Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL041W (VPS24)22422111361e-160
Scas_625.72242227971e-108
CAGL0L01837g2242227951e-108
Sklu_1576.22232217911e-107
ABR049C2232226911e-92
Kwal_26.81562222216842e-91
KLLA0F25366g2242236572e-87
Scas_668.262331691385e-10
KLLA0B13343g2361411323e-09
YKL002W (DID4)2321611314e-09
ABR002C2342051234e-08
Kwal_26.7923148117915e-04
CAGL0K02827g153110870.001
Scas_603.7203211740.10
Scas_618.17107781681.1
AFR068C204159661.1
KLLA0F21318g204218632.8
KLLA0A09031g89958643.2
Sklu_2188.3462107633.6
YGL140C1219106633.7
YOR198C (BFR1)470105634.1
CAGL0A00495g90288625.1
Kwal_26.7635691113616.1
YLR453C (RIF2)39545616.5
Kwal_27.12660205148597.6
Kwal_55.2113390624609.0
KLLA0B11099g94230609.1
YPL036W (PMA2)94758609.7
YBL034C (STU1)151374609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL041W
         (221 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved i...   442   e-160
Scas_625.7                                                            311   e-108
CAGL0L01837g 211118..211792 highly similar to sp|P36095 Saccharo...   310   e-108
Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement         309   e-107
ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH] (482245..48...   270   1e-92
Kwal_26.8156                                                          268   2e-91
KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces...   257   2e-87
Scas_668.26                                                            58   5e-10
KLLA0B13343g join(complement(1171345..1171404), similar to sp|P3...    55   3e-09
YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Clas...    55   4e-09
ABR002C [593] [Homologous to ScYKL002W (DID4) - SH] (400237..400...    52   4e-08
Kwal_26.7923                                                           40   5e-04
CAGL0K02827g 254429..254890 highly similar to sp|P36108 Saccharo...    38   0.001
Scas_603.7                                                             33   0.10 
Scas_618.17                                                            31   1.1  
AFR068C [3260] [Homologous to ScYKR035W-A (DID2) - SH] (545276.....    30   1.1  
KLLA0F21318g 1992956..1993570 similar to sgd|S0006435 Saccharomy...    29   2.8  
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    29   3.2  
Sklu_2188.3 YOR198C, Contig c2188 4499-5887 reverse complement         29   3.6  
YGL140C (YGL140C) [1847] chr7 complement(241356..245015) Protein...    29   3.7  
YOR198C (BFR1) [4994] chr15 complement(718653..720065) Protein t...    29   4.1  
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    28   5.1  
Kwal_26.7635                                                           28   6.1  
YLR453C (RIF2) [3827] chr12 complement(1041796..1042983) Rap1p-i...    28   6.5  
Kwal_27.12660                                                          27   7.6  
Kwal_55.21133                                                          28   9.0  
KLLA0B11099g complement(972830..975658) similar to sp|Q01454 Sac...    28   9.1  
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    28   9.7  
YBL034C (STU1) [160] chr2 complement(153813..158354) Suppressor ...    28   9.8  

>YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved in
           sorting of proteins in the pre-vacuolar endosome,
           component of ESCRT-III complex with Did4p, Vps20p, and
           Snf7p [675 bp, 224 aa]
          Length = 224

 Score =  442 bits (1136), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT
Sbjct: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR
Sbjct: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK
Sbjct: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180

Query: 181 NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRA 221
           NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRA
Sbjct: 181 NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRA 221

>Scas_625.7
          Length = 224

 Score =  311 bits (797), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/222 (72%), Positives = 198/222 (89%), Gaps = 2/222 (0%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           MDYIKK IWGPDPKEQQRRI++VLRKN R +EKSLR+LT LQNKTQQLIK++AKKND++T
Sbjct: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VR+YA+ELYQINKQY RMY+S+ QL SV  +IDEA+R+ T+S++MA+S GLMREVNSLVR
Sbjct: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           LP+L+ TMIELEKELMKSGIISEMVD+TM+SV +  EE+DE VD EVNKIVEQYTNEKF+
Sbjct: 121 LPELQGTMIELEKELMKSGIISEMVDETMDSVME-SEELDEEVDAEVNKIVEQYTNEKFE 179

