Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL025C (PAN3)67966729010.0
Scas_685.764545812921e-170
Sklu_2380.362253612361e-162
ACR172W61246011891e-155
Kwal_14.86362845711181e-144
CAGL0L09889g71746310341e-131
KLLA0E08085g65645910251e-130
Kwal_47.1786836592800.12
AER304C325867770.48
ADR313W578136760.48
CAGL0L06820g366106721.2
Scas_709.5175945721.5
ADR126C69189693.4
KLLA0F17006g415105659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL025C
         (667 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component...  1122   0.0  
Scas_685.7                                                            502   e-170
Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement        480   e-162
ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH] complement(...   462   e-155
Kwal_14.863                                                           435   e-144
CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces...   402   e-131
KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces c...   399   e-130
Kwal_47.17868                                                          35   0.12 
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...    34   0.48 
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    34   0.48 
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    32   1.2  
Scas_709.51                                                            32   1.5  
ADR126C [1867] [Homologous to ScYKL072W (STB6) - SH; ScYMR053C (...    31   3.4  
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    30   9.4  

>YKL025C (PAN3) [3230] chr11 complement(389883..391922) Component of
           Pab1p-stimulated poly(A) ribonuclease [2040 bp, 679 aa]
          Length = 679

 Score = 1122 bits (2901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/667 (86%), Positives = 574/667 (86%)

Query: 1   MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPTM 60
           MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPTM
Sbjct: 1   MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPTM 60

Query: 61  TSVPKFNAKVSASFTPMTVGSDSLXXXXXXXXXXXXXXXXIXXXXXXXXXXXVNPMXXXX 120
           TSVPKFNAKVSASFTPMTVGSDSL                I           VNPM    
Sbjct: 61  TSVPKFNAKVSASFTPMTVGSDSLTTVTNTTSAATNATGNIAMAATSATASTVNPMINPI 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXYDPFNAPIFTPSSTSSIHTNANAHSFPFPSIAN 180
                                      YDPFNAPIFTPSSTSSIHTNANAHSFPFPSIAN
Sbjct: 121 VNSSLVNNNNNNSNISISIPTTASSSNYDPFNAPIFTPSSTSSIHTNANAHSFPFPSIAN 180

Query: 181 SGGININATDDXXXXXXXXXXXXXXXXXXXIESSNLKYPRIYPPPHSLLQYHLYAPEQPS 240
           SGGININATDD                   IESSNLKYPRIYPPPHSLLQYHLYAPEQPS
Sbjct: 181 SGGININATDDNSNNMSMANNVPPPMQPPPIESSNLKYPRIYPPPHSLLQYHLYAPEQPS 240

Query: 241 SLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVFPSSGKVIPSIVQDYFNLVPLNFN 300
           SLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVFPSSGKVIPSIVQDYFNLVPLNFN
Sbjct: 241 SLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVFPSSGKVIPSIVQDYFNLVPLNFN 300

Query: 301 NNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQIWSKINCTNLIKFRDI 360
           NNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQIWSKINCTNLIKFRDI
Sbjct: 301 NNDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQIWSKINCTNLIKFRDI 360

Query: 361 FQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNNYLWIYLVQLTNVINSIHSQN 420