Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL045W (PRI2)52850826720.0
Scas_625.952450920020.0
CAGL0L01749g50250919130.0
Sklu_2411.1050450918860.0
Kwal_26.820650650918330.0
KLLA0F04818g49351116130.0
ABR056C48951214090.0
CAGL0H02431g141666675.0
Scas_522.6523109665.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL045W
         (519 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large s...  1033   0.0  
Scas_625.9                                                            775   0.0  
CAGL0L01749g 184351..185859 highly similar to sp|P20457 Saccharo...   741   0.0  
Sklu_2411.10 YKL045W, Contig c2411 18845-20359                        731   0.0  
Kwal_26.8206                                                          710   0.0  
KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces c...   625   0.0  
ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH] (498192..499...   547   0.0  
CAGL0H02431g 216932..221182 similar to sp|Q03496 Saccharomyces c...    30   5.0  
Scas_522.6                                                             30   5.8  

>YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large
           subunit (DNA polymerase alpha 58 kDa subunit), involved
           in synthesis of RNA primers for Okazaki fragments [1587
           bp, 528 aa]
          Length = 528

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/508 (98%), Positives = 500/508 (98%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILXXXXXXXXKKLYARLYESKLS 60
           MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIIL        KKLYARLYESKLS
Sbjct: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILSSSSSEEEKKLYARLYESKLS 60

Query: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120
           FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES
Sbjct: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120

Query: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180
           LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL
Sbjct: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180

Query: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240
           QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL
Sbjct: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240

Query: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300
           VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI
Sbjct: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300

Query: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360
           ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL
Sbjct: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360

Query: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420
           FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI
Sbjct: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420

Query: 421 LSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEM 480
           LSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEM
Sbjct: 421 LSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEM 480

Query: 481 THNSASADLEIGEQTHIAHPNLYFERSR 508
           THNSASADLEIGEQTHIAHPNLYFERSR
Sbjct: 481 THNSASADLEIGEQTHIAHPNLYFERSR 508

>Scas_625.9
          Length = 524

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/509 (72%), Positives = 436/509 (85%), Gaps = 1/509 (0%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILXXXXXXXXKKLYARLYESKLS 60
           MFRQ+KRRI+SR+NF S      ++    N   ANQ IL        K LY  +Y+SK+S
Sbjct: 1   MFRQNKRRISSRRNFDSSPFGSDNKNGNENNGGANQFILPGSTTEEEKTLYNNIYDSKIS 60

Query: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120
           FY+  PQGEITLEQFE+WAIDRLKILLEIESCLSRNK++KEIET+IKPQFQKLLPFNT+S
Sbjct: 61  FYEARPQGEITLEQFEVWAIDRLKILLEIESCLSRNKTLKEIETLIKPQFQKLLPFNTDS 120

Query: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180
             D+KKDYYSHFILRLCFCR+KELREKF+RAET LFKIRFNMLTS DQ KFV+SL+L  L
Sbjct: 121 FLDKKKDYYSHFILRLCFCRTKELREKFIRAETLLFKIRFNMLTSFDQIKFVKSLNLSKL 180

Query: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240
           QFI++EEK ELS +LYQT++ +L +QLNL +E+QRK +FQ EKFIKLPFENVIELVGNR 
Sbjct: 181 QFITDEEKTELSDKLYQTITPALIYQLNLTDENQRKLFFQNEKFIKLPFENVIELVGNRQ 240

Query: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300
            F++ G+ Y+PQFQQLNL+S EF++KLN+ L+KTYQ+LPRLNEDDRLLPILNHLSSGYTI
Sbjct: 241 AFIRKGFIYIPQFQQLNLISTEFSNKLNEALMKTYQFLPRLNEDDRLLPILNHLSSGYTI 300

Query: 301 ADFNQQ-KANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLS 359
           ADFN+  K   +    DDEINAQ+V+SEEIS+NYPLCIKNL  GLK++ HL+Y+GRQQLS
Sbjct: 301 ADFNENSKFGMYQNGNDDEINAQTVYSEEISANYPLCIKNLFRGLKEHGHLKYHGRQQLS 360