Query: 181 NVDQVPTVELAAN-EEEQEIPDEKVDEEADRMVNEMRERLRA 221
            ++ VPT EL A+ EEE+EIP+++VDEEAD+M+ EM+ERL A
Sbjct: 180 KINNVPTTELPAHEEEEKEIPEDQVDEEADKMLREMKERLNA 221

>CAGL0L01837g 211118..211792 highly similar to sp|P36095
           Saccharomyces cerevisiae YKL041w VPS24, start by
           similarity
          Length = 224

 Score =  310 bits (795), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 194/222 (87%), Gaps = 2/222 (0%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           MDY+K AIWGPD KEQQR I+S+LRKN R I+KSLREL+ LQNKTQ LIKKSAKKNDVR 
Sbjct: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VRLYAKELY INKQY RMYTS+AQL+SV MKIDEA RM TLSNQMA S GLM EVNSLVR
Sbjct: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           LPQL+ TMIELEKELMKSGIISEM+D+TMES+GD  +E+++ VDEEVNKIVEQYT+EK  
Sbjct: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGDT-DELNDEVDEEVNKIVEQYTSEKLA 179

Query: 181 NVDQVPTVELA-ANEEEQEIPDEKVDEEADRMVNEMRERLRA 221
            V+ VPT EL  + +EEQE+P+E++++EAD+M+N+MR+RLRA
Sbjct: 180 KVENVPTTELPKSEQEEQEVPEEEIEDEADKMLNDMRDRLRA 221

>Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement
          Length = 223

 Score =  309 bits (791), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 154/221 (69%), Positives = 197/221 (89%), Gaps = 1/221 (0%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           MDY+KK +WGPDPKEQ R+I+S++RKNGRNI+KSLRELTVLQNKTQQLIK++AKKND+++
Sbjct: 1   MDYLKKVMWGPDPKEQHRKIKSIVRKNGRNIDKSLRELTVLQNKTQQLIKRAAKKNDIKS 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VR+YAKE+YQ+NKQY RMYTS+AQL+SV MKIDEA RM  LS  MA SAGLMREVNSLV+
Sbjct: 61  VRIYAKEIYQVNKQYIRMYTSKAQLESVGMKIDEAFRMKNLSENMAASAGLMREVNSLVK 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           LPQL+++M+ELEKE+MKSG+ISEM+DDT+E V D  EEM+  +DEEVNKIV QYT++KF+
Sbjct: 121 LPQLQSSMMELEKEIMKSGVISEMIDDTLE-VADEDEEMESEIDEEVNKIVSQYTSDKFE 179

Query: 181 NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRA 221
            VD VPT EL + +E++ +P+E++++EAD M+NEMRERL+A
Sbjct: 180 IVDNVPTTELPSKQEQELVPEEQIEDEADNMLNEMRERLKA 220

>ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH]
           (482245..482916) [672 bp, 223 aa]
          Length = 223

 Score =  270 bits (691), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 175/222 (78%), Gaps = 3/222 (1%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           M++IK AIWG DP+EQ R+++++LRKN R ++KSLREL  L+ KTQ LIKKSAK NDV+T
Sbjct: 1   MNFIKTAIWGVDPREQHRKMKAILRKNHRQLDKSLRELAALKGKTQVLIKKSAKTNDVKT 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VR+YAKELYQINKQYDR+YTS+AQL SV MKI+EA  MN +   MA SAGLMREVNSLV 
Sbjct: 61  VRIYAKELYQINKQYDRIYTSKAQLQSVGMKIEEAFHMNKMQQTMAQSAGLMREVNSLVS 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           +PQLR+TM+ELEKEL++SGI+SEMV+D++E++    +  DE VDE+V +IV QYT  KF 
Sbjct: 121 VPQLRSTMMELEKELLRSGIVSEMVNDSLENIDMTVD--DEEVDEQVEQIVMQYTGAKFN 178

Query: 181 NVDQVPTVELAANEE-EQEIPDEKVDEEADRMVNEMRERLRA 221
            VD VP  +L   +  E+ +P+E + +EAD M+ EMRERL A
Sbjct: 179 AVDNVPETQLERQDALEEVVPEEDIKDEADNMLREMRERLNA 220

