Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL043W (PHD1)36636018240.0
YMR016C (SOK2)7851285351e-61
CAGL0L01771g4351265144e-61
Scas_106.14231485127e-61
Scas_709.527251135271e-60
ABR055C6781065111e-58
Scas_625.85211055003e-58
KLLA0F04840g6361065021e-57
Kwal_26.81765921284957e-57
CAGL0M07634g2571073803e-43
KLLA0E05357g754771342e-08
YDL056W (MBP1)833771154e-06
Sklu_1824.21791181088e-06
Scas_510.21043801111e-05
AFR600C815771092e-05
Kwal_27.107569221221093e-05
CAGL0D01012g802771074e-05
YER111C (SWI4)1093911057e-05
Kwal_26.9359742771041e-04
Sklu_2055.3743771031e-04
KLLA0E20867g9331411012e-04
Scas_683.37820771003e-04
AGL297C97080985e-04
CAGL0A04565g1041102950.001
YCL004W (PGS1)521155730.44
YJR053W (BFA1)57464701.0
CAGL0M11902g373212672.0
CAGL0H08437g141083654.4
Kwal_23.3679235102644.8
CAGL0F01727g25058644.8
Sklu_2220.432386635.8
KLLA0F23716g554217646.6
AAL003W508145637.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL043W
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   707   0.0  
YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   210   1e-61
CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   202   4e-61
Scas_106.1                                                            201   7e-61
Scas_709.52                                                           207   1e-60
ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   201   1e-58
Scas_625.8                                                            197   3e-58
KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   197   1e-57
Kwal_26.8176                                                          195   7e-57
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   150   3e-43
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    56   2e-08
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    49   4e-06
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         46   8e-06
Scas_510.2                                                             47   1e-05
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    47   2e-05
Kwal_27.10756                                                          47   3e-05
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    46   4e-05
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    45   7e-05
Kwal_26.9359                                                           45   1e-04
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            44   1e-04
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    44   2e-04
Scas_683.37                                                            43   3e-04
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    42   5e-04
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    41   0.001
YCL004W (PGS1) [533] chr3 (109104..110669) Phosphatidylglyceroph...    33   0.44 
YJR053W (BFA1) [2947] chr10 (533941..535665) Component of a spin...    32   1.0  
CAGL0M11902g 1180502..1181623 similar to sp|P28003 Saccharomyces...    30   2.0  
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    30   4.4  
Kwal_23.3679                                                           29   4.8  
CAGL0F01727g 171213..171965 similar to sp|P54964 Saccharomyces c...    29   4.8  
Sklu_2220.4 YLR059C, Contig c2220 8039-9010 reverse complement         29   5.8  
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    29   6.6  
AAL003W [184] [Homologous to ScYCL004W (PGS1) - SH] complement(3...    29   7.7  

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/360 (95%), Positives = 345/360 (95%)

Query: 1   MYHVPEMRLHYPLVNTQSNAAITPTRSYDNTLPSFNELSHQSTINLPFVQRETPNAYANV 60
           MYHVPEMRLHYPLVNTQSNAAITPTRSYDNTLPSFNELSHQSTINLPFVQRETPNAYANV
Sbjct: 1   MYHVPEMRLHYPLVNTQSNAAITPTRSYDNTLPSFNELSHQSTINLPFVQRETPNAYANV 60

Query: 61  AQLATSPTQAKSGYYCRYYAVXXXXXXXXXXXXXXXAVLPYATIPNSNFQPSSFPVMAVM 120
           AQLATSPTQAKSGYYCRYYAV               AVLPYATIPNSNFQPSSFPVMAVM
Sbjct: 61  AQLATSPTQAKSGYYCRYYAVPFPTYPQQPQSPYQQAVLPYATIPNSNFQPSSFPVMAVM 120

Query: 121 PPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTATTRTPGVSST 180
           PPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTATTRTPGVSST
Sbjct: 121 PPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTATTRTPGVSST 180

Query: 181 SVLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRS 240
           SVLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRS
Sbjct: 181 SVLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRS 240

Query: 241 EKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASL 300
           EKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASL
Sbjct: 241 EKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASL 300

