIGVI 236

Query: 435 LYSLF 439
           +Y+L 
Sbjct: 237 VYTLL 241

>Scas_477.5
          Length = 703

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 116/283 (40%), Gaps = 68/283 (24%)

Query: 189 PLLWKKVRPIGSGNFSTVLLY------ELMDQSNPKLKQVAVKRLKYPEEL--------- 233
           P  W K   IGSG+F TV L       ELM      +KQV +     P  +         
Sbjct: 403 PKSWLKGARIGSGSFGTVYLGMNAQTGELM-----AVKQVGITAPPTPSAVVDKSKNSNS 457

Query: 234 -------SNVEQINTSLRYKETL-SRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTS 285
                  SN +  N   +    +  ++ ++L  E+ +LK L+H  IV   G         
Sbjct: 458 NGSGKNNSNGKIANDQAKNSPNMHKKMVDALQHEMNLLKELHHENIVTYYG--------- 508

Query: 286 KKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYL 345
                     + +  P  ++ + Y P G + ++++   G  E  LI     +V++ V YL
Sbjct: 509 ----------SSQEGPNLNIFLEYVPGGSV-SSMLNNYGPFEESLIVNFIRQVLIGVAYL 557

Query: 346 HENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKK---IENNEMCT 402
           H  +IIHRD+K  NIL+                  +  +++ DFG+ KK   +   +   
Sbjct: 558 HNKNIIHRDIKGANILID----------------TKGCVKITDFGISKKLSPLSKQDKRA 601

Query: 403 ARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           +  GS  +++PE++         +D W+ G ++  +F  + PF
Sbjct: 602 SLQGSVYWMAPEVVKQTATT-EKADIWSTGCVVIEMFTGKHPF 643

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 114/278 (41%), Gaps = 42/278 (15%)

Query: 192 WKKVRPIGSGNFSTVL-LYELMDQSNPKL----KQVAVKRLKYPEELSNVEQINTSLRYK 246
           +K +  IG G FS V     L D  N  L    KQVAVK +   + LS      T  R  
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVIS-KKRLSTTAS-TTGRRRD 148

Query: 247 ETLSRLENSLTRELQVLKSLN-HPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDM 305
           +     EN  T   QVLK +  H  +    G N   F+  ++      I           
Sbjct: 149 KREEAGENKATSREQVLKEITIHKAVSS--GENIVTFIDFQETESYYFI----------- 195

Query: 306 IMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENIL---- 361
           +      G++   ++ R       L + +  ++ LAVK++H   I+HRD+K EN+L    
Sbjct: 196 VQELLAGGEIFGEIV-RLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPI 254

Query: 362 ---------LKYSFD-----DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGS 407
                    L+ S D     D   FR          I+LADFGL K+I      T  CG+
Sbjct: 255 DFIPSKRQQLRQSDDPKTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATNTTTP-CGT 313

Query: 408 EDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             Y +PE++    Y   + D W +G +LY++     PF
Sbjct: 314 VGYTAPEVVKDERYSMKV-DMWGIGCVLYTVLCGFPPF 350

>Kwal_26.8703
          Length = 444

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 18/128 (14%)

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           ++ R GR+   ++ +I   V+  + YL E  IIHRD+K +NILL                
Sbjct: 250 LLERGGRIGEKVLGKIAESVLKGLSYLQERKIIHRDIKPQNILLN--------------- 294

Query: 379 CKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSL 438
            +   ++L DFG+   +  N + T   G+  Y++PE + G PY    SD W+LG+ L  +
Sbjct: 295 -EAGQVKLCDFGV-SGVAVNSLATTFTGTSFYMAPERIQGQPYS-VTSDVWSLGLTLLEV 351

Query: 439 FEDRLPFD 446
            + + PF 
Sbjct: 352 AQGQFPFG 359

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 28/151 (18%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y P GDLL+ +M ++G +     Q    +++ A+ ++H+  +IHRDLK ENILL  
Sbjct: 231 FLLEYAPNGDLLS-LMRKHGSVNEKCTQYYAAQIIDALGFMHDKGVIHRDLKPENILLDV 289

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNE----------MCTARCGSEDYVSPE 414
                              ++L DFG  + +++               +  G+ +YVSPE
Sbjct: 290 DMK----------------VKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPE 333

Query: 415 ILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            L+   Y     D WA G IL+ +   + PF
Sbjct: 334 -LLNDNYVDFRCDIWAFGCILFQMIAGKPPF 363

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 119/282 (42%), Gaps = 75/282 (26%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETL-- 249
           +K VR +G G +  VLL + ++ S    K  A+K+L+  E L  + Q  T  + ++    
Sbjct: 128 FKPVRVLGQGAYGKVLLVKDVNTS----KLYAMKQLRKAEIL--ISQTATDSKREDEDKN 181

Query: 250 ------------SRLENSLTRELQVLKSLNHPCIVKLL---GINNPIFVTSKKPLCDLII 294
                        RLE +   E  +L  + HP IVKL      N+ ++            
Sbjct: 182 DGNNNDNDDGLSKRLERTFA-ERSILSEIEHPNIVKLFYSFHDNSKLY------------ 228

Query: 295 KTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRD 354
                     +++ Y P G+L    +  +G L+   +     E+  A+++LH   +++RD
Sbjct: 229 ----------LLLQYIPGGELFYH-LKEHGTLDETTVSFYAAEISCALRFLHTKGVVYRD 277

Query: 355 LKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-----------ENNEMCTA 403
           LK EN LL                 ++  + L DFGL KK            EN     +
Sbjct: 278 LKPENCLLN----------------QRGHLVLTDFGLSKKSANDSAVDEEDPENVNALYS 321

Query: 404 RCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             G+ +Y +PEIL+G  Y  +  D ++LG +LY +   + P+
Sbjct: 322 IIGTPEYCAPEILLGKAYSQN-CDWYSLGCLLYDMLVGKPPY 362

>Kwal_0.155
          Length = 587

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 104/227 (45%), Gaps = 35/227 (15%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            I+    AG  +   + R       L + +  ++ LAVK++H   I+HRD+K EN+L ++
Sbjct: 249 FIVQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEH 308

Query: 365 ------------SFDDINSFRDSPIY------CKQNFIELADFGLCKKIENNEMCTARCG 406
                         DD  + +D  I+           ++LADFGL K+I +    T  CG
Sbjct: 309 VDYEPSPSPVLRKSDDPKAKQDEGIFRPGIGGGGIGTVKLADFGLSKQIYSTNTKTP-CG 367

Query: 407 SEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIAR 466
           +  Y +PE++    Y   + D W +G +LY++     PF         ++    + +I+R
Sbjct: 368 TVGYTAPEVVKDERYSMQV-DMWGIGCVLYTVLCGFPPF-------YDEKIDVLTEKISR 419

Query: 467 FDWR-----WYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFV 508
            ++      W  +SD   N  ++++E      ++R++I+E    P++
Sbjct: 420 GEFTFLRPWWDEISDGAKNAVRRLLE---VDPSKRYTIDEFLADPWL 463

>Scas_629.16
          Length = 918

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 103/242 (42%), Gaps = 23/242 (9%)

Query: 281 IFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIF-TEVV 339
           I  TS  P    +  + ++       M YC  G+   A+  R  +  +    R + +EV 
Sbjct: 570 ILATSNHPFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVT 629

Query: 340 LAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNE 399
            A++YLH    I+RDLK ENILL  S   + S  D  +  K   + +        + + +
Sbjct: 630 AALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKVPVMKGSAESTVVDTK 689

Query: 400 MCT------ARCGSEDYVSPEILMGVPYDGHLS--DTWALGVILYSLFEDRLPFDPPPNA 451
           +C+      +  G+E+Y++PE++ G   +GH +  D W LG+++Y +     PF      
Sbjct: 690 ICSDGFRTNSFVGTEEYIAPEVIRG---NGHTAAVDWWTLGILIYEMLFGFTPF------ 740

Query: 452 SARQRSRATSHRIARFDWRWYRLSDYKTN----VGKQIVENTLTRKNQRWSINEIYESPF 507
                S  T   I + D  +   +D   N    + K + +N   R   +    ++   PF
Sbjct: 741 -KGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPF 799

Query: 508 VK 509
            K
Sbjct: 800 FK 801

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 75/143 (52%), Gaps = 21/143 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM +C  G L +  + R G+++   I  I  E+++A+K +H++++IHRD+K  N+L+  
Sbjct: 97  IIMEHCAGGSLRS--LLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLI-- 152

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEM-CTARCGSEDYVSPEILM-GVPYD 422
                           +  ++L DFG+  ++    +      G+  +++PE++M GV YD
Sbjct: 153 --------------TNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYD 198

Query: 423 GHLSDTWALGVILYSLFEDRLPF 445
             + D W+LG+  Y +     P+
Sbjct: 199 TKV-DIWSLGITTYEIATGNPPY 220

>Kwal_23.6458
          Length = 868

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 117/267 (43%), Gaps = 52/267 (19%)