>Kwal_26.8156
          Length = 222

 Score =  268 bits (684), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 179/221 (80%), Gaps = 2/221 (0%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           MDY+KKAIWGPDPKEQ R+IR ++R+NGR+++KSLREL  LQ KTQ LIK++AK+ND R+
Sbjct: 1   MDYLKKAIWGPDPKEQHRKIRGLVRRNGRSLDKSLRELAALQTKTQGLIKRAAKQNDTRS 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VR+YA+ELYQI+KQY RMY S+AQL SV MKIDEA RM  L   +A SAGLMREVNSLVR
Sbjct: 61  VRIYARELYQIDKQYKRMYISKAQLQSVGMKIDEAFRMQDLQENIALSAGLMREVNSLVR 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           LP L++TM+ LEKEL+K+G+I EM+DD+ME +    EEM+E V++EVNKIV QYT+ K  
Sbjct: 121 LPYLQSTMMLLEKELVKNGLIGEMLDDSME-LATEDEEMEEEVEQEVNKIVNQYTSAKLD 179

Query: 181 NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRA 221
            +D +PT E     EE  +P++K+D+EAD M+NEMRERL+A
Sbjct: 180 KIDNIPTSEPPMAHEEI-VPEDKIDDEADNMLNEMRERLKA 219

>KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces
           cerevisiae YKL041w VPS24 endosomal Vps protein complex
           subunit singleton, start by similarity
          Length = 224

 Score =  257 bits (657), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 133/223 (59%), Positives = 176/223 (78%), Gaps = 4/223 (1%)

Query: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60
           M++IK AIWGPDPKEQ R+++S+LRKN R + KSL EL+ L+ KTQQLIK++AK+ND++T
Sbjct: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQLSKSLNELSSLKAKTQQLIKQAAKQNDIKT 60

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
           VRLYAKELY +NKQY+RMYTS+AQL SV MKI+E  +MN L ++MA SA LMR+VNSLVR
Sbjct: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180
           LPQLR TMIELEKEL+KSGII+EM+DD MES      E +E ++E+V++IV +YT+EK  
Sbjct: 121 LPQLRGTMIELEKELVKSGIITEMMDDAMES--YEDMEEEEEINEQVDQIVAEYTSEKLG 178

Query: 181 NVDQVPTVELA--ANEEEQEIPDEKVDEEADRMVNEMRERLRA 221
            V++ P V L+     E++ +P+  +D EAD M+  M+ERL A
Sbjct: 179 KVEETPNVVLSEPPPAEQEVVPESNIDAEADNMIKAMKERLNA 221

>Scas_668.26
          Length = 233

 Score = 57.8 bits (138), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 90/169 (53%), Gaps = 2/169 (1%)

Query: 7   AIWGPD--PKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLY 64
           A +G    P+E+ ++ +  L +  R +E+  R+L   + K  Q IKKSAK+  +   ++ 
Sbjct: 6   AFFGKSMTPQERLKKNQRALERAQRELEREKRKLATQEKKIIQEIKKSAKQGQINAAKIQ 65

Query: 65  AKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQL 124
           AK+L +     ++    R QL ++ ++I      + +++ M ++ GL+  +N  + LPQL
Sbjct: 66  AKDLVRTRNYMEKFDNMRTQLQAISLRIQAVRSSDQMTSSMREATGLLAGMNRSMNLPQL 125

Query: 125 RNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQ 173
           +N  +E EK+        E +D+ +++      + DE  DE VNK++++
Sbjct: 126 QNISMEFEKQTDLMDQRQEFMDEAIDNAMGDEIDEDEEADEIVNKVLDE 174

>KLLA0B13343g join(complement(1171345..1171404), similar to
           sp|P36108 Saccharomyces cerevisiae YKL002w class E
           vacuolar-protein sorting and endocytosis factor
           singleton, start by similarity
          Length = 236

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 75/141 (53%), Gaps = 4/141 (2%)

Query: 13  PKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQIN 72
           P+E+ R+ +  L +  R +E+  ++L   + K  Q IKKSAK   V   ++ AK+L +  
Sbjct: 14  PQERMRKNQRALERAQRELEREKKKLEAQEKKLIQEIKKSAKNGQVNAAKIQAKDLVRTR 73

Query: 73  KQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELE 132
           K  ++    + QL ++ +++      + ++  M ++ GL+  +N  + LPQL+   +E E
Sbjct: 74  KYTEKFGNMKTQLQAISLRVQAVRSSDQMAVSMREATGLLAGMNRSMNLPQLQRISMEFE 133