Query: 301 TPKSSPAPIKQEPSDNKHEIATEIKPKSIDALSNGASTQGAGELPHLKINHIDTEAQTSR 360
           TPKSSPAPIKQEPSDNKHEIATEIKPKSIDALSNGASTQGAGELPHLKINHIDTEAQTSR
Sbjct: 301 TPKSSPAPIKQEPSDNKHEIATEIKPKSIDALSNGASTQGAGELPHLKINHIDTEAQTSR 360

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  210 bits (535), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%)

Query: 167 TVTATTRTPGVSSTSVLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNV 226
           T  AT      +S S+++PRV TTMWEDE T+CYQVEANGISVVRRADN+M+NGTKLLNV
Sbjct: 395 TTNATGSNTSGTSASIIRPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNV 454

Query: 227 TKMTRGRRDGILRSEKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIE 286
           TKMTRGRRDGIL++EK+R VVKIGSMHLKGVWIPFERA  +AQRE+I D+LYPLF++DI+
Sbjct: 455 TKMTRGRRDGILKAEKIRHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQ 514

Query: 287 SIVDARKP 294
           S++    P
Sbjct: 515 SVLKQNNP 522

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  202 bits (514), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (85%), Gaps = 7/126 (5%)

Query: 185 PRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR 244
           PR+ITT+WEDENT+CYQVEANG+SVVRRADN+MINGTKLLNVTKMTRG+RDGILRSEK R
Sbjct: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260

Query: 245 EVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASLTPKS 304
           +VVKIGSMHLKGVWIPFERA  +A+RE+I+D LYPLFV+DI S++       K SL P S
Sbjct: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVL-------KTSLKPSS 313

Query: 305 SPAPIK 310
              P++
Sbjct: 314 LVIPMQ 319

>Scas_106.1
          Length = 423

 Score =  201 bits (512), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 94/148 (63%), Positives = 118/148 (79%), Gaps = 7/148 (4%)

Query: 184 KPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKV 243
           +PRV TTMWEDE T+CYQVEA G+SVVRRADN+MINGTKLLNVTKMTRGRRDGIL++EK+
Sbjct: 153 RPRVTTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEKI 212

Query: 244 REVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIV-----DARKPSNKA 298
           R VVKIGSMHLKGVWIPF+RA  +AQRE+I+D L+PLFV+DI+S++      A  PS+ A
Sbjct: 213 RHVVKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAPSAPYPSSTA 272

Query: 299 SLTPKSSPAPIKQEPSDNKHEIATEIKP 326
            +T  +S A      + NK+ I++ + P
Sbjct: 273 DVT--ASVATNNSNSTANKNAISSSLLP 298

>Scas_709.52
          Length = 725

 Score =  207 bits (527), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 90/113 (79%), Positives = 102/113 (90%)

Query: 182 VLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSE 241
            +KPRV TTMWEDE TICYQVEANG+SVVRRADN+MINGTKLLNVTKMTRGRRDGIL+SE
Sbjct: 381 FVKPRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSE 440

Query: 242 KVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKP 294
           K+R VVKIGSMHLKGVW+PFERA ++A RE ILD LYPLFV+DIES++   +P
Sbjct: 441 KIRHVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRP 493

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%)

Query: 185 PRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR 244
           PRV TTMWEDE+T+CYQVEANG+SVVRRADN+MINGTKLLNV KMTRGRRDGIL++EKVR
Sbjct: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388

Query: 245 EVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVD 290
            VVKIGSMHLKGVWIPFERA  LAQRE+I+D L+PLFV+DI+S++ 
Sbjct: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQ 434

>Scas_625.8
          Length = 521

 Score =  197 bits (500), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 99/105 (94%)

Query: 185 PRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR 244
           PRVITTMWEDE T+CYQVE NG++VVRRADN+MINGTKLLNVTKMTRGRRDGILR+EKVR
Sbjct: 208 PRVITTMWEDERTLCYQVECNGVAVVRRADNDMINGTKLLNVTKMTRGRRDGILRAEKVR 267

Query: 245 EVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIV 289
            V+KIGSMHLKGVWIPF+RA ++A+RE+I+D LYPLFVKDI SI+
Sbjct: 268 SVIKIGSMHLKGVWIPFDRALMMAKREKIVDLLYPLFVKDINSIL 312

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  197 bits (502), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 100/106 (94%)