Query: 360 LFLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHT 419
           LFLKGIGLSADE+LKFWSEAFT+NG MT++KFNKEYRY+FRHNYGLEGNRINYKPWDC T
Sbjct: 361 LFLKGIGLSADESLKFWSEAFTKNGRMTVDKFNKEYRYNFRHNYGLEGNRINYKPWDCRT 420

Query: 420 ILSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479
           ILSKPRPGRG+YHGCP+RDW+ ++L+AELRSM LT +QI S+LDSC+K EYTIACTK FE
Sbjct: 421 ILSKPRPGRGEYHGCPYRDWNPDKLTAELRSMNLTPSQIASILDSCEKTEYTIACTKTFE 480

Query: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508
            THN+   DLEI +QTHI+HPNLYFERSR
Sbjct: 481 FTHNTTGTDLEIDDQTHISHPNLYFERSR 509

>CAGL0L01749g 184351..185859 highly similar to sp|P20457
           Saccharomyces cerevisiae YKL045w PRI2, start by
           similarity
          Length = 502

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/509 (70%), Positives = 419/509 (82%), Gaps = 19/509 (3%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILXXXXXXXXKKLYARLYESKLS 60
           MFRQSK+R++ R+NF+          D G+ +A   II+        KKLY R+YE+KLS
Sbjct: 1   MFRQSKKRVSMRRNFAE---------DRGDASA---IIIGATTTEEEKKLYQRIYENKLS 48

Query: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNT-E 119
           FYD+PPQGEITLE+FEIWAIDRLK+LLEIESCL+RNK++KEIE IIKP F+K   FN  +
Sbjct: 49  FYDIPPQGEITLEEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMD 108

Query: 120 SLEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPL 179
           + EDRKK+YYSHFILRLCFC+SKELR+KFVR ET L ++RFNML+STDQ KFV+SL+LP 
Sbjct: 109 TFEDRKKEYYSHFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPS 168

Query: 180 LQFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNR 239
           LQFI  EEKAELS QLYQT+S  LQF LNL +E QR+ YF+ EKFIKLPFE+VIELVGNR
Sbjct: 169 LQFIDEEEKAELSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNR 228

Query: 240 LVFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYT 299
            VFLK+GYAYLPQFQQLNL++NEF++KL +ELIKTYQYLPRLNEDDRL+PILNHLSSGYT
Sbjct: 229 QVFLKNGYAYLPQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYT 288

Query: 300 IADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLS 359
           IAD     + QF  N D+EINA+SVWSEEIS +YPL +KNL  GLK+N+HLRY+GRQQL+
Sbjct: 289 IADSGSFDS-QFGNNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLT 347

Query: 360 LFLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHT 419
           LFLKGIGLS DEALKFW +AFT+N  MT EKFNKEYRY+ RH+YGLEGNRINYKPWDC T
Sbjct: 348 LFLKGIGLSVDEALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRT 407

Query: 420 ILSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479
           ILSKPRP RG+YHGCPFRDW+H+RL++EL  M LT  QI  VLDSC K EYTIACTKVFE
Sbjct: 408 ILSKPRPNRGEYHGCPFRDWNHDRLTSELSKMGLTTQQITDVLDSCDKHEYTIACTKVFE 467

Query: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508
           MTHN        GE  HI+HPNLYFERSR
Sbjct: 468 MTHNVPE-----GESMHISHPNLYFERSR 491

>Sklu_2411.10 YKL045W, Contig c2411 18845-20359
          Length = 504

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/509 (70%), Positives = 433/509 (85%), Gaps = 17/509 (3%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILXXXXXXXXKKLYARLYESKLS 60
           MFRQ+KR+I+SR+NF +            +T+A+ Q IL        +KLY +LY SK+S
Sbjct: 1   MFRQTKRKISSRRNFDN------------STDASGQFILQATTSEGEQKLYEKLYSSKIS 48