Query: 133 KE--LM--KSGIISEMVDDTM 149
           K+  LM  +   + E +DD M
Sbjct: 134 KQSDLMEQRQEFMDESIDDVM 154

>YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Class E
           vacuolar protein-sorting (vps) factor involved in
           endosome to vacuole transport, component of ESCRT-III
           complex with Vps24p, Vps20p, and Snf7p, has similarity
           to human BC-2 breast adenocarcinoma marker protein [699
           bp, 232 aa]
          Length = 232

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 86/161 (53%)

Query: 13  PKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQIN 72
           P+E+ ++ +  L +  R +E+  R+L +   K    IKKSAK   V   ++ AK+L +  
Sbjct: 14  PQERLKKNQRALERTQRELEREKRKLELQDKKLVSEIKKSAKNGQVAAAKVQAKDLVRTR 73

Query: 73  KQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELE 132
               +    +AQL ++ ++I      + ++  M+++ GL+  +N  + LPQL+   +E E
Sbjct: 74  NYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEATGLLAGMNRTMNLPQLQRISMEFE 133

Query: 133 KELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQ 173
           K+    G   E +D+ +++V     + DE  DE VNK++++
Sbjct: 134 KQSDLMGQRQEFMDEAIDNVMGDEVDEDEEADEIVNKVLDE 174

>ABR002C [593] [Homologous to ScYKL002W (DID4) - SH]
           (400237..400881,400948..401007) [705 bp, 234 aa]
          Length = 234

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 97/205 (47%), Gaps = 31/205 (15%)

Query: 13  PKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQIN 72
           P+E+ ++ ++ L +  R +E+  R+L   + +  Q IKKSAK   +   ++ AK+L +  
Sbjct: 14  PQERLKKNQNALDRTQRELEREKRKLEAQEKRLVQDIKKSAKNGQINAAKIQAKDLVRTK 73

Query: 73  KQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELE 132
           +  ++    + QL ++ ++I      + ++  M ++ GL+  +N  + LPQL+   +E E
Sbjct: 74  RYIEKFNGMKTQLQAISLRIQAVRSSDQMAISMREATGLLSSMNRSMNLPQLQRISMEFE 133

Query: 133 KELMKSGIISEMVDDTMESVGDVGEEMDEAVDE--------------EVNKIVEQYT--- 175
           ++       ++M+D   E        MDEA+D+               +NK++++     
Sbjct: 134 RQ-------NDMMDQRQEF-------MDEAIDDAMGDELEEDEEAEEIINKVLDEIGVGL 179

Query: 176 NEKFKNVDQVPTVELAANEEEQEIP 200
           N K ++  Q      AA E    IP
Sbjct: 180 NNKLEDAPQGLVKNSAAAEARVAIP 204

>Kwal_26.7923
          Length = 148

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 8/117 (6%)

Query: 82  RAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKE--LM--K 137
           + QL ++ ++I      + ++  M ++ GL+  +N  + LPQ++    E EK+  LM  +
Sbjct: 2   KTQLQAISLRIQAVRSSDQMTTSMREATGLLASMNRSMNLPQIQLISAEFEKQSDLMDQR 61

Query: 138 SGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKNVDQVPTVELAANE 194
              + E +DD M    D G E DE  DE VN+++++   +    +   P  EL A E
Sbjct: 62  QEFMDEAIDDAM----DDGLEEDEEADEIVNRVLDEIGVDLNVKLKSTPQDELNATE 114

>CAGL0K02827g 254429..254890 highly similar to sp|P36108
           Saccharomyces cerevisiae YKL002w, start by similarity
          Length = 153

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%), Gaps = 11/110 (10%)

Query: 82  RAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKE--LM--K 137
           +AQL ++ ++I      + ++  M ++ GL+  +N  + LPQL+   +E EK+  LM  +
Sbjct: 2   KAQLQAISLRIQAVRSSDQMTRSMREATGLLAGMNRSMNLPQLQKISMEFEKQSDLMDQR 61

Query: 138 SGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYT---NEKFKNVDQ 184
              + E +D+ M   GD  EE +E  DE VNK++++     N + +N  Q
Sbjct: 62  QEFMDEAIDNVM---GDELEE-NEDADEIVNKVLDEIGIDLNSQLQNTPQ 107