Query: 184 KPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKV 243
           + +V TTMWEDENT+CYQVEANG+SVVRRADN+MINGTKLLNVT+MTRGRRDGIL++EK+
Sbjct: 362 RSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKI 421

Query: 244 REVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIV 289
           R VVKIGSMHLKGVWIPFERA ++AQRE+I+D LY LFV+DI+SI+
Sbjct: 422 RHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSII 467

>Kwal_26.8176
          Length = 592

 Score =  195 bits (495), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 108/128 (84%), Gaps = 2/128 (1%)

Query: 187 VITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVREV 246
           V TTMWEDE+T+CYQVEANG+SVVRRADN+MINGTKLLNV KMTRGRRDGIL++EK+R V
Sbjct: 217 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV 276

Query: 247 VKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASLTPKSSP 306
           VKIGSMHLKGVWIPF+RA  +AQRE+I+D L+PLFV+DI+S++  ++ ++   + P +S 
Sbjct: 277 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVI--QQGASTVLVGPAASG 334

Query: 307 APIKQEPS 314
           A     PS
Sbjct: 335 ATAGGMPS 342

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  150 bits (380), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%)

Query: 183 LKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK 242
           L  RVITT WEDE+TIC+ V  NG++VVRRADN+M+NGTKLLNVT MTRGRRDGIL++E 
Sbjct: 118 LLSRVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEP 177

Query: 243 VREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIV 289
           VR+VVK G M LKGVWIP +RA  +A++E I   LYPLF+ D+   +
Sbjct: 178 VRDVVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQAI 224

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKV---REVVKIGSMHLKGVWIPFERA 264
           S+++R  +N +N T +L   K  + +R  IL  E +    E V+ G    +G WIP E A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 265 YILAQREQILDHLYPLF 281
             LA++ ++LD L PLF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVREV---VKIGSMHLKGVWIPFERA 264
           S+++R  ++ +N T +L      + +R  IL  E ++E    V+ G    +G W+P   A
Sbjct: 24  SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIA 83

Query: 265 YILAQREQILDHLYPLF 281
             LA++  + D L PLF
Sbjct: 84  KQLAEKFSVYDQLKPLF 100

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 53/118 (44%), Gaps = 15/118 (12%)

Query: 199 CYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK---VREVVKIGSMHLK 255
           CY        V+RR  +N +N T++  +   ++ +R  IL  E      E ++ G    +
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKIQGGYGRFQ 87

Query: 256 GVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSN------KASLTPKSSPA 307
           G WIP E A  L  + ++ D    + VK I S +    PSN      K S+  K SPA
Sbjct: 88  GTWIPLENARYLVSKYKVDD----IIVKTILSFIP--DPSNLPPRRSKNSVIKKLSPA 139

>Scas_510.2
          Length = 1043

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 199 CYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK---VREVVKIGSMHLK 255
           CY        V+RR  ++ IN T++  +   ++  R  +L  E    + E V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 256 GVWIPFERAYILAQREQILD 275
           G WIP E A +L Q+ +I D
Sbjct: 124 GTWIPLESALMLVQKYKIND 143

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR---EVVKIGSMHLKGVWIPFERA 264
           S+++R  ++ +N T +L   K  + +R  IL  E ++   E V+ G    +G W+P + A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 265 YILAQREQILDHLYPLF 281
             LAQ+ ++L+ L PLF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>Kwal_27.10756
          Length = 922

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 54/122 (44%), Gaps = 9/122 (7%)

Query: 199 CYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK---VREVVKIGSMHLK 255
           CY        V+RR  ++ +N T++  +   ++ +R  IL  E      E ++ G    +
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQ 105

Query: 256 GVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKP---SNKASLTPKSSPAPIKQE 312
           G WIP E A+ L Q+  + D +       +   +D R P    +K S+  K SP    Q 
Sbjct: 106 GTWIPLENAHYLVQKYSVSDVVVSTI---LHFQLDPRNPPLRRSKNSVIKKQSPGTKIQS 162

Query: 313 PS 314
           PS
Sbjct: 163 PS 164

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVREV---VKIGSMHLKGVWIPFERA 264
           S+++R ++  +N T +L      + +R  IL  E ++E+   V+ G    +G W+P   A
Sbjct: 24  SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIA 83

