Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL042W (SPC42)36335715380.0
Kwal_26.81903241071836e-15
ABR054C3141101748e-14
CAGL0L01793g3593001553e-11
KLLA0F04862g316611294e-08
Scas_625.7d3021751242e-07
Scas_711.453351331119e-06
Scas_688.21467102710.77
CAGL0J00693g188494691.7
KLLA0C12859g44549654.4
ADL283W30678644.5
Kwal_26.8588219105635.4
KLLA0F25322g126947637.4
YIL144W (TID3)69178638.6
YBL043W (ECM13)25739619.5
Sklu_1941.252682629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL042W
         (357 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...   597   0.0  
Kwal_26.8190                                                           75   6e-15
ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...    72   8e-14
CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...    64   3e-11
KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...    54   4e-08
Scas_625.7d                                                            52   2e-07
Scas_711.45                                                            47   9e-06
Scas_688.21                                                            32   0.77 
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...    31   1.7  
KLLA0C12859g complement(1088553..1089890) similar to sp|Q04371 S...    30   4.4  
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    29   4.5  
Kwal_26.8588                                                           29   5.4  
KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...    29   7.4  
YIL144W (TID3) [2533] chr9 (78074..80149) Component of the Tid3p...    29   8.6  
YBL043W (ECM13) [150] chr2 (136653..137426) Protein possibly inv...    28   9.5  
Sklu_1941.2 YFR037C, Contig c1941 1263-2843                            28   9.7  

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/357 (84%), Positives = 302/357 (84%)

Query: 1   MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE 60
           MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE
Sbjct: 1   MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE 60

Query: 61  FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISD 120
           FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISD
Sbjct: 61  FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISD 120

Query: 121 LEKKLSDANSTFKEMRFXXXXXXXXXXXXXSENYDQINVPKHRAPDATGNPRTTNKVSNT 180
           LEKKLSDANSTFKEMRF             SENYDQINVPKHRAPDATGNPRTTNKVSNT
Sbjct: 121 LEKKLSDANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPKHRAPDATGNPRTTNKVSNT 180

Query: 181 SDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQEPKRYNPT 240
           SDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQEPKRYNPT
Sbjct: 181 SDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQEPKRYNPT 240

Query: 241 VKVNPSDDDIMMYESAXXXXXXXXXXXXXXXXXXRKKHDLRKXXXXXXXXXXXXMMDGDD 300
           VKVNPSDDDIMMYESA                  RKKHDLRK            MMDGDD
Sbjct: 241 VKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQELQSMMDGDD 300

Query: 301 NIKLDNVSKHNHATHRHXXXXXXXXXXXXDACLECSNDLYEKNRVKPENNMSETFAT 357
           NIKLDNVSKHNHATHRH            DACLECSNDLYEKNRVKPENNMSETFAT
Sbjct: 301 NIKLDNVSKHNHATHRHSSQSSRDYSPSSDACLECSNDLYEKNRVKPENNMSETFAT 357

>Kwal_26.8190
          Length = 324

 Score = 75.1 bits (183), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 10/107 (9%)

Query: 1   MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE 60
           MN SPTP+RY+S+        Y+ P +          +N     I +D++VPEEY+ N++
Sbjct: 1   MNISPTPRRYNSRG-------YDYPRETDE---AFHPFNQEPPMIPSDRIVPEEYRVNSQ 50

Query: 61  FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKL 107
            INK ++QNKEL  +L  KQ+EI  L  +  +LR KL KY ++ KKL
Sbjct: 51  MINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKL 97

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 65/110 (59%), Gaps = 7/110 (6%)

Query: 1   MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE 60
           MN SPTPKRY  +SS       N  Y  + P      Y++  +  NAD++VP+EYK N+ 
Sbjct: 1   MNISPTPKRY--QSSNHMPRAVNHNYHSAVPA-----YHEHAAGQNADRIVPDEYKINSN 53

Query: 61  FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQ 110
            I+  ++QNK+L  KL EK  E+ +L  +  +LR KL KY ++ KKL+ Q
Sbjct: 54  MISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKLQAQ 103

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 131/300 (43%), Gaps = 44/300 (14%)

Query: 1   MNGSPTPKRYSSKSSRLYDDY-----------------YNIPYQYSNPTPMNRDYNDVGS 43
           MN SPTPKRY+S+  R Y                    +N  Y   NP P+ +  N + S
Sbjct: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINP-PVYK--NGLHS 57