>Scas_603.7
          Length = 203

 Score = 33.1 bits (74), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 95/211 (45%), Gaps = 39/211 (18%)

Query: 25  RKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRA- 83
           R     +E +L +L     + Q+  +K+AK+    T +L  K+    N++  R+Y S A 
Sbjct: 3   RNPAAGLENTLFQLKFTSKQLQKQAQKAAKEEKTETNKL--KKALNENEEIARIYASNAI 60

Query: 84  --------------QLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMI 129
                         ++DSV  ++  A+ M  +S+ MA     M +  + + L Q+   M 
Sbjct: 61  RKKNERLQLLKLASRVDSVSSRVQTAVTMRQVSSSMAQVCKGMEKALANMNLQQITMVMD 120

Query: 130 ELEKELMKSGIISEMVDDTMESVGDVGEEMD------EAVDEEVNKIVEQYTNEKFKN-- 181
           + E++        E +D ++    D+G   D      + VDE + K+ ++   E FK   
Sbjct: 121 KFEQQF-------EDLDTSVNVYEDMGVNSDAMMVDNDKVDELMGKVADENGLE-FKQSA 172

Query: 182 -VDQVPTVELAANEEEQEIPDEKVDEEADRM 211
            +D +P +     E+ Q + +EK D+ A+R+
Sbjct: 173 KLDNLPEI-----EKPQAVSEEKEDKLAERL 198

>Scas_618.17
          Length = 1077

 Score = 30.8 bits (68), Expect = 1.1,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 15  EQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQ 74
           E+ RRIRS+  +NG  I K L+  T +    Q ++K++   ND+ T   +  ELY    +
Sbjct: 514 EKMRRIRSMSNRNGNVIPK-LQVGTNVDGFYQDVLKRTNNGNDLPT---WCGELY---FE 566

Query: 75  YDR-MYTSRAQLDSVRMKIDE 94
           + R  YTS+AQ   + M++ E
Sbjct: 567 FHRGTYTSQAQTKRL-MRLSE 586

>AFR068C [3260] [Homologous to ScYKR035W-A (DID2) - SH]
           (545276..545890) [615 bp, 204 aa]
          Length = 204

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 77/159 (48%), Gaps = 13/159 (8%)

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSA-GLMREVNSLV 119
            RLYA    +   +  ++    +++D+V  K+  A+ M  +S  MA    G+ R + S+ 
Sbjct: 52  ARLYASNAIRKRNERVQLLKLASRVDAVVSKVQTAVTMRQVSGSMAQVCKGMDRALQSM- 110

Query: 120 RLPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAV--DEEVNKIVEQYTNE 177
            L Q+   M + E++        E +D ++    ++G+ +D  V  +++V++++ Q  +E
Sbjct: 111 NLQQITMIMDKFEQQF-------EDLDTSVNVYEEMGQNVDAVVVDNDKVDELISQAADE 163

Query: 178 KFKNVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMR 216
           K   + Q  + +L      Q  P E  +++ D++   +R
Sbjct: 164 KGLELKQ--SAQLGELPRVQNAPAEVTEDKEDKLAQRLR 200

>KLLA0F21318g 1992956..1993570 similar to sgd|S0006435 Saccharomyces
           cerevisiae YKR035wa class E vacuolar-protein sorting and
           endocytosis factor, start by similarity
          Length = 204

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 93/218 (42%), Gaps = 37/218 (16%)

Query: 24  LRKNGRNIEKSLRELTVLQNKTQQLIKKSAK--KNDVRTVRLYAKELYQINKQYD----R 77
           + +N  N+E +L +L     +  +   K+AK  K +V  ++    E  +I K Y     R
Sbjct: 1   MSRNSMNLENTLFQLKFTAKQLNKQAAKAAKEEKQEVNKLKKIINESEEIGKLYASNAIR 60

Query: 78  MYTSRAQL-------DSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIE 130
               R QL       D+V  ++  A+ M  +S  MA     M +    + L Q+   M +
Sbjct: 61  KRNERVQLLKLASRVDAVASRVQTAVTMRQVSTSMAQVCRGMDKALQSMNLQQITMVMDK 120