Query: 189 PLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKET 248
           P  ++K++ +G G+   V L          +K+    RL Y  ++ + E++    + K  
Sbjct: 461 PQSFEKIKLLGQGDVGKVYL----------VKEKKTNRL-YALKIFSKEEMIKRKKIKRI 509

Query: 249 LSRLENSLTRELQVLKSLNHPCIVKLL-GINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
           L+        E ++L + NHP IV L     +  ++     LC                M
Sbjct: 510 LA--------EQEILATSNHPFIVTLYHSFQSEDYLY----LC----------------M 541

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKYSF 366
            YC  G+   A+  R  +       R ++ EVV A++YLH    I+RDLK ENILL  S 
Sbjct: 542 EYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLMGFIYRDLKPENILLHKSG 601

Query: 367 DDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCT------ARCGSEDYVSPEILMGVP 420
             + S  D  +  K     +        + + ++C+      +  G+E+Y++PE++ G  
Sbjct: 602 HIMLSDFDLSVQAKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRG-- 659

Query: 421 YDGHLS--DTWALGVILYSLFEDRLPF 445
            +GH +  D W LG+++Y +     P+
Sbjct: 660 -NGHTAAVDWWTLGILIYEMLFGFTPY 685

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 18/128 (14%)

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           ++   GR+   ++ +I   V+  + YLH+  IIHRD+K +NILL                
Sbjct: 329 LLKHGGRVGEKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLN--------------- 373

Query: 379 CKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSL 438
            +   ++L DFG+  +  N+ + T   G+  Y++PE + G PY    SD W+LG+ L  +
Sbjct: 374 -EAGQVKLCDFGVSGEAVNS-LATTFTGTSYYMAPERIQGQPYS-VTSDVWSLGLTLLEV 430

Query: 439 FEDRLPFD 446
            +   PFD
Sbjct: 431 AQAHFPFD 438

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 98/250 (39%), Gaps = 53/250 (21%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           IG G+F  V +          LK V+ + L   +E           R  E   +    LT
Sbjct: 336 IGKGSFGVVRICH-----KKNLKSVSGEILYAVKEFRR--------RPTENPVKYSKRLT 382

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
            E  +  SL H  I++ L     +F  +K   C+              +M YC  GDL  
Sbjct: 383 SEFCISSSLKHTNIIETL----DLFQDAKGDYCE--------------VMEYCSGGDLFT 424

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            ++A  G+LE         +++  V Y+H   + HRDLK EN+LL +             
Sbjct: 425 LIIAA-GKLEYQEADCFLKQLITGVVYMHNMGVCHRDLKPENLLLTH------------- 470

Query: 378 YCKQNFIELADFG--LCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                 +++ DFG   C ++   +   +    CGS  Y++PE      +D    D WA G
Sbjct: 471 ---DGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQEEFDPRAVDIWACG 527

Query: 433 VILYSLFEDR 442
           VI  ++   R
Sbjct: 528 VIYMAMRTGR 537

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 74/148 (50%), Gaps = 21/148 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +++     GDL   +    G ++  + Q  F +++ A+ YLH+  + HRD+K ENILL  
Sbjct: 92  IMLEMADGGDLFDKIEPDVG-VDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLD- 149

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNE----MCTARCGSEDYVSPEILMGVP 420
                          K+  ++LADFGL  +    +    + T + GS  Y++PEIL    
Sbjct: 150 ---------------KKGNLKLADFGLASQFRRKDGTLRVSTDQRGSPPYMAPEILSSQG 194

Query: 421 YDGHLSDTWALGVILYSLFEDRLPFDPP 448
           Y  +++D W+ GV+L+ L    +P+  P
Sbjct: 195 YYANITDIWSAGVLLFVLLTGEIPWSIP 222

>ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)
           [2016 bp, 671 aa]
          Length = 671

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 87/211 (41%), Gaps = 42/211 (19%)

Query: 244 RYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPC 303
           R  E++       T E  +   L+HP +++ L +    F  SK+                
Sbjct: 152 RPGESVKDYARKCTSEYMIGSMLHHPNVIETLDV----FSNSKQNQYY------------ 195

Query: 304 DMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLK 363
             +M YCP  D  A VM+  G++    I   F ++V  V YLH     HRDLKL+N ++ 
Sbjct: 196 -EVMEYCPV-DFFAVVMS--GQMSRGEINCCFKQLVEGVNYLHSKGYAHRDLKLDNCVM- 250

Query: 364 YSFDDINSFRDSPIYCKQNFIELADFGLCKKIE-----NNEMCTARCGSEDYVSPEILMG 418
                           +   ++L DFG     +     + +M     GS+ Y++PE+L  
Sbjct: 251 ---------------TRDGILKLIDFGSAFVFKYTYEADEKMAHGVVGSDPYLAPEVLTS 295

Query: 419 V-PYDGHLSDTWALGVILYSLFEDRLPFDPP 448
              Y   L D W++G+I   +   R P+  P
Sbjct: 296 TKSYSAPLVDIWSIGIIYCCMILKRFPWKEP 326

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 96/250 (38%), Gaps = 55/250 (22%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           IG G F  V +    D +N      AVK  K               R  E   +    LT
Sbjct: 228 IGKGAFGVVRICHKKD-ANGTEALYAVKEFKK--------------RPSEDQEKYSRRLT 272

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
            E  +  SL H  I+  L     +F  +K   C+              +M YC  GDL +
Sbjct: 273 SEFCLSSSLKHTNIINTL----DLFQDAKGDYCE--------------VMEYCSGGDLFS 314

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            ++   G+LE       F +++  V Y+H+  + HRDLK EN++L               
Sbjct: 315 LIVT-AGKLEYMEADCFFKQMIRGVVYMHDMGVCHRDLKPENLILT-------------- 359

Query: 378 YCKQNFIELADF--GLCKKI---ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALG 432
                 +++ DF  G C ++   ++  +    CGS  Y++PE      +D    D WA G
Sbjct: 360 --ANGVLKITDFGNGECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEEFDPRPVDIWACG 417

Query: 433 VILYSLFEDR 442
            I  ++   R
Sbjct: 418 TIYMAMRTGR 427

>Scas_201.1*
          Length = 274

 Score = 67.4 bits (163), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 87/191 (45%), Gaps = 35/191 (18%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           L  EL +L+ L+HP IV         F +  K                 ++      G+L
Sbjct: 81  LYDELSILQRLHHPNIVAF----KDWFESRDKFY---------------IVTQLATGGEL 121

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              ++ + G+        I  +++ AVKY+H  +I+HRDLK EN+L     D+       
Sbjct: 122 FDRII-KKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPSDESQ----- 175

Query: 376 PIYCKQNFIELADFGLCKKIE-NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                   + +ADFG+ K+++ N+++     GS  YV+PE+L    + G   D W+LGVI
Sbjct: 176 --------LVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGH-GKPCDIWSLGVI 226

Query: 435 LYSLFEDRLPF 445
            Y+L     PF
Sbjct: 227 TYTLLSGYSPF 237

>Kwal_33.13222
          Length = 148

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 17/114 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M++ Y   G+L   ++ R G L      R F ++++ + Y H   I+HRDLK EN+LL +
Sbjct: 24  MVLEYVEKGELFNLLVER-GPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDH 82

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMG 418
            F+                I++ADFG+      +++    CGS  Y +PEI+ G
Sbjct: 83  KFN----------------IKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 121/289 (41%), Gaps = 75/289 (25%)

Query: 189 PLLWKKVRPIGSGNFSTVLLY------ELMDQSNPKLKQVAVKRLKYPEELSNVEQINTS 242
           P  W K   IGSG+F +V L       ELM      +KQV +K         N +Q N+ 
Sbjct: 412 PKNWLKGACIGSGSFGSVYLGMNAHTGELM-----AVKQVEIKNNNIGVPTDNNKQANSD 466

Query: 243 L--------------------RYKETLSR-LENSLTRELQVLKSLNHPCIVKLLGINNPI 281
                                +  + + R + ++L  E+ +LK L+H  IV   G     
Sbjct: 467 ENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYG----- 521

Query: 282 FVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLA 341
                           +     ++ + Y P G + ++++   G  E  LI     ++++ 
Sbjct: 522 --------------ASQEGGNLNIFLEYVPGGSV-SSMLNNYGPFEESLITNFTRQILIG 566

Query: 342 VKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-----E 396
           V YLH+ +IIHRD+K  NIL+     DI         C    +++ DFG+ KK+     +
Sbjct: 567 VAYLHKKNIIHRDIKGANILI-----DIKG-------C----VKITDFGISKKLSPLNKK 610

Query: 397 NNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
            N+  + + GS  ++SPE++         +D W+ G ++  +F  + PF
Sbjct: 611 QNKRASLQ-GSVFWMSPEVVKQTATTAK-ADIWSTGCVVIEMFTGKHPF 657