Query: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120
           FYDLPPQGEITL+QFE WAIDRLKILLEIESC+ RNK+IKEIETI+KP  QK LP+NT+S
Sbjct: 49  FYDLPPQGEITLDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDS 108

Query: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180
            +DRKKDYYSHFILRLCFCRSKELREKF R+ET LFKIRFNMLTS DQTKFVQSL+LPLL
Sbjct: 109 FQDRKKDYYSHFILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLL 168

Query: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240
           QFIS+EEKA LS QLYQT++ +LQFQL+L+EE QR+Q+FQQEKFIKLPFE+VIELVG+R 
Sbjct: 169 QFISDEEKANLSQQLYQTIAPALQFQLSLSEEQQRRQFFQQEKFIKLPFESVIELVGSRQ 228

Query: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300
           VF+  G+AYLPQFQQLN ++NEF++KL+ E++KTYQ+LPRLNEDDRLLPIL+HLSSGY I
Sbjct: 229 VFVSRGFAYLPQFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAI 288

Query: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360
            DF QQ+ N++  +  D I A+ V+S+EI SN+PLC KNLM GL+ NHHLRY GRQQLSL
Sbjct: 289 VDF-QQQGNEYGADNGD-ITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSL 346

Query: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420
           FLKGIGL+ DEALKFWS+AF RNG M+++KFNKEY+Y+FRHNYGLEGNRINYKPWDC TI
Sbjct: 347 FLKGIGLNVDEALKFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTI 406

Query: 421 LSKPRPGRGDYHGCPFRDWSHERLSAEL-RSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479
           LSKPRP RG++HGCP+RDW+ E+LS+EL +++KLT  Q+  VLDSCQ+ E+T+ACTKVFE
Sbjct: 407 LSKPRPARGEFHGCPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFE 466

Query: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508
           +TH S++   EI EQ+HIAHPNLY++RSR
Sbjct: 467 LTHGSSTT--EINEQSHIAHPNLYYDRSR 493

>Kwal_26.8206
          Length = 506

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/509 (67%), Positives = 413/509 (81%), Gaps = 15/509 (2%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILXXXXXXXXKKLYARLYESKLS 60
           MFRQ+KRRI SR+NF+           VG+  ++ + IL         KLY  LYESKLS
Sbjct: 1   MFRQAKRRITSRRNFAG---------QVGD--SSGKFILDGTTTEEESKLYESLYESKLS 49

Query: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120
           FY +PP+GEITLEQFE+WAI+RLK+LLEIESC+ RNKS KE+E I+KP   KLLP  ++ 
Sbjct: 50  FYQMPPKGEITLEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDD 109

Query: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180
           L+DRKKDYYSHFILRLCFCRSKELR+K +R+ET L K+RFNMLTS DQ KFVQ+L+LP L
Sbjct: 110 LQDRKKDYYSHFILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFL 169

Query: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240
           QFI++EEK +LS QLYQT+S++LQFQLNL +E QR+QYF QEKFIKLPFE+VI+LVG+R 
Sbjct: 170 QFITDEEKEQLSTQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQ 229

Query: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300
           VF+K GYAYLPQFQQLN ++NEF++ L+  L KTYQ +PRLNEDDRLLPIL+HLSSGYTI
Sbjct: 230 VFIKKGYAYLPQFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTI 289

Query: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360
           ++F QQ     +     E+ A SV+S++I  N+PLC KNLM GLK+NHHLRY GRQQLS 
Sbjct: 290 SNFQQQDQFNQASQ--GEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSF 347

Query: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420
           FLKGIG+  DEAL+FWS+AFT  G+MT +KF KEYRY+FRHNYGLEGNRINYKPWDC TI
Sbjct: 348 FLKGIGMDVDEALQFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTI 407

Query: 421 LSKPRPGRGDYHGCPFRDWSHERLSAEL-RSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479
           LS+PRP RG+YHGCP+RDW+ +RLS EL + M LT AQ+ SVLDS Q+ EYTIACTKVFE
Sbjct: 408 LSRPRPSRGEYHGCPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFE 467