Query: 265 YILAQREQILDHLYPLF 281
             LA++  +   L PLF
Sbjct: 84  INLAEKFDVYQDLKPLF 100

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 188 ITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK---VR 244
           I T  E +   CY        V+RR  ++ IN T++  + + ++ +R  IL  E      
Sbjct: 39  IATYSETDVYECYIRGFETKIVMRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQH 98

Query: 245 EVVKIGSMHLKGVWIPFERAYILAQREQILD 275
           E V+ G    +G WIP + A  L  + +I+D
Sbjct: 99  EKVQGGYGRFQGTWIPLDSAKFLVNKYEIID 129

>Kwal_26.9359
          Length = 742

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVR---EVVKIGSMHLKGVWIPFERA 264
           S+++R +++ +N T +L   K  + +R  IL  E ++   E V+ G    +G W+P + A
Sbjct: 25  SIMKRKEDDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 84

Query: 265 YILAQREQILDHLYPLF 281
             LA + ++L  L PLF
Sbjct: 85  RNLAAKFEVLSELKPLF 101

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVREV---VKIGSMHLKGVWIPFERA 264
           S+++R  ++ +N T +L   K  + +R  IL  E ++++   V+ G    +G W+P + A
Sbjct: 27  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDIHEKVQGGFGKYQGTWVPLDIA 86

Query: 265 YILAQREQILDHLYPLF 281
             LA +  +++ L PLF
Sbjct: 87  RKLASKFDVMEELKPLF 103

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 13/141 (9%)

Query: 199 CYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK---VREVVKIGSMHLK 255
           CY  +     ++RR ++N +N T++      T+ +R  IL  E      E ++ G    +
Sbjct: 109 CYTKDKPPCLIMRRCNDNWLNITQVFKAGSFTKAQRTKILEKEANEIKHEKIQGGYGRFQ 168

Query: 256 GVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASLTPK-------SSPAP 308
           G WIP+E    L ++  I + +    V+ I    D     +K S   K       +SP+ 
Sbjct: 169 GTWIPWESTKYLVEKYNINNKVVKRIVEFIPDPNDMPPRRSKVSQIKKLDPNARITSPSA 228

Query: 309 IKQEPSDNKHEIATEIKPKSI 329
            K+ P  N     T +K KSI
Sbjct: 229 YKKTPKKN---AKTPMKKKSI 246

>Scas_683.37
          Length = 820

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 208 SVVRRADNNMINGTKLLNVTKMTRGRRDGILRSE---KVREVVKIGSMHLKGVWIPFERA 264
           SV++R  ++ +N T +L      + +R  IL  E   +  E V+ G    +G W+P E A
Sbjct: 24  SVMKRKKDDWVNATHILKAANFAKAKRTRILDKEVMGRKHEKVQGGFGKYQGTWVPLEIA 83

Query: 265 YILAQREQILDHLYPLF 281
             LA +  + + L  LF
Sbjct: 84  TELAMKFDVYEELRALF 100

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 199 CYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKV---REVVKIGSMHLK 255
           CY        V+RR  ++ +N T++  V   ++ +R  IL  E      E ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 256 GVWIPFERAYILAQREQILD 275
           G WIP + A  L  + +I D
Sbjct: 93  GTWIPLDSAKGLVAKYEITD 112

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 46/102 (45%), Gaps = 4/102 (3%)

Query: 176 GVSSTSVLKPRVITTMWEDENTI-CYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRR 234
            V ++S + P +    + D +   CY        V+RR  ++ +N T++  + + ++ +R
Sbjct: 28  AVDTSSGMAPIIEIATYADTDVYECYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQR 87

Query: 235 DGILRSEKV---REVVKIGSMHLKGVWIPFERAYILAQREQI 273
             IL  E      E V+ G    +G W+P E A  +  +  I
Sbjct: 88  TKILEKESTNMKHEKVQGGYGRFQGTWVPLEAAKFMTTKYNI 129

>YCL004W (PGS1) [533] chr3 (109104..110669)
           Phosphatidylglycerophosphate synthase, the first enzyme
           of the cardiolipin biosynthetic pathway [1566 bp, 521
           aa]
          Length = 521