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 71/143 (49%), Gaps = 21/143 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM YC  G L    + R G +E   I  I  E+++A+  +H +++IHRD+K  NIL+  
Sbjct: 90  VIMEYCAGGSL--RTLLRPGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILI-- 145

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMC-TARCGSEDYVSPEILM-GVPYD 422
                              ++L DFG+  ++  + +      G+  +++PE++M GV YD
Sbjct: 146 --------------ANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYD 191

Query: 423 GHLSDTWALGVILYSLFEDRLPF 445
             + D W+LG+  Y +     P+
Sbjct: 192 TKV-DIWSLGITAYEIATGNPPY 213

>Kwal_27.9773
          Length = 406

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 112/278 (40%), Gaps = 56/278 (20%)

Query: 239 INTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPR 298
           +   ++Y    S+    L  E  +L  L H  IV+    ++ + V               
Sbjct: 46  VRKEIKYGHMNSKERQQLISECAILSQLKHENIVEFYEWDSDVDVLY------------- 92

Query: 299 ALPPCDMIMSYCPAGDL---LAAVMARNGRLEAWLIQRIFTEVVLAVKYLH--------- 346
                   M YC  GDL   ++        +   L+  +  +V++A+   H         
Sbjct: 93  ------FYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYRCHYGSDLAPLE 146

Query: 347 ------------ENSIIHRDLKLENILLKYS-FDDINSFRDSPIYCKQNFIELADFGLCK 393
                        N +IHRDLK  NI L      D      +  Y K + ++L DFGL K
Sbjct: 147 TIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS-VKLGDFGLAK 205

Query: 394 KIENN-EMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNAS 452
            +  + E  T   G+  Y+SPE+LM  PY   LSD W+LG ++Y +   R PF       
Sbjct: 206 SLGASVEFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVIYEMCTLRPPFQAKTYTE 264

Query: 453 ARQRSRATSHRIARFDWRWYRLSDYKTNVGKQIVENTL 490
            ++R +      A+FD    R+ DY ++  + ++E+ +
Sbjct: 265 LQRRIKT-----AKFD----RIPDYYSDELQMLIESCI 293

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 108/248 (43%), Gaps = 60/248 (24%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           IG G++  V  Y+ +++   ++  VA+K + Y     N E++N               + 
Sbjct: 31  IGRGSYGVV--YKAINKHTDQV--VAIKEVVY----ENDEELN--------------DIM 68

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
            E+ +LK+LNH  IVK  G     F+     L               +++ YC  G L  
Sbjct: 69  AEISLLKNLNHNNIVKYHG-----FIRKSYELY--------------ILLEYCANGSLRR 109

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +   +  L     +   T+ +L +KYLH   +IHRD+K  NILL               
Sbjct: 110 LISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLS-------------- 155

Query: 378 YCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYS 437
               N ++LADFG+   + ++ +  A  G+ ++++PEIL G      LSD W+LG  +  
Sbjct: 156 --ADNTVKLADFGVSTIVNSSALTLA--GTLNWMAPEIL-GNRGASTLSDIWSLGATVVE 210

Query: 438 LFEDRLPF 445
           +     P+
Sbjct: 211 MLTKNPPY 218

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 113/268 (42%), Gaps = 42/268 (15%)

Query: 213 DQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIV 272
           D+ N     V V   +  +E +N   +N+S   K+ L + + SL  +  + +  N+ C  
Sbjct: 55  DKGNDTKDGVMVIGDEKDDETNNT--VNSSQEKKQRLLKHQKSLISDKVLSRFSNNVCFE 112

Query: 273 KLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQ 332
            L  ++    +   K + +L            +IM YC  GDL  A+       +   + 
Sbjct: 113 ALYEVDIQTKIGKHKNITELY-----DFFDSYIIMEYCSGGDLYEAIKDDMVPRKTKNVT 167

Query: 333 RIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLC 392
            I  +++ AV+Y+H   I HRD+K ENIL+  +++                I+L D+GL 
Sbjct: 168 NIINQILDAVEYVHSRGIYHRDIKPENILIAGNWN----------------IKLTDWGLA 211

Query: 393 KKIENNEMCTARCGSEDYVSPEILMGV--------PYDGHLSDTWALGVILYSLFEDRLP 444
               +        GSE Y++PE+             YD    D WA+G+++ ++   + P
Sbjct: 212 --TTDKTSMERNVGSERYMAPELFESNLDREERTDAYDCAKVDIWAIGIVMLNIVFHKNP 269

Query: 445 FDPPPNASARQRSRA----TSHRIARFD 468
           F       A Q  +A     ++R A FD
Sbjct: 270 F-----TVANQTDKAFCYFAANREALFD 292

>KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces
           cerevisiae YMR291w, start by similarity
          Length = 557

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 133/286 (46%), Gaps = 55/286 (19%)

Query: 193 KKVRPIGSGNFSTVLLYELM-----DQSNPKL--KQVAVKRLKYPE-ELSNVEQINTSLR 244
           KKV  +G G+FS V   E M     D+   KL  K + + +L+  + E+S ++++++ +R
Sbjct: 38  KKV-ALGDGHFSVV--KECMNTMTGDRYAMKLVHKSLVMDKLQLIQREVSVLKRVSSLIR 94

Query: 245 YKETLS-RLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPC 303
             ETL+ ++  S +    V +  +H  +++L       F TSK  +              
Sbjct: 95  ELETLNQKVAGSGSNHGDVFEGHHH--VLQLF----DFFETSKSIV-------------- 134

Query: 304 DMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVL-AVKYLHENSIIHRDLKLENIL- 361
            ++   C + DL   ++   G L+     + FT  +L A+++LH N IIHRDLK EN+L 
Sbjct: 135 -LVTQLCESEDLYDKIL-NAGHLDLETQVKPFTACLLSALQFLHGNGIIHRDLKAENVLF 192

Query: 362 -LKYSFDDINSFRDSPIYCKQNF-IELADFGLCKKIENNEMCTARCGSEDYVSPEILMG- 418
            LK   + I   RD  +Y K    + LADFGL    E         G+  Y++PE++   
Sbjct: 193 RLKTKTNMIELPRDDAMYDKSAHDLILADFGLAISTETGS--KEFVGTISYLAPELVACK 250

Query: 419 -------------VPYDGHLSDTWALGVILYSLFEDRLPFDPPPNA 451
                         PY G   D WALGV+ Y +    +PFD   +A
Sbjct: 251 NSGKQSSIQNGRLKPY-GTGVDVWALGVLCYFMACGYMPFDCETDA 295

>CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces
           cerevisiae YMR291w, hypothetical start
          Length = 622

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 123/278 (44%), Gaps = 50/278 (17%)

Query: 197 PIGSGNFSTVLLYELMDQSNPKLKQVA-VKRLKYPEELSNVEQINTSLRY-KETLSRLEN 254
           P+G G+FS V   E M+     L  +  + +    ++L  +++    L+Y  ET+  LE 
Sbjct: 53  PLGDGHFSVV--KECMNMHTKDLYAMKLIDKSIVQDKLKLIQREFELLKYISETIRTLEL 110

Query: 255 SLTRELQVLKSLN-------HPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
           S T  L   ++ +       H  I++L       F TSK  +               +I 
Sbjct: 111 SSTSSLMNAQNGSNCSHFDGHHHILQLFDF----FETSKNIV---------------LIT 151

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVL-AVKYLHENSIIHRDLKLENIL--LKY 364
             C   DL   ++ +N +L+     + +T  ++ A+++LH N I+HRD+K EN+L  LK+
Sbjct: 152 QLCQKDDLYDTII-KNQKLDLETQVKPYTACLISALEFLHSNGIVHRDIKAENVLFRLKH 210

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTAR--CGSEDYVSPEILM----- 417
             +   +  ++      + + LADFGL  ++      T R   G+  Y+SPEI+      
Sbjct: 211 QINPNETAENATYDLAAHDLILADFGLATRVNVESTTTLREYVGTVSYISPEIVACKGVS 270

Query: 418 ---------GVPYDGHLSDTWALGVILYSLFEDRLPFD 446
                     +P  G   D WALGV+ Y +     PFD
Sbjct: 271 SIDNTKEIEKIPKYGTPVDIWALGVLTYFMALGYTPFD 308

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 331 IQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNF-IELADF 389
           ++ I ++++  +K++HE++  HRDLK ENIL+  S         + I  + N+ I+LADF
Sbjct: 170 LKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADF 229

Query: 390 GLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
           GL + +EN    TA   +  Y SPEIL+   Y     D WA G +
Sbjct: 230 GLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCV 274

>YAR018C (KIN3) [73] chr1 complement(170393..171700)
           Serine/threonine protein kinase [1308 bp, 435 aa]
          Length = 435

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 118/302 (39%), Gaps = 86/302 (28%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           ++ +  IG G+F +V           K+  +  K+L           +   ++Y    S+
Sbjct: 25  YQVLEEIGRGSFGSV----------RKVIHIPTKKL----------LVRKDIKYGHMNSK 64