Query: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508
           MTH  A A++E+ +QTHIAHPNLY+ERSR
Sbjct: 468 MTHGGA-ANVEVNDQTHIAHPNLYYERSR 495

>KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces
           cerevisiae YKL045w PRI2 DNA-directed DNA polymerase
           alpha, 58 KD subunit (DNA primase) singleton, start by
           similarity
          Length = 493

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/511 (60%), Positives = 383/511 (74%), Gaps = 31/511 (6%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDV---GNTNAANQIILXXXXXXXXKKLYARLYES 57
           MFRQ+K+R+A+R+NF   D   ++ +DV   GN +   Q              Y  LY +
Sbjct: 1   MFRQTKKRVANRRNFVGDD---QNRIDVTGYGNQDDGMQ--------------YDILYPT 43

Query: 58  KLSFYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFN 117
           KL++Y LPP+GEITLEQFE WAIDRLK+LLE+ES   RNKS+KEIET IKP     L   
Sbjct: 44  KLTWYRLPPKGEITLEQFETWAIDRLKVLLELESLWQRNKSMKEIETTIKPVLSSKLNLG 103

Query: 118 TESLEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDL 177
            ++ E RKKDYYSHFILRLCFCRSKELR+KFVRAET LFKIRF MLT+ DQ  F+ SLDL
Sbjct: 104 NDN-ESRKKDYYSHFILRLCFCRSKELRDKFVRAETLLFKIRFQMLTTQDQLNFISSLDL 162

Query: 178 PLLQFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVG 237
           P +  I  EEK  LS +LYQTVS  L FQLNL EE QR+Q+F +EK+ KLP ENV++LVG
Sbjct: 163 PYVNSIDEEEKQSLSTELYQTVSHLLTFQLNLTEETQRRQFFNREKYYKLPMENVMDLVG 222

Query: 238 NRLVFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSG 297
           +R +F+K G+AY+PQFQQLNL+SNEF+  L  EL+ TYQ +P+LNEDDR+LPIL+HLSSG
Sbjct: 223 SRQIFIKKGWAYVPQFQQLNLISNEFSDCLQTELMGTYQMIPKLNEDDRILPILHHLSSG 282

Query: 298 YTIADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQ 357
           Y + +   Q+ N     V+DE   +SV ++++  ++PLC K LME L+ NHHLRY GRQQ
Sbjct: 283 YVVTE--SQELN--GAGVNDEFTHRSVKTKKVMEHFPLCAKQLMEQLQTNHHLRYQGRQQ 338

Query: 358 LSLFLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDC 417
           LS FLKGIGLS DEAL+FW+E+FT  G MT+++FNKEY+Y+FRHNYGLEGNRINYKPWDC
Sbjct: 339 LSFFLKGIGLSVDEALQFWTESFTSGGKMTVDQFNKEYKYNFRHNYGLEGNRINYKPWDC 398

Query: 418 HTILSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKV 477
            TILSKPRP RG+YHGCP+RD+  ++L A L+ M LTQ Q+ SV++SCQ+ +YTIACTKV
Sbjct: 399 RTILSKPRPSRGEYHGCPYRDYHPDKLVATLKEMSLTQQQVNSVVESCQQQDYTIACTKV 458

Query: 478 FEMTHNSASADLEIGEQTHIAHPNLYFERSR 508
           FE  H + +ADL+      I HPN YFERSR
Sbjct: 459 FEAVHKTTTADLQ------IVHPNQYFERSR 483

>ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH]
           (498192..499661) [1470 bp, 489 aa]
          Length = 489

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/512 (52%), Positives = 354/512 (69%), Gaps = 29/512 (5%)

Query: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILXXXXXXXXKKLYARLYESKLS 60
           MFRQSKRR+A R++    D         G T      IL        +  Y +LY +KLS
Sbjct: 1   MFRQSKRRVAQRRHGDGAD---------GAT------ILAGLTAEEEQARYDQLYPAKLS 45