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 113 SFPVMAVMPPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTATT 172
           S P+ AV        G F   ++P ++  P+    ND S  +   L  ++  +    + T
Sbjct: 284 SLPITAV--------GQFSTLVYPISQFTPLFPKYNDKSTEKRTILSLLSTITSNAISWT 335

Query: 173 RTPGVSSTS-VLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLN---VTK 228
            T G  +    +K +++ T   + N I     ANG    +   +N+      L+   +  
Sbjct: 336 FTAGYFNILPDIKAKLLATPVAEANVITASPFANGFYQSKGVSSNLPGAYLYLSKKFLQD 395

Query: 229 MTRGRRD-GILRSEKVREVVKI---GSMHLKGVWI 259
           + R R+D  I   E  R VV      S H KG+W+
Sbjct: 396 VCRYRQDHAITLREWQRGVVNKPNGWSYHAKGIWL 430

>YJR053W (BFA1) [2947] chr10 (533941..535665) Component of a spindle
           assembly checkpoint pathway, acts downstream of Bub2p to
           block cytokinesis [1725 bp, 574 aa]
          Length = 574

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 142 PIIQNTND---TSVARPNNLKSIAAASPTVTATTRTPGVSSTSVLKPRVITTMWEDENTI 198
           P + N ND    S A    L+   +   T+  TT TP +SST  L  R +   + +EN  
Sbjct: 466 PFVSNDNDGVYQSTAAQARLRKYHSMR-TLNGTTETPEISSTFHLSSRALEKFYHEENRW 524

Query: 199 CYQV 202
           C ++
Sbjct: 525 CKKL 528

>CAGL0M11902g 1180502..1181623 similar to sp|P28003 Saccharomyces
           cerevisiae YAL034c FUN19, hypothetical start
          Length = 373

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 76/212 (35%), Gaps = 61/212 (28%)

Query: 130 FLNT-LHPHTELPPIIQNTNDTSVARPNNLKSIAAAS-----PTVTATTRTP-------- 175
           F NT  H +T+LPPI Q T  + +A+P ++     AS     P    T R+P        
Sbjct: 167 FYNTRYHHYTQLPPISQITGQSVLAKPKSVTKRHFASPPNSPPKKRKTERSPTSSQFQQH 226

Query: 176 --------GVSSTSVLKPRVITTMWED------------ENTICYQVEANG--------- 206
                    + + + +   V    WE             +N +C ++E  G         
Sbjct: 227 HNPNPNIVSIKAVASVPQYVPGISWEQLPDYSPPLSTLPDNKLCLRIEWKGNPMDLSVDP 286

Query: 207 ------------ISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVREVVKIGSMHL 254
                        S++R   +  ++  K L + K+ + ++    R    ++  KI     
Sbjct: 287 LRSKLHPAEIVLASILRLPCDLYLDSKKRLFLEKVYKLKKGMPFRKTDAQKACKIDVNKA 346

Query: 255 KGVWIPFERAYILAQREQILDHLYPLFVKDIE 286
             ++  FE+   L       DH +  ++ DI+
Sbjct: 347 SRLFTAFEKVGWLE------DHHFQKYLNDIQ 372

>CAGL0H08437g complement(825191..829423) similar to sp|P22219
           Saccharomyces cerevisiae YBR097w VPS15, start by
           similarity
          Length = 1410

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 13/83 (15%)

Query: 111 PSSFPVMAVMPPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTA 170
           PS+F +  VMP  V FD  F   LHP T         ND  V   N++K   + S T T 
Sbjct: 874 PSNFSIENVMPNTVFFDIEF---LHPET------LTFNDLDVTNTNSIKE--SESNTFTD 922

Query: 171 T-TRTPGVSSTSVLK-PRVITTM 191
             ++   +  + + K PR+ TT+
Sbjct: 923 NHSKVIEMKGSLIFKTPRIPTTL 945

>Kwal_23.3679
          Length = 235

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 16/102 (15%)

Query: 144 IQNTNDTSVARPNNLKSIAAASPTVTATTRTPGVSSTSVLKPRVITTMWEDENTICYQVE 203
           I+  N +S  RP + K + A   + TA  +  G+     L P+ +   W+          
Sbjct: 22  IRLKNMSSTGRPEDAKFLEAVPVSNTAECKWIGLERIEYLDPKGVKRQWD---------- 71