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
               L  E  +L  L H  IV+     N  F   K+ L               + M YC 
Sbjct: 65  ERQQLIAECSILSQLKHENIVEFY---NWDFDEQKEVLY--------------LYMEYCS 107

Query: 312 AGDL---LAAVMARNGRLEAWLIQRIFTEVVLAVKYLH---------------------E 347
            GDL   +      +  +   ++  I  +++ A+   H                     +
Sbjct: 108 RGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGK 167

Query: 348 NSIIHRDLKLENILLKY------------SFDDINS--FRD---------SPIYCKQNFI 384
           N +IHRDLK  NI L Y              +++NS  +RD         SP+   Q  +
Sbjct: 168 NIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVV 227

Query: 385 ELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRL 443
           +L DFGL K +E + +  T   G+  Y+SPE+LM  PY   LSD W+LG +++ +     
Sbjct: 228 KLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVIFEMCSLHP 286

Query: 444 PF 445
           PF
Sbjct: 287 PF 288

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 87/195 (44%), Gaps = 40/195 (20%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E+ +LK+L H  IV+  G     F+     L               +I+ YC  G L   
Sbjct: 55  EIDLLKNLRHQNIVEYRG-----FIQKAHELY--------------IILEYCARGSL-RD 94

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           ++     LE   +  + T+ +  ++YLHE  +IHRD+K  N+LL                
Sbjct: 95  ILKHGPLLEDDTVNYV-TQTLYGLQYLHEQGVIHRDIKAANLLLT--------------- 138

Query: 379 CKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSL 438
            ++  ++LADFG+  +I  N M     GS ++++PE++ G      +SD W+LG  +  L
Sbjct: 139 -EEGIVKLADFGVSTRI--NRMAMTYAGSPNWMAPEVMTGQGAST-VSDIWSLGATVVEL 194

Query: 439 FEDRLPFDPPPNASA 453
                PF    N SA
Sbjct: 195 LTGNPPFHNLVNESA 209

>Scas_643.20
          Length = 1082

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 17/112 (15%)

Query: 334  IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
            IF +VV  +K+LH+  I+HRD+K EN+++           DS     +  ++L D+G   
Sbjct: 936  IFKQVVSGLKHLHDQGIVHRDIKDENVIV-----------DS-----KGHVKLIDYGSAA 979

Query: 394  KIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
              ++        G+ DY +PE+L G  YDG   D WA+G++LY++     PF
Sbjct: 980  YTKSGPF-DVFVGTIDYAAPEVLGGSVYDGKPQDIWAIGILLYTIIFKENPF 1030

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 93/200 (46%), Gaps = 14/200 (7%)

Query: 257 TRELQVLKSLNHPCIVKLLGIN-----NPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
           T ++  LK LN   ++K   I        I  TS  P    +  + +      + M YC 
Sbjct: 346 TNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYCM 405

Query: 312 AGDLLAAVMARNGRLEAWLIQRIF-TEVVLAVKYLHENSIIHRDLKLENILLKYSFDDIN 370
            G+   A+  R  +  A    + + +EVV A++YLH    I+RDLK ENILL  S   + 
Sbjct: 406 GGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVML 465

Query: 371 SFRDSPIYC---KQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLS- 426
           S  D  I     K+  ++ + +   K   +     +  G+E+Y++PE++ G   +GH + 
Sbjct: 466 SDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRG---NGHTAA 522

Query: 427 -DTWALGVILYSLFEDRLPF 445
            D W LG+++Y +     PF
Sbjct: 523 VDWWTLGILIYEMLFGCTPF 542

>Scas_713.7
          Length = 983

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 104/248 (41%), Gaps = 60/248 (24%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           IG G++  V  Y+ +++    L+ VA+K + Y  +   +E                  + 
Sbjct: 32  IGKGSYGVV--YKAVNKKT--LQIVAIKEVNYDNDDELIE------------------IM 69

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
            E+ +LK+LNH  IVK  G     F+     L               +I+ +C  G L  
Sbjct: 70  TEIDLLKNLNHVNIVKYHG-----FIQKSSNLY--------------IILEFCSKGSLKN 110

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +      +     +    + +  + YLHE  +IHRD+K  N+LL           DS  
Sbjct: 111 LLTGYKDGIPELDAKVYIRQTLNGLVYLHEQGVIHRDIKAANLLL-----------DS-- 157

Query: 378 YCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYS 437
               + ++LADFG+  K+ N  M  A  GS  ++SPEI+ G      LSD W+LG  +  
Sbjct: 158 ---NDVVKLADFGVSTKVSNTAMTLA--GSLHWMSPEII-GNRGASTLSDIWSLGATVVE 211

Query: 438 LFEDRLPF 445
           L     PF
Sbjct: 212 LVTGNPPF 219

>AEL179W [2327] [Homologous to NOHBY] complement(302948..303817)
           [870 bp, 289 aa]
          Length = 289

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 334 IFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCK 393
           +  ++V  V YLH + ++HRDLKL+N++L     D ++ +            L DFG   
Sbjct: 113 LLGQLVEGVAYLHSSGVVHRDLKLDNMMLA---PDCHTLK------------LIDFGHAV 157

Query: 394 KIENNEM-CTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFED 441
           K++  +  C    G+E  ++PE L  + Y+G+  D W++G+I+Y LF D
Sbjct: 158 KLQAGKTKCYGIGGTEPLIAPEALNQLSYEGYPVDMWSIGIIMYMLFND 206

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 24/167 (14%)

Query: 306 IMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYS 365
           I+ YC   DL + VM+     E   I  +F +++  VKYLH+  + HRDLKL+N ++   
Sbjct: 439 ILEYCEY-DLFSLVMSEKMHYEE--ICCLFKQLINGVKYLHDIGLSHRDLKLDNCVV--- 492

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIE---NNEMCTAR--CGSEDYVSPEILMGVP 420
                         ++  ++L DFG         +++M  A    GS+ Y+SPE+     
Sbjct: 493 -------------TRRGILKLIDFGASSVFHYPLSSQMIEANGIVGSDPYLSPEVFYFNE 539

Query: 421 YDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARF 467
           YD    D W++G+I + +   R P+  P     + ++  +   ++ F
Sbjct: 540 YDPRALDVWSVGIIFFCMITRRFPWKYPKVKDVQFKAFCSGRGVSSF 586

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 135/334 (40%), Gaps = 61/334 (18%)

Query: 189 PLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKET 248
           P  ++K+R +G G+   V L          +++    RL   +     E I      ++ 
Sbjct: 458 PQSFEKIRLLGQGDVGKVYL----------VREKKSDRLYALKIFGKAEMIK-----RKK 502

Query: 249 LSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMS 308
           + R+      E ++L + NHP IV L                    +T   L  C   M 
Sbjct: 503 IKRI----LAEQEILATSNHPFIVTLY----------------HSFQTEDYLYLC---ME 539

Query: 309 YCPAGDLLAAVMARNGRLEAWLIQRIF-TEVVLAVKYLHENSIIHRDLKLENILLKYSFD 367
           YC  G+   A+  R  +  +    R + +EV  A++YLH    I+RDLK ENILL  S  
Sbjct: 540 YCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLMGFIYRDLKPENILLHQSGH 599

Query: 368 DINSFRDSPIYCKQNFIELADFGLCKKIENNEMCT------ARCGSEDYVSPEILMGVPY 421
            + S  D  +  K              + + ++C+      +  G+E+Y++PE++ G   
Sbjct: 600 VMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTNSFVGTEEYIAPEVIRG--- 656

Query: 422 DGHLS--DTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRWYRLSDY-- 477
           +GH +  D W LG++ Y +     PF           +  T   I + D  +   +D   
Sbjct: 657 NGHTASVDWWTLGILTYEMLFGFTPFKG-------DNTNQTFSNILKNDVYFPNNNDISR 709

Query: 478 --KTNVGKQIVENTLTRKNQRWSINEIYESPFVK 509
             K  + K +V+    R   ++  +EI + PF K
Sbjct: 710 TCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFK 743

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 84/209 (40%), Gaps = 45/209 (21%)

Query: 246 KETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDM 305
           +ETL      +T E     +L H  I++ L               D++ +    L    +
Sbjct: 300 RETLKEYSRKVTSEFCTGSTLRHQNIIETL---------------DMLQEGELFL----V 340

Query: 306 IMSYCPAGDLLAAVMARN-GRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +M YCP  D    VM+    + E W     F ++   V YLH   + HRDLKL+N ++  
Sbjct: 341 VMEYCPY-DFFNLVMSNQMTKHEVWCY---FKQICRGVDYLHSQGLAHRDLKLDNCVV-- 394

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENN-----EMCTARCGSEDYVSPEILMGV 419
                              ++L DFG       N     E      GS+ Y++PE+L  +
Sbjct: 395 --------------TADGILKLIDFGSAIIFRYNFNSKLEPAKGIVGSDPYLAPELLTQL 440