Query: 44  RINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDI 103
            ++ DKLVPEE K     IN  + QNKEL   +  ++ EI  L  I    R+KL KY  +
Sbjct: 58  NLDDDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVM 117

Query: 104 TKKLEDQNLNLQIKISDLEK-KLSDANSTFKEMRFXXXXXXXXXXXXXSENYDQINVPKH 162
            +KLED+    +   + L K +  D N +  E  F             +E+Y  I +PK 
Sbjct: 118 NRKLEDELRGSERSSNALNKDRNDDRNDSILENSF-----------ENAEDY--IQIPKL 164

Query: 163 RAPDATGNPRTTNKVSNTSDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTI 222
           R  ++ G     +K   T+D + RL  + + L           + N++ MSP      T 
Sbjct: 165 RY-NSKG---KQDKSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATP 220

Query: 223 LPINNRLNFQEPKRYNPTVKVNPSDDDIMMYESAXXXXXXXXXXXXXXXXXXRKKHDLRK 282
              NN+     P   +P ++ +PS++DI+  ESA                  +++++LRK
Sbjct: 221 PERNNK-----PIMSSPKIR-DPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRK 274

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 44/61 (72%)

Query: 48  DKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKL 107
           +++VPEEYK N+  IN+ ++QNK+L+ ++ EKQ EI  L  +  + R+KL KY ++ KK+
Sbjct: 20  ERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKKM 79

Query: 108 E 108
           +
Sbjct: 80  Q 80

>Scas_625.7d
          Length = 302

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 84/175 (48%), Gaps = 37/175 (21%)

Query: 2   NGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEF 61
           N SPTP+RY ++                        Y   G R   D+L+PEE + + + 
Sbjct: 16  NISPTPQRYGTEK-----------------------YARYGLR-KTDELLPEESRLSNDA 51

Query: 62  INKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQI---KI 118
           IN+ +  N++L   LR++++E+    ++ E+L+SKL KY ++  KLE + + L++   K+
Sbjct: 52  INELIDMNRQLKKTLRDREDELDRYGRLTESLQSKLIKYTNLNNKLEREKIELELENEKL 111

Query: 119 SDLEKKLSD---ANSTFKEMRFXXXXXXXXXXXXXSENYDQINVPK--HRAPDAT 168
            D+ ++L++     S   ++++              EN D I +PK  H   D T
Sbjct: 112 IDINERLTNDLRTTSVAGDLKY-----SQKTRKGDDENTDDIFIPKRGHTFKDTT 161

>Scas_711.45
          Length = 335

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 70/133 (52%), Gaps = 10/133 (7%)

Query: 1   MNGSPTPKRYSSKS---SRLYDDYYNIPYQYSNPTPMNRD----YNDVGSRINA---DKL 50
           MN SPTPKRY S +    R+ +  YN  +   N     RD    Y+DV         D L
Sbjct: 1   MNVSPTPKRYISGTFNPRRVPEPEYNNYHHNYNNHNYQRDNLPRYDDVKRPYQDHLDDAL 60

Query: 51  VPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQ 110
           +P++ KR+ +  ++ V+ N+ L  +L  KQ E+ +L  ++ +L+ KL KY  +T    D+
Sbjct: 61  LPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDE 120

Query: 111 NLNLQIKISDLEK 123
              L+ +I DLEK
Sbjct: 121 IEILKRRIEDLEK 133

>Scas_688.21
          Length = 467

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 6/102 (5%)

Query: 15  SRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKELNF 74
           SRLY    N  Y   N    N  Y+D G    +   +PE   ++TE I +A   N   N 
Sbjct: 299 SRLYTHVLNQYYFVENCVSFNHSYSDSGLFGISISCIPEAASQSTEIIAQAF-ANTFANP 357

Query: 75  KLREKQNEIFELK-----KIAETLRSKLEKYVDITKKLEDQN 111
           KL   + E+   K      +   L SKL +  D+ ++++ +N
Sbjct: 358 KLALTEEEVSRAKNQLKSSLLMNLESKLVELEDMGRQVQLRN 399

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 37  DYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSK 96
           + NDV + ++ +K   E+ KRN + ++K+ +Q +E+   ++E + +   L    E   SK
Sbjct: 868 ELNDVKNLLDVEK---EKLKRNEQLLSKSNEQQREIETMIKEIREDKSTLLSEKEAAISK 924

Query: 97  LEKYVDITKKLEDQNLNLQIKISDLEKKLSDANS 130
           +++   + +KLE++N      I++L +KLS   S
Sbjct: 925 IQELELVRQKLEEKNNEKDASIAELTRKLSSLES 958