Query: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120
           FY LPP GEITL+QFE WAIDRLK+LLE+ES + RN++ +E+E  +KP   KLL    E 
Sbjct: 46  FYALPPVGEITLDQFETWAIDRLKVLLELESLIQRNRAGRELEQAMKPLLGKLL-PLGEE 104

Query: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180
            E R+KDYYSHFILRLCFCR+ ELRE+FVRAET LF++RF MLTS DQ +FVQSLDLPL+
Sbjct: 105 QEARRKDYYSHFILRLCFCRTAELRERFVRAETALFRLRFQMLTSADQARFVQSLDLPLV 164

Query: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240
           QFI   EK  L  QLY  V+  L  QL L +E QR+Q+FQ E+F+KLPFE+VI+LVG R 
Sbjct: 165 QFIDEAEKQALGAQLYDAVAPQLLHQLQLTDEAQRRQFFQHERFLKLPFESVIDLVGPRH 224

Query: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300
           V L+ G+AYLPQF QLN ++ E+A++L  +L  TYQ+LP L  DDRL PIL HLS+G+ +
Sbjct: 225 VLLRGGWAYLPQFMQLNHIAAEYAARLATDLRATYQHLPALAGDDRLPPILAHLSAGHVV 284

Query: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360
           A                 + A  + +E + +  PLC + L++GL  NHHLRY GRQQL+L
Sbjct: 285 APPPPPTGGG--------LTAADLAAEPVRAALPLCARGLLDGLAANHHLRYLGRQQLAL 336

Query: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420
           FLKG G+SAD+AL+FW++AFT  G  ++++FN+EYRY+ RH YGLEGNRINY+PWDC TI
Sbjct: 337 FLKGAGMSADDALRFWADAFT-AGPTSLDRFNREYRYALRHTYGLEGNRINYRPWDCRTI 395

Query: 421 LSKPRPGRGDYHGCPFRDWSHERLSAELRSMKLTQAQIISVLDSCQKGEYTIACTKVFEM 480
           L+KPRP R ++HGCP+RDW+ +RL+A L +M+L    + +V D+C + EYT+ACT VF+ 
Sbjct: 396 LAKPRPARNEFHGCPYRDWAPDRLAAALAAMQLAPPAVAAVRDACARREYTLACTHVFDA 455

Query: 481 THN----SASADLEIGEQTHIAHPNLYFERSR 508
            H     SA   +   + +HI HPN +FER+R
Sbjct: 456 CHGHVAPSAPGHVPAPDMSHIVHPNQFFERAR 487

>CAGL0H02431g 216932..221182 similar to sp|Q03496 Saccharomyces
           cerevisiae YMR259c, hypothetical start
          Length = 1416

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 306 QKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLK-KNHHLRYYGRQQLSLFLK- 363
           QKAN+F E V  +++  ++  E +S  Y + I +L+ G   ++HHL   G + L LFL+ 
Sbjct: 387 QKANKFPEEVQQKLSTVTLAREFLSKVYEIVIFHLLPGSSYQSHHL---GLKFLRLFLEL 443

Query: 364 GIGLSA 369
           GI   A
Sbjct: 444 GIDKKA 449

>Scas_522.6
          Length = 523

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 13/109 (11%)

Query: 109 QFQKLLPFNTESLEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQ 168
           +  K+L    ESL D+K  +          C     RE+F R    +F +RF +L    +
Sbjct: 330 RLTKMLELVEESLGDKKDGFTVSDAADALNCS----REEFTRDYLTIFPVRFQVLKLYQR 385

Query: 169 TKFVQSLDLPL---LQFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQ 214
            K V S  L +   LQ I++E + E   + +       QF   +NE  Q
Sbjct: 386 AKHVYSEALRVLKALQLITHESQYERESEFFS------QFGQLMNESQQ 428

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,845,112
Number of extensions: 751199
Number of successful extensions: 2519
Number of sequences better than 10.0: 38
Number of HSP's gapped: 2565
Number of HSP's successfully gapped: 38
Length of query: 519
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 413
Effective length of database: 12,926,601
Effective search space: 5338686213
Effective search space used: 5338686213
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)