Query: 420 PYDGHLSDTWALGVILYSLFEDRLPFDPP 448
            YD   +D W++ V+ Y +   R P+  P
Sbjct: 441 YYDPSAADVWSIAVMFYCMSLRRFPWKKP 469

>Scas_613.13*
          Length = 312

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 117/265 (44%), Gaps = 68/265 (25%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           + K + +G G ++ V L           +Q+AVK +K  E             +K+ L  
Sbjct: 14  YTKGKKVGEGTYAVVYL----GTKQSTGRQIAVKEIKTSE-------------FKDGL-- 54

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCP 311
            + S  RE++ L+ + H  +++L+ I    F+               A    ++++ + P
Sbjct: 55  -DMSAIREVKYLQEIQHDNVIELVDI----FM---------------AYDNLNLVLEFLP 94

Query: 312 AGDLLAAVMARN-----GRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
           + DL   +  R+       +++W++       +  V + H N I+HRDLK  N+LL    
Sbjct: 95  S-DLEVIIKDRSILFTPADIKSWMLM-----TLRGVHHCHRNFILHRDLKPNNLLL---- 144

Query: 367 DDINSFRDSPIYCKQNFIELADFGLCKKIEN-NEMCTARCGSEDYVSPEILMGVPYDGHL 425
                   SP       I++ADFGL + + + +EM T+   +  Y +PE+L G  +    
Sbjct: 145 --------SP----DGVIKVADFGLARAVPSPHEMLTSNVVTRWYRAPELLFGAKHYTSA 192

Query: 426 SDTWALGVILYSLFEDRLPFDPPPN 450
            D W++GVI   L   R+P+ P  N
Sbjct: 193 IDIWSVGVIFAELML-RIPYLPGQN 216

>Scas_668.22
          Length = 893

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 82/191 (42%), Gaps = 39/191 (20%)

Query: 256 LTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDL 315
           +  E+ V+K   HP IV         F+ S     DL +           IM Y   G L
Sbjct: 653 IINEILVMKGSRHPNIVN--------FIDSYLLDGDLWV-----------IMEYMEGGSL 693

Query: 316 LAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDS 375
              V   +  L    I  +  E +  +++LH   ++HRD+K +NILL  S D        
Sbjct: 694 TDVVT--HCILTEGQIGAVCRETLSGLQFLHSKGVLHRDIKSDNILLSISGD-------- 743

Query: 376 PIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
                   I+L DFG C +I E N   T   G+  +++PE++    Y G   D W+LG++
Sbjct: 744 --------IKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEY-GPKVDIWSLGIM 794

Query: 435 LYSLFEDRLPF 445
           +  + E   P+
Sbjct: 795 IIEMIEGEPPY 805

>AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH]
           (348350..350533) [2184 bp, 727 aa]
          Length = 727

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (52%), Gaps = 18/125 (14%)

Query: 315 LLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHEN-SIIHRDLKLENILLKYSFDDINSFR 373
           L   ++AR+ RLE W I +I  EV L +++LHE  SI+H DLK  NI++ +         
Sbjct: 486 LQEQLVARSKRLEDWRIWKIIVEVCLGLRFLHETCSIVHLDLKPANIMITF--------- 536

Query: 374 DSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGV 433
                  +  ++L DFG+  K+   +      G  +Y++PEI+    YD   +D ++LG+
Sbjct: 537 -------EGNLKLGDFGMATKLPLTDKAFENEGDREYIAPEIISDGIYD-FRADIFSLGL 588

Query: 434 ILYSL 438
           ++  +
Sbjct: 589 MIVEI 593

>Kwal_56.22788
          Length = 515

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 110/436 (25%), Positives = 170/436 (38%), Gaps = 123/436 (28%)

Query: 32  ALIDENGEEDKKMASTEGTTGDSRSTPLTVSIPTFENVQALPTPMTYTPLSPGNLSMSPI 91
           A+ID++ +E  ++  ++G     R   L  S P  E+   LP  +   P SP N++    
Sbjct: 20  AIIDDDEDEAFELEFSDGL----RHKNLLSSDPRAEH---LPPRLLGLPGSPSNITTG-- 70

Query: 92  DQSSLNIPKRRSHARLLDDMLSVTQPNQRVVSELIAPANLSPQRVVSLPTVTEEALVNDS 151
                   +RRS   L D M   T PN R ++       LS                   
Sbjct: 71  --------RRRS--SLYDKMSVHTPPNTRRIT-------LS------------------- 94

Query: 152 VDSDNYTKEPYFPESSSSTEKCDDDIFQGFLLDHWDRPLL-WKKVRPIGSGNFSTVLLYE 210
                 T+EP    S  S+  C   +F      H  R L  +  VR +G G +  VLL  
Sbjct: 95  ------TEEPQGSNSERSS-YCAPSVFD----KHGTRTLEDFAPVRVLGRGAYGKVLL-- 141

Query: 211 LMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTR---ELQVLKSLN 267
           + D    +L   A+K+LK  E L +    + S    +  S LE  L R   E  +L  L 
Sbjct: 142 VKDSHTSRL--YAMKQLKKAEILIH----DGSSEEGQPDSNLEKRLERTFAERTILSQLE 195

Query: 268 HPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLE 327
           HP IVKL       F    K                 +I+ + P G+L    +   G L+
Sbjct: 196 HPNIVKLF----YSFHDHHKLY---------------LILQFIPGGELFYH-LKEQGTLD 235

Query: 328 AWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELA 387
              +     E+  A+++LH+  +++RDLK EN LL                 ++  + L 
Sbjct: 236 EDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLLD----------------ERGHLVLT 279

Query: 388 DFGLCK----------------KIENNEMCTARC--GSEDYVSPEILMGVPYDGHLSDTW 429
           DFGL K                  E   +CT     G+ +Y +PEIL G PY  +  D +
Sbjct: 280 DFGLSKVSASDDSADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQN-CDWY 338

Query: 430 ALGVILYSLFEDRLPF 445
           +LG +++ +   + P+
Sbjct: 339 SLGCLIFDMLIGKPPY 354

>Scas_711.15
          Length = 727

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 68/133 (51%), Gaps = 6/133 (4%)

Query: 306 IMSYCPAGDLLAAVMARNGRLEAW-LIQRIFTEVVLAVKYLHENSIIHRDLKLENILL-- 362
           I+  C   +L   ++ R  R+ +   ++ I  +++  +K++H+++  HRD+K ENIL+  
Sbjct: 144 IVMECMEQNLYQMMLHRKKRVFSIPSLKSILAQILAGIKHIHDHNFFHRDIKPENILVSP 203

Query: 363 -KYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPY 421
            K  FD      +   Y     ++LADFGL + +EN    TA   +  Y SPEIL+   Y
Sbjct: 204 NKRYFD--KERLELGFYPDNYVVKLADFGLARHVENKNTYTAYVSTRWYRSPEILLRNGY 261

Query: 422 DGHLSDTWALGVI 434
                D WA G +
Sbjct: 262 YSTPLDIWAFGCV 274

>Scas_692.24
          Length = 718

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 88/208 (42%), Gaps = 42/208 (20%)

Query: 247 ETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMI 306
           E++       T E  +  +L+HP +++ + I    F  SK+   +   +          +
Sbjct: 252 ESVKEYAKKCTAEFCIGSTLHHPNVIETVDI----FSDSKQ---NKYFE----------V 294

Query: 307 MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
           M YCP  D  A VM   G++    I     +++  VKYLH   + HRDLKL+N ++    
Sbjct: 295 MQYCPV-DFFAVVMT--GKMSRGEINCCLKQLLEGVKYLHSMGLAHRDLKLDNCVMN--- 348

Query: 367 DDINSFRDSPIYCKQNFIELADFGLCKKI-----ENNEMCTARCGSEDYVSPEILMGV-P 420
                        +   ++L DFG          ++  M     GS+ Y++PE++     
Sbjct: 349 -------------EDGILKLIDFGSAVVFRYPYEDDIAMAHGIVGSDPYLAPEVITSTKS 395

Query: 421 YDGHLSDTWALGVILYSLFEDRLPFDPP 448
           YD    D W++G+I   +   R P+  P
Sbjct: 396 YDPQCVDIWSVGIIYCCMMLKRFPWKAP 423

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 67/142 (47%), Gaps = 20/142 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           ++M Y   G L   V   +  L    I  +  E +  +++LH   ++HRD+K +NILL  
Sbjct: 692 IVMEYMEGGSLTDVVT--HCLLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSL 749

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGVPYDG 423
             +                I+L DFG C +I ENN   T   G+  +++PE++    Y G
Sbjct: 750 KGN----------------IKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEY-G 792

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
              D W+LG+++  + E   P+
Sbjct: 793 PKVDIWSLGIMIIEMIEGEPPY 814

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 5/107 (4%)