Query: 131 LEKELMKSGIISEMVDDTMESVGDVGEEMDEAV--DEEVNKIVEQYTNEKFKNVDQVPTV 188
            E++        E +D ++    D+G   D  V   ++V++++ Q  +E          +
Sbjct: 121 FEQQF-------EDLDASVNVYEDMGANADAVVVDGDKVDELMNQVADEN--------GL 165

Query: 189 ELAANEEEQEIPDEKVDEEADRMVNE-----MRERLRA 221
           EL  +    ++PD  V E    +VNE     + ERLRA
Sbjct: 166 ELKHSAALTDLPD--VKEAPAAVVNEEKEDKLAERLRA 201

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 29.3 bits (64), Expect = 3.2,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 161 EAVDEEVNKIVEQYTNEKFKNVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRER 218
           + V ++V  IVE    E+   V   P   L   EEE  IP E V E  +  V E+  R
Sbjct: 433 DPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEEEHPIP-EDVRENYENKVAELASR 489

>Sklu_2188.3 YOR198C, Contig c2188 4499-5887 reverse complement
          Length = 462

 Score = 28.9 bits (63), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 8/107 (7%)

Query: 25  RKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAK--ELY----QINKQYDRM 78
           R+     E + ++L  LQ+K+Q +  K       RTV LY K  E+Y    QI   +D  
Sbjct: 185 REVSTQFETTQKKLNDLQSKSQVVYDKRQTLFSKRTV-LYKKRDEIYAAIKQIRSDFDNE 243

Query: 79  YTS-RAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQL 124
           + + +A+LD  R+K +E  +++ L  +   + G ++E  +  RLP  
Sbjct: 244 FKAFKAKLDQERLKREEDAKLSKLLEEKDAAMGKLQERLNHARLPAF 290

>YGL140C (YGL140C) [1847] chr7 complement(241356..245015) Protein of
           unknown function [3660 bp, 1219 aa]
          Length = 1219

 Score = 28.9 bits (63), Expect = 3.7,   Method: Composition-based stats.
 Identities = 23/106 (21%), Positives = 48/106 (45%), Gaps = 12/106 (11%)

Query: 122 PQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKN 181
           P+L+    ELE    +   I + + + ++++  + ++   AV EE N +V  Y  +    
Sbjct: 857 PRLKGEYTELENVFTQVIFIQKQIIERIDTISLLRKQNGSAVIEEFNSVVYPYRRQM--- 913

Query: 182 VDQVPTVELAANEE-------EQEIPDEKVDEEADRMVNEMRERLR 220
           V  +  +  A  E         Q +P  ++     R++N++R+ LR
Sbjct: 914 VGSISCLMRALQEAFINKTPLPQFLPSARIAHR--RLINKVRQTLR 957

>YOR198C (BFR1) [4994] chr15 complement(718653..720065) Protein that
           suppresses brefeldin A-induced lethality when
           overproduced, may be involved in mRNA metabolism [1413
           bp, 470 aa]
          Length = 470

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 16/105 (15%)

Query: 63  LYAK--ELY----QINKQYDRMYTS-RAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREV 115
           LY K  ELY    QI   +D  + S RA+LD  R+K +E  R++ L  Q     G ++E 
Sbjct: 217 LYKKRDELYSQIRQIRADFDNEFKSFRAKLDKERLKREEEQRLSKLLEQKDVDMGKLQEK 276

Query: 116 NSLVRLPQLRNTMIELEKELM---------KSGIISEMVDDTMES 151
            +  ++P     +  +E  L+         K  I+ ++  + +E+
Sbjct: 277 LTHAKIPAFTYEIGAIENSLLVLDPTYVKPKKNILPDLSSNALET 321

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 28.5 bits (62), Expect = 5.1,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 1/88 (1%)

Query: 131 LEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKNVDQVPTVEL 190
           ++K  +KS I      D +     +     + V ++V  +VE    E+   V   P   L
Sbjct: 406 IDKAFLKSLINYPKAKDALTKYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVL 465

Query: 191 AANEEEQEIPDEKVDEEADRMVNEMRER 218
              EE+  IP E V E  +  V E+  R
Sbjct: 466 KTVEEDHPIP-EDVHENYENKVAELASR 492

>Kwal_26.7635
          Length = 691

 Score = 28.1 bits (61), Expect = 6.1,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 14/113 (12%)