Query: 204 ANGISVVRRADN-NMINGTKLLNVTKMTRGRRDGILRSEKVR 244
               S VRR  N   ++G  +L + K   G+   IL  ++ R
Sbjct: 72  ----SAVRRTRNSGGVDGVGILAILKAP-GKEPEILLQKQFR 108

>CAGL0F01727g 171213..171965 similar to sp|P54964 Saccharomyces
           cerevisiae YLR059c YNT20, hypothetical start
          Length = 250

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 232 GRRDGILRSEKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIV 289
           G  D +L S+K +E V+   ++    WIP +R  ILA     +D L+ L  KD   +V
Sbjct: 107 GLMDKVLASKKTKEQVEEELLNYLQKWIPEKRVGILAGNSVHMDRLFML--KDFPRVV 162

>Sklu_2220.4 YLR059C, Contig c2220 8039-9010 reverse complement
          Length = 323

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 16/86 (18%)

Query: 237 ILRSEKVREVVKIGSMHLKGVWIP-------------FERAYILAQREQILDHLYPLFVK 283
           +L S+K REVV+   +     +IP              +R ++L +  Q++DHL+   + 
Sbjct: 171 VLSSKKTREVVEQELLAYIKKYIPDPRRGILAGNSVHMDRIFMLREFPQVIDHLFYRII- 229

Query: 284 DIESIVDA--RKPSNKASLTPKSSPA 307
           D+ SI++   R     AS+ PK   A
Sbjct: 230 DVSSIMEVSFRHNPELASIVPKKKGA 255

>KLLA0F23716g join(complement(2216857..2218129), some similarities
           with ca|CA1415|CaDBP2.exon2 Candida albicans
           ATP-dependent RNA helicase of DEAD box family, exon 2
           (by homology), hypothetical start
          Length = 554

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 84/217 (38%), Gaps = 14/217 (6%)

Query: 105 PNSNFQPSSFPVMAVMPPEVQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAA 164
           P  +F  + FP   +   EV+ +G    T       P  +   +   VA   + K+++  
Sbjct: 111 PIRSFDEAGFPSYVL--DEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYC 168

Query: 165 SPTVTATTRTPGVSSTSVLKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGT--K 222
            P +      P +S      P V+      E  +  Q E +      R  N  + G   K
Sbjct: 169 LPGIVHINAQPLLSPGD--GPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPK 226

Query: 223 LLNVTKMTRGRRDGILRSEKVREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFV 282
              +  + RG    I    ++ ++++IG  +LK V        +L + +++LD     F 
Sbjct: 227 SQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRV-----TYLVLDEADRMLDMG---FE 278

Query: 283 KDIESIVDARKPSNKASLTPKSSPAPIKQEPSDNKHE 319
             I  IVD  +P  +  +   + P  +KQ  SD  H+
Sbjct: 279 PQIRKIVDQIRPDRQTLMWSATWPKEVKQLASDYLHD 315

>AAL003W [184] [Homologous to ScYCL004W (PGS1) - SH]
           complement(335149..336675) [1527 bp, 508 aa]
          Length = 508

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 10/145 (6%)

Query: 124 VQFDGSFLNTLHPHTELPPIIQNTNDTSVARPNNLKSIAAASPTVTATTRTPGVSSTS-V 182
           VQ+   +   ++P ++  P+ +  ND S  +P+ L+ +++   + T+   T G  +    
Sbjct: 277 VQYLDDYPTIVYPISQFTPLFKKNNDFSTEKPSILRLLSSIPSSETSWAFTAGYFNILPE 336

Query: 183 LKPRVITTMWEDENTICYQVEANGISVVRRA-----DNNMINGTKLLNVTKMTRGRRDGI 237
           +K R++ +       I     ANG    R       D  +    K L       G+ D I
Sbjct: 337 IKKRLLDSPSCVGKIITAAPTANGFYQSRGISKYLPDAYLYLAQKFLKSVH-AEGKSDTI 395

Query: 238 LRSEKVREVVKI---GSMHLKGVWI 259
              E  + VV      S H KG+WI
Sbjct: 396 SLYEWQKGVVNQPGGWSYHAKGIWI 420

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.128    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,527,244
Number of extensions: 473953
Number of successful extensions: 1619
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1611
Number of HSP's successfully gapped: 48
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)