Query: 331 IQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYS---FDDINSFRDSPIYCKQNFIELA 387
           ++ I  +V+  ++++H+ +  HRDLK ENIL+  S   FD  +S+ +   Y     ++LA
Sbjct: 184 LKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFD--SSWLEKGNYPDNYVVKLA 241

Query: 388 DFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVI 434
           DFGL + +EN    TA   +  Y SPEIL+   Y     D WA G +
Sbjct: 242 DFGLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCV 288

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (45%), Gaps = 26/149 (17%)

Query: 305 MIMSYCPAGDL--LAAVMARNGRLEA-WLIQRIFTEVVL----AVKYLHENSIIHRDLKL 357
           ++  YC  GD      +  + G L A  +I+  F +VVL    A+KY H   I HRD+K 
Sbjct: 83  LVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAIKYAHSMGIAHRDIKP 142

Query: 358 ENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILM 417
           ENIL+ Y  D                I+LAD+G    I  +       G+++Y  PE   
Sbjct: 143 ENILINYHGD----------------IKLADWG--HAISASSSNDNNIGTDNYRGPETFS 184

Query: 418 G-VPYDGHLSDTWALGVILYSLFEDRLPF 445
             V Y+ + SD W++GV L  L     PF
Sbjct: 185 AKVSYNTYRSDYWSMGVTLLYLLFSHCPF 213

>Kwal_55.22001
          Length = 363

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 105/250 (42%), Gaps = 52/250 (20%)

Query: 188 RPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKE 247
           RP+L K+ + IG G F TV+   L   +N      A+K+            +     YK 
Sbjct: 22  RPMLVKEYKKIGHGAFGTVVQAFLTPDNNKWYGPFAIKK------------VPAQTEYK- 68

Query: 248 TLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIM 307
                    +REL++L+  +HP +VKL       F T   P  + + +         + M
Sbjct: 69  ---------SRELEILRIADHPNVVKL-----EYFFTHTSPQDNKLYQ--------HLAM 106

Query: 308 SYCPAGDLLAAVMARNGRLEAWLIQ-RIFT-EVVLAVKYLHENSIIHRDLKLENILLKYS 365
              P    L      + +LE  L   +++T ++   + YLH   I HRD+K  N+L+   
Sbjct: 107 ECLPETLQLEIHRYASNKLELPLKHTKLYTYQIARGMLYLHALGICHRDIKPSNVLV--- 163

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
             D N+            +++ DFG  KK+E N+   +   S  Y +PE+++G       
Sbjct: 164 --DPNT----------GVLKICDFGSAKKLEQNQPSISYICSRFYRAPELIVGCTQYTTQ 211

Query: 426 SDTWALGVIL 435
            D W LG ++
Sbjct: 212 IDIWGLGCVM 221

>Scas_716.73
          Length = 416

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 84/183 (45%), Gaps = 43/183 (23%)

Query: 305 MIMSYCPAGDL---LAAVMARNGRLEAWLIQRIFTEVVLAVKYLH--------------- 346
           + M YC  GDL   +    +RN  +   +I  I  ++++A+   H               
Sbjct: 87  LYMEYCSRGDLSQMIKFYKSRNKYIPEKIIWGILAQLLMALYKCHYGVELSPLVTIYDRM 146

Query: 347 ------ENSIIHRDLKLENILL---------------KYSFDDIN--SFRDSPIYCKQNF 383
                 +N +IHRDLK  NI L               +Y+ +++N  + ++  +   Q  
Sbjct: 147 KPPTKGKNIVIHRDLKPGNIFLSNDNNATNNDDDAEKEYNDNNVNEPNRQNIKMDYSQVV 206

Query: 384 IELADFGLCKKIENN-EMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDR 442
           ++L DFGL K +E + +  T   G+  Y+SPE+LM  PY   LSD W+LG ++Y +    
Sbjct: 207 VKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVVYEMCSLH 265

Query: 443 LPF 445
            PF
Sbjct: 266 PPF 268

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 121/277 (43%), Gaps = 65/277 (23%)

Query: 192 WKKVRPIGSGNFSTVLLYEL-MDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLS 250
           +  V  IG G FSTV  Y++   Q+N K    A+K  KY                     
Sbjct: 444 FTNVHSIGKGQFSTV--YQVTFAQTNKKYAIKAIKPNKY--------------------- 480

Query: 251 RLENSLTRELQVLKSLNHPCIVKLLGINNPIFV--TSKKPLCDLIIKTPRALPPCDMIMS 308
              NSL R L  +K LN         + N I +    K+ + D I  +         IM+
Sbjct: 481 ---NSLKRILLEIKILNE--------VTNQITMDQEGKEYIIDYI--SSWKFQNSYYIMT 527

Query: 309 -YCPAGDLLA----AVMARNGRLEAWLIQRIFTEVVLAVKYLHEN-SIIHRDLKLENILL 362
             C  G+L       V+A+  RLE W I +I  E+ LA++++H++  I+H DLK  N+++
Sbjct: 528 ELCENGNLDGFLQEQVIAKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMI 587

Query: 363 KYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYD 422
            +                +  ++L DFG+   +   +      G  +Y++PEI+    YD
Sbjct: 588 TF----------------EGNLKLGDFGMATHLPLEDKSFENEGDREYIAPEIISDCTYD 631

Query: 423 GHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRA 459
            + +D ++LG+++  +  + +    P N +A  + R+
Sbjct: 632 -YKADIFSLGLMIVEIAANVV---LPDNGNAWHKLRS 664

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 84/181 (46%), Gaps = 32/181 (17%)

Query: 330 LIQRIFTEVVLAVKYLHENSIIHRDLKLENIL-------------LKYSFD-----DINS 371
           L + +  ++  AVKY+H+  I+HRD+K EN+L             L+ S D     D   
Sbjct: 244 LSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGV 303

Query: 372 FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
           FR          ++LADFGL K+I      T  CG+  Y +PE++    Y   + D W +
Sbjct: 304 FRPGIGGGGIGVVKLADFGLSKQIYQTNTKTP-CGTVGYTAPEVVKDERYSMQV-DMWGV 361

Query: 432 GVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWR-----WYRLSDYKTNVGKQIV 486
           G +LY++     PF         ++    + +I+R ++      W ++SD   N  ++++
Sbjct: 362 GCVLYTVLCGFPPF-------FDEKIDVLTEKISRGEYTFLRPWWDQISDGAKNCVRKLL 414

Query: 487 E 487
           E
Sbjct: 415 E 415

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 87/208 (41%), Gaps = 42/208 (20%)

Query: 247 ETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMI 306
           E++       T E  +  SL+HP +++ + +    F  SK+                  +
Sbjct: 253 ESVKEYAKKCTAEFCIGSSLHHPNVIETVDV----FSDSKQN-------------KYYEV 295

Query: 307 MSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
           M YCP  D  A VM   G++    I     ++   V+YLH   + HRDLKL+N ++  + 
Sbjct: 296 MQYCPI-DFFAVVMT--GKMSRGEINCCLKQLTEGVRYLHSMGLAHRDLKLDNCVM--TA 350

Query: 367 DDINSFRDSPIYCKQNFIELADFGLCKKI-----ENNEMCTARCGSEDYVSPEILMGV-P 420
           D I              I+L DFG          ++  M     GS+ Y++PE++     
Sbjct: 351 DGI--------------IKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPEVITSTKS 396

Query: 421 YDGHLSDTWALGVILYSLFEDRLPFDPP 448
           YD    D W++G+I   +   R P+  P
Sbjct: 397 YDPQCVDIWSIGIIYCCMMLKRFPWKAP 424

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 66/155 (42%), Gaps = 32/155 (20%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y P GD L  ++ + G L     +   ++++ AV  LH   IIHRD+K ENILL  
Sbjct: 201 FLLEYAPHGDFLG-LIKKYGSLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLD- 258

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTAR--------------CGSEDY 410
                          K   ++L DFG  K +      TA                G+ +Y
Sbjct: 259 ---------------KNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEY 303

Query: 411 VSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           VSPE L+   Y     D WA G ILY +   + PF
Sbjct: 304 VSPE-LLNDNYTDSRCDIWAFGCILYQMLAGKPPF 337

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 90/211 (42%), Gaps = 45/211 (21%)

Query: 236 VEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIK 295
           ++Q+N   + K+ L      +  E+ V+K   HP IV         F+ S     DL + 
Sbjct: 648 IKQMNLEKQPKKEL------IINEILVMKGSKHPNIVN--------FIDSYVLKGDLWV- 692

Query: 296 TPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDL 355
                     IM Y   G L   V   +  L    I  +  E +  +++LH   ++HRD+
Sbjct: 693 ----------IMEYMEGGSLTDVVT--HCILTEGQIGAVCRETLSGLEFLHSKGVLHRDI 740