Query: 45  TQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQ 104
           + ++ K  A  + V TVR    +    + +YD MY       SV   +DEA   N  +  
Sbjct: 75  SSEVNKFPATDSSVSTVR----DSVSTSGEYDGMYDGNGS-SSV---MDEAFDSNNSTTD 126

Query: 105 MADSAGLMR---EVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVGD 154
             + +G+M        ++RLP    + +++ K+L+ SG+I++   DT E+  D
Sbjct: 127 EPNFSGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVINQ---DTDEASAD 176

>YLR453C (RIF2) [3827] chr12 complement(1041796..1042983)
           Rap1p-interacting factor, involved with Rap1p in
           transcriptional silencing and telomere length regulation
           [1188 bp, 395 aa]
          Length = 395

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 109 AGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVG 153
           AG+ R V+  + L  +   +IE+   LMK GI S    + +ES+G
Sbjct: 123 AGIDRAVSETLSLVDINVVIIEMNDYLMKEGIQSSKSKECIESMG 167

>Kwal_27.12660
          Length = 205

 Score = 27.3 bits (59), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 19/148 (12%)

Query: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120
            RLYA    +   +  ++    +++DSV  ++  A+ M  +S  MA     M +    + 
Sbjct: 53  ARLYASNSVRKRNERLQLLKLASRVDSVASRVQTAVTMRQVSGSMAQVCRGMDKALQSMN 112

Query: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEA------VDEEVNKI---- 170
           L Q+   M + E++        E +D ++    D+G   D        VDE +NK+    
Sbjct: 113 LQQITMIMDKFEQQF-------EDLDASVNVYEDMGANADAVVVDNDRVDELLNKVADEN 165

Query: 171 -VEQYTNEKFKNVDQV-PTVELAANEEE 196
            +E   +   K+V +V P+ E A +E+E
Sbjct: 166 GLELKQSAALKDVAEVTPSTEAATDEKE 193

>Kwal_55.21133
          Length = 906

 Score = 27.7 bits (60), Expect = 9.0,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 20/24 (83%)

Query: 132 EKELMKSGIISEMVDDTMESVGDV 155
           E+EL++S I+ E+++DT+E  G++
Sbjct: 801 EEELLRSKIMGELLNDTLEHDGEI 824

>KLLA0B11099g complement(972830..975658) similar to sp|Q01454
           Saccharomyces cerevisiae YPR135w POB1 DNA-directed DNA
           polymerase alpha-binding protein singleton, start by
           similarity
          Length = 942

 Score = 27.7 bits (60), Expect = 9.1,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 132 EKELMKSGIISEMVDDTMESVGDV-GEEMD 160
           E+E ++S I+S+++ DTM++ G++ G E D
Sbjct: 837 EEEFLRSKILSDLLKDTMDNEGEIYGNETD 866

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 27.7 bits (60), Expect = 9.7,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 161 EAVDEEVNKIVEQYTNEKFKNVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRER 218
           + V ++V  +VE    E+   V   P   L   EE+  IP E V E  +  V E+  R
Sbjct: 481 DPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIP-EDVHENYENKVAELASR 537

>YBL034C (STU1) [160] chr2 complement(153813..158354) Suppressor of
            beta-tubulin mutation that is required for assembly of
            the mitotic spindle [4542 bp, 1513 aa]
          Length = 1513

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 147  DTMESVGDVGEEMDEAVDE-EVNKIVEQYTNEKFKNVDQVPTVELAANEEEQEIPDEKV- 204
            D  +S GD  EE D+AVDE +V K +E      FKN++   T+EL  N  ++    + V 
Sbjct: 1008 DNKKSEGD--EESDDAVDENDVKKCMEMTMINPFKNLETDKTLELKNNVGKRTSSTDSVV 1065

Query: 205  ---DEEADRMVNEM 215
               D + D+ ++EM
Sbjct: 1066 IHDDNDKDKKLSEM 1079

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,857,799
Number of extensions: 297232
Number of successful extensions: 2564
Number of sequences better than 10.0: 298
Number of HSP's gapped: 2465
Number of HSP's successfully gapped: 321
Length of query: 221
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 123
Effective length of database: 13,203,545
Effective search space: 1624036035
Effective search space used: 1624036035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)