>KLLA0C12859g complement(1088553..1089890) similar to sp|Q04371
           Saccharomyces cerevisiae YMR027w HRT2 high level
           expression reduced Ty3 transposition singleton, start by
           similarity
          Length = 445

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 23  NIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKE 71
           +IPY  S+   M +D+ND+ +++   K  P E + + +FI K +++  E
Sbjct: 266 DIPYMVSDV--MIKDFNDIIAQLEDPKFFPVEDRTHLDFITKRIKEYVE 312

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%)

Query: 57  RNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQI 116
           R T+    A+++ K   FK     + I E+K + E   + + + VD+    E+ NL L+ 
Sbjct: 25  RQTDGRQIAIKEIKTSQFKDGLDMSAIREVKYLQEIRHANVIELVDLFMAQENLNLVLEF 84

Query: 117 KISDLEKKLSDANSTFKE 134
             +DLE  + D++  F +
Sbjct: 85  LPADLEMLIKDSSLLFTQ 102

>Kwal_26.8588
          Length = 219

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 26  YQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFE 85
           +Q   PTP N D  ++ S     + + E +K++T F N +V+     N     +Q EI  
Sbjct: 49  FQQQAPTPPNNDLRELQSDERLRQQLREGFKKDTSFHN-SVRAPVIPNIP---QQQEIDS 104

Query: 86  LKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSDANS 130
           L+ +  + + ++++ V        +N  LQ +++ LE+ +S+  S
Sbjct: 105 LRSVLHSQQRQIDQLVRGLDSQAARNSALQQRVTTLERYVSELES 149

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
           Saccharomyces cerevisiae YMR012w CLU1 translation
           initiation factor eIF3 (p135 subunit) singleton,
           hypothetical start
          Length = 1269

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 6/47 (12%)

Query: 35  NRDYND--VGSRINADKLVPEEYKRNTEFINKAVQQNKELNFKLREK 79
           N++Y D   G  +  +KL+    K   E INK VQQ KE+  KL+E+
Sbjct: 693 NKEYQDWETGYLVKVEKLI----KERQEEINKYVQQGKEVPSKLKEQ 735

>YIL144W (TID3) [2533] chr9 (78074..80149) Component of the
           Tid3p-Nuf2p-Spc24p-Spc25p centromere complex, involved
           in chromosome segregation [2076 bp, 691 aa]
          Length = 691

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 62  INKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITK---KLEDQNLNLQIKI 118
           IN+  Q N++L  +L E  N  FEL K  E  R  + + ++I K   K+ D NL ++ KI
Sbjct: 557 INEKTQINEKLELELSEA-NSKFELSK-QENERLLVAQRIEIEKMEKKINDSNLLMKTKI 614

Query: 119 SDLEKKLSDANSTFKEMR 136
           SD E+ ++      +E++
Sbjct: 615 SDAEELVTSTELKLEELK 632

>YBL043W (ECM13) [150] chr2 (136653..137426) Protein possibly
           involved in cell wall structure or biosynthesis [774 bp,
           257 aa]
          Length = 257

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 89  IAETLRSKLEKYVDITKKLEDQNLNLQIKISDLEKKLSD 127
           +A  +RSKL K V +T K +D NL + +  ++L  K+++
Sbjct: 14  LASKVRSKLAKCVSVTTKNKDYNLRVLVGHANLLDKITE 52

>Sklu_1941.2 YFR037C, Contig c1941 1263-2843
          Length = 526

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 7/82 (8%)

Query: 49  KLVPEEYKRNTEFINKAVQQNKELNF-KLREKQNEIFELKKIAETLRSKLEKYVDITKKL 107
           K + E+Y +  + +   VQ    L   K+  K N++ EL++   +L+++ EKYV  ++KL
Sbjct: 395 KKISEKYLKEAQLV---VQDLCHLTLQKMDLKFNQLSELER---SLQTEKEKYVKESEKL 448

Query: 108 EDQNLNLQIKISDLEKKLSDAN 129
            +  ++L  ++SDL K L+  N
Sbjct: 449 LNDRISLSKQVSDLNKDLAALN 470

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,465,643
Number of extensions: 487667
Number of successful extensions: 2492
Number of sequences better than 10.0: 205
Number of HSP's gapped: 2432
Number of HSP's successfully gapped: 265
Length of query: 357
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 254
Effective length of database: 13,030,455
Effective search space: 3309735570
Effective search space used: 3309735570
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)