Query: 356 KLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPE 414
           K +NILL    D                I+L DFG C +I E N   T   G+  +++PE
Sbjct: 741 KSDNILLSMEGD----------------IKLTDFGFCAQINELNLKRTTMVGTPYWMAPE 784

Query: 415 ILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           ++    Y G   D W+LG+++  + E   P+
Sbjct: 785 VVSRKEY-GPKVDIWSLGIMIIEMIEGEPPY 814

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 112/253 (44%), Gaps = 20/253 (7%)

Query: 195 VRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEEL------SNVEQINTSLRYKET 248
           ++ +G G+F +V L E M   N    Q++     YPE L       NVEQ N   + K  
Sbjct: 36  IQELGKGSFGSVTLAETMYDMNSSATQISSM---YPETLMDQTLIRNVEQENWYYKKKGI 92

Query: 249 LSRLENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLI-IKTPRALPPCDMIM 307
           ++    ++   L  L        +K +     + + + K L  +  +    +L    ++M
Sbjct: 93  VAI--KTMMNRLPTLHDYTRVREIKFI-----LQIPAHKNLVTIYEMFIDDSLYHLHIVM 145

Query: 308 SYCPAGDLLAAVMARNGRLEAW-LIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSF 366
             C   ++   +  R  R+ +   ++ I  +++  +K++H++   HRD+K ENIL+  S 
Sbjct: 146 E-CMEQNIYQLMKHRKRRVFSLPTLRSILFQILAGIKHIHDHDFFHRDIKPENILISPSH 204

Query: 367 DDINS-FRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
              +  + +   Y     ++LAD+GL + + N    T    +  Y SPEIL+   Y    
Sbjct: 205 RYFSKKWLEDDNYSDNYVVKLADYGLARHVNNRSPYTTYVSTRWYRSPEILLRKGYYSKP 264

Query: 426 SDTWALGVILYSL 438
            D WA G ++  L
Sbjct: 265 LDIWAYGCVVVEL 277

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 67/142 (47%), Gaps = 20/142 (14%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           ++M Y   G L   V   +  L    I  +  E +  +++LH   +IHRD+K +NILL  
Sbjct: 770 VVMEYMEGGSLTDVVT--HCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLSM 827

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGVPYDG 423
           + D                I+L DFG C +I E N   T   G+  +++PE++    Y G
Sbjct: 828 NGD----------------IKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVVSRKEY-G 870

Query: 424 HLSDTWALGVILYSLFEDRLPF 445
              D W+LG+++  + E   P+
Sbjct: 871 PKVDIWSLGIMIIEMIEGEPPY 892

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 102/227 (44%), Gaps = 43/227 (18%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y   G+LL+ +       ++W  +    ++V  ++++H   +IHRDLK EN+LL  
Sbjct: 90  FVLDYASGGELLSLLHKMGTFTDSWA-KHFAAQLVDTLEFMHARGVIHRDLKPENVLLSK 148

Query: 365 ----------SFDDINSFRDSPIYCKQNFIELADFGLCK----KIENNEMCTARCGSEDY 410
                     +    N+F D     K N    A+ G+ K       +   C++  G+ +Y
Sbjct: 149 EGILMITDFGAAATQNNFSD-----KDNTRSNANEGIPKDDVPSSGDKTECSSFVGTAEY 203

Query: 411 VSPEILMGVPYD--GHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFD 468
           VSPE+L+   Y+     SD WALG ++Y   +   PF         +    T  +I   D
Sbjct: 204 VSPELLL---YNKCSFGSDIWALGCMVYQFIQGFPPF-------RGENELKTFEKIVSLD 253

Query: 469 WRWY--RLSDYKTNVGKQIVENTLTRK------NQRWSINEIYESPF 507
           + W   R +++ T +  Q+V   L R+       QR +I++I   P+
Sbjct: 254 YSWNPERQTNFGT-INIQVV--NLVRRMLTIDTTQRATIDQIKRDPW 297

>Scas_634.5
          Length = 790

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 112/250 (44%), Gaps = 57/250 (22%)

Query: 192 WKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSR 251
           +  V  IGSG FS+V          P  K+ AVK +K             + +Y      
Sbjct: 444 FNNVHMIGSGQFSSVYQVTFA----PTNKKYAVKAVK-------------ANKY------ 480

Query: 252 LENSLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMS-YC 310
             NSL R LQ +K L+     +L        +  K+ + D I  +         IMS Y 
Sbjct: 481 --NSLNRILQEIKILDEIRTSQLD-------LEGKEYVIDFI--SSWKYQGSFYIMSEYY 529

Query: 311 PAGDLLA----AVMARNGRLEAWLIQRIFTEVVLAVKYLHEN-SIIHRDLKLENILLKYS 365
             G+L +     ++++N RLE W I +I  E+ LA++++H+   ++H DLK  NIL+ + 
Sbjct: 530 DNGNLDSFLQEQIISKNTRLEDWRIWKIIVELSLALRFIHQTCHVVHLDLKPTNILITF- 588

Query: 366 FDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMGVPYDGHL 425
                          +  ++LADFG+   +   +      G  +Y++PEI+    YD   
Sbjct: 589 ---------------EGNLKLADFGMAAHLPLRDQDFENEGDREYIAPEIISECIYDFK- 632

Query: 426 SDTWALGVIL 435
           +D ++LG+++
Sbjct: 633 ADIFSLGLMI 642

>Kwal_27.10004
          Length = 735

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 75/177 (42%), Gaps = 35/177 (19%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQ-RIFTEVVLAVKYLHENSIIHRDLKLENILLK 363
            +M YC  GDL + +   N +      +   + +VV  +K++H   ++HRD+K EN+L+ 
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIHSQGVVHRDIKPENVLI- 419

Query: 364 YSFDDINSFRDSPIYCKQNFIELADFGLCKKIENN--------EMCTARCGSEDYVSPEI 415
                           K+   ++ DFG+      +         +     GS  Y +PE+
Sbjct: 420 ---------------SKEGIAKMTDFGISDWGNEDPDDLTSPVRLFDTYVGSPPYSAPEV 464

Query: 416 LM----------GVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSH 462
           +             PYD +  D WALGV+L++L     PF     + ++ RS   S+
Sbjct: 465 VAFKDEDSTYQDRKPYDAYKMDCWALGVLLFTLVYQCTPFLDASKSDSKYRSYVLSY 521

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 99/254 (38%), Gaps = 53/254 (20%)

Query: 198 IGSGNFSTVLLYELMDQSNPKLKQVAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLT 257
           +G GNF  V L   +  +         K +    +  N+E  N  +          + L 
Sbjct: 13  VGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEHSNEPI----------DLLL 62

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           +E+  L +L+ P I    G     F       C+L I           +M YC  G LL 
Sbjct: 63  KEIYFLSTLHCPYITHYYGT----FTGD----CNLYI-----------VMEYCSNGSLLN 103

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            ++    RL       I  +V  A++YLHE  +IHRDLK  NILL    DD         
Sbjct: 104 -LLRYYSRLTEQTTCFIILQVCHALEYLHEKRLIHRDLKAANILLN---DD--------- 150

Query: 378 YCKQNFIELADFGLCKKIENNEM------CTARCGSEDYVSPEILMGVPYDGHLSDTWAL 431
                 + LAD G+  +++ N             G+  +++PEI+    YDG   D W+L
Sbjct: 151 ----GEVRLADLGVTGQLKFNSTRHGGKNLNTFVGTPFWMAPEIIKNQSYDGK-CDIWSL 205

Query: 432 GVILYSLFEDRLPF 445
           G+    L   + P 
Sbjct: 206 GITTLELLNGKPPM 219

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 70/153 (45%), Gaps = 30/153 (19%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
            ++ Y P GD L+ ++ + G L          +++ A+  +H + IIHRD+K ENILL  
Sbjct: 195 FLLEYAPNGDFLS-LIKKFGTLNEECTIYYSAQIIDAIGSMHSHGIIHRDIKPENILLDG 253

Query: 365 SFDDINSFRDSPIYCKQNFIELADFG----LCKKIENN--------EMCTARCGSEDYVS 412
           +                  I+L DFG    L KK + N           ++  G+ +YVS
Sbjct: 254 NMK----------------IKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVS 297

Query: 413 PEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
           PE+L    Y  +  D WA G ++Y +   + PF
Sbjct: 298 PELLSD-NYTDYKCDIWAFGCLVYQMIAGKPPF 329

>Scas_660.20
          Length = 957

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 76/172 (44%), Gaps = 32/172 (18%)

Query: 306 IMSYCPAGDLLAAVMARNGRLEAWLIQRIFT-EVVLAVKYLHENSIIHRDLKLENILLKY 364
           ++ Y P G+LL+ +       E W   + FT ++V  ++++H   +IHRDLK EN+LL  
Sbjct: 91  VLDYLPGGELLSLLHKMKTFSEVW--SKHFTVQLVDTLEFIHSQGVIHRDLKPENVLLD- 147

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKI-----ENNEMCTARCGSEDYVSPEILMGV 419
                   RD  +        + DFG          + N+  ++  G+ +YVSPE+L+  
Sbjct: 148 --------RDGKLM-------ITDFGAAYTTTAGNNDANKSSSSFVGTAEYVSPELLLHN 192

Query: 420 PYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFDWRW 471
                 SD WALG +++       PF         +    T  +I   D+ W
Sbjct: 193 QC-SFSSDVWALGCMIFQFVTGSPPF-------RGENELKTFEKIVALDYPW 236

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 128/292 (43%), Gaps = 53/292 (18%)

Query: 166 SSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQVAVK 225
           +S S  +CDDD     L      P  W K   IGSG+F +V  Y  M+    +L  V   
Sbjct: 390 NSESESECDDDNIVS-LPTKVVTPKSWLKGARIGSGSFGSV--YLGMNAHTGELMAVKQV 446

Query: 226 RLKYPEELSNVEQINTSLRYKETLSRLEN-------SLTRELQVLKSLNHPCIVKLLGIN 278
            L+    +++ +   +       + +L +       + + ++ +LK L+H  IV   G  
Sbjct: 447 ELEPTTVMASSDDKKSHPSSNAVVKKLTDPPQDGGRASSTKMNLLKELHHENIVTYYG-- 504

Query: 279 NPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEV 338
                            + +     ++ + Y P G  +++++   G  E  L++    + 
Sbjct: 505 -----------------SSQEGGNLNIFLEYVPGGS-VSSMLNSYGPFEEPLVKNFTRQT 546

Query: 339 VLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI--- 395
           ++ + YLH  +IIHRD+K  N+L+     DI           +  +++ DFG+ KK+   
Sbjct: 547 LVGLTYLHRKNIIHRDIKGANLLI-----DI-----------KGSVKITDFGISKKLSPL 590

Query: 396 --ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPF 445
             + N+  + + GS  +++PE++  V      +D W++G ++  +F  + PF
Sbjct: 591 NKKQNKRASLQ-GSVYWMAPEVVKQV-VTTEKADIWSVGCVVVEMFTGKHPF 640

>YKL168C (KKQ8) [3102] chr11 complement(131293..133497)
           Serine/threonine protein kinase of unknown function
           [2205 bp, 734 aa]
          Length = 734

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 64/142 (45%), Gaps = 25/142 (17%)

Query: 306 IMSYCPAGDLLAAVMARN---GRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILL 362
           +M +CPAGDL   ++ ++   GRL          +++  VK++H++ I H DLK ENIL 
Sbjct: 522 VMEFCPAGDLYGMLVGKSKLKGRLHPLEADCFMKQLLHGVKFMHDHGIAHCDLKPENIL- 580

Query: 363 KYSFDDINSFRDSPIYCKQNFIELADFGLCKKIENN-----EMCTARCGSEDYVSPEILM 417
                          +     +++ DFG     +              GSE YV+PE  +
Sbjct: 581 ---------------FYPHGLLKICDFGTSSVFQTAWERRVHAQKGIIGSEPYVAPEEFV 625

Query: 418 -GVPYDGHLSDTWALGVILYSL 438
            G  YD  L D W+ GV+  ++
Sbjct: 626 DGEYYDPRLIDCWSCGVVYITM 647

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 63/149 (42%), Gaps = 24/149 (16%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           M+M Y P  D    VM      +   I   F ++   V YLH   I HRDLKL+N ++  
Sbjct: 257 MVMEYAPY-DFFDLVMTNTMSPDE--ISCYFKQLCHGVNYLHAMGIAHRDLKLDNCVV-- 311

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIE-----NNEMCTARCGSEDYVSPEILMGV 419
                              ++L DFG     +     N    T   GS+ Y+SPE+L   
Sbjct: 312 --------------TNDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELLEMN 357

Query: 420 PYDGHLSDTWALGVILYSLFEDRLPFDPP 448
            YD  L+D W+L +I Y +   R P+  P
Sbjct: 358 HYDPRLADVWSLAIIYYCMTLKRFPWKAP 386

>Scas_721.110
          Length = 520

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 84/193 (43%), Gaps = 47/193 (24%)

Query: 258 RELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLA 317
           RE+++L++ +HP I  L+     I V S K +               MI  Y    DL  
Sbjct: 231 REIKLLQTFHHPNIATLV----EIMVESSKMVY--------------MIFEYA-DNDLTG 271

Query: 318 AVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPI 377
            +  +N  +     + +F +++  VKYLH++ I+HRD+K  NIL+               
Sbjct: 272 LLGDKNVVMSLGQRKHLFQQLLRGVKYLHDSLILHRDIKGSNILID-------------- 317

Query: 378 YCKQNFIELADFGLCKKIENNEMCTARCGSEDYVS---------PEILMGVPYDGHLSDT 428
              +  +++ DFGL +K+    + +   GS DY +         PE+LMG        D 
Sbjct: 318 --NKGNLKITDFGLARKM---HVKSDSDGSNDYTNRVITLWYRPPELLMGTTNYSTEVDM 372

Query: 429 WALGVILYSLFED 441
           W  G IL  LF +
Sbjct: 373 WGCGCILMELFNN 385

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 91/222 (40%), Gaps = 51/222 (22%)

Query: 240 NTSLRYKETLSRLEN--------SLTRELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCD 291
           N     KE  ++ EN         +T E  +  +LNHP I++ +               +
Sbjct: 461 NKIFAVKEFRTKFENESKRDYVKKITSEYCIGTTLNHPNIIETI---------------E 505

Query: 292 LIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSII 351
           ++ +  R L     +M YC   DL A VM+     E   I   F +++  V+YLH   + 
Sbjct: 506 IVYENDRIL----QVMEYCEY-DLFAIVMSNKMSYEE--ICCCFKQILTGVQYLHSIGLA 558

Query: 352 HRDLKLENILLKYSFDDINSFRDSPIYCKQNFIELADFGLCKKI-----ENNEMCTARCG 406
           HRDLKL+N ++                 ++  ++L DFG          +N    +   G
Sbjct: 559 HRDLKLDNCVIN----------------EKGIVKLIDFGAAVVFSYPFSKNLVEASGIVG 602

Query: 407 SEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPP 448
           S+ Y++PE+ +   YD    D W+  +I   +   + P+  P
Sbjct: 603 SDPYLAPEVCIFAKYDPRPVDIWSSAIIFACMILKKFPWKIP 644

>Scas_673.20*
          Length = 758

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 82/188 (43%), Gaps = 39/188 (20%)

Query: 259 ELQVLKSLNHPCIVKLLGINNPIFVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAA 318
           E+ VLK   HP I+    IN+ +       L D +           ++M Y   G L   
Sbjct: 526 EMLVLKEYQHPNIINF--INSYL-------LHDTLW----------IVMEYMDGGSLADI 566

Query: 319 VMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKYSFDDINSFRDSPIY 378
           V       E   +  I  E +  + +LH   I+HRD+K +NILL  + D           
Sbjct: 567 VSFFTPTEEQ--MATICRETLFGLNFLHSRGIVHRDIKSDNILLSMNGD----------- 613

Query: 379 CKQNFIELADFGLCKKI-ENNEMCTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYS 437
                I++ DFG C ++ E+N   T   G+  +++PE++    Y G   D W+LG+++  
Sbjct: 614 -----IKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEY-GPKVDVWSLGIMIIE 667

Query: 438 LFEDRLPF 445
           + E   P+
Sbjct: 668 MIEGEPPY 675

>Scas_584.11
          Length = 1074

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 76/172 (44%), Gaps = 26/172 (15%)

Query: 305 MIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLAVKYLHENSIIHRDLKLENILLKY 364
           +IM YC  GDL  A+       +   I  IF++++ A++++H  SI HRD+K ENIL   
Sbjct: 132 IIMEYCSGGDLYEAIKDDLVPKKTKTITHIFSQIMDAIEFVHGKSIYHRDIKPENIL--- 188

Query: 365 SFDDINSFRDSPIYCKQNFIELADFGLCKKIENNEMCTARCGSEDYVSPEILMG------ 418
                       I      I+L D+GL    E +       GSE Y++PE+         
Sbjct: 189 ------------ITGIDWTIKLTDWGLATTHETS--FDRSVGSERYMAPELFESNLDIEE 234

Query: 419 --VPYDGHLSDTWALGVILYSLFEDRLPFDPPPNASARQRSRATSHRIARFD 468
               Y     D WA+G++  ++   + PF    N S +      ++R A FD
Sbjct: 235 RKEAYKCDKVDLWAMGIVFLNIVFQKNPFS-VANQSDKSFCYFAANREALFD 285

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,961,151
Number of extensions: 824324
Number of successful extensions: 4405
Number of sequences better than 10.0: 675
Number of HSP's gapped: 3627
Number of HSP's successfully gapped: 725
Length of query: 509
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 403
Effective length of database: 12,926,601
Effective search space: 5209420203
Effective search space used: 5209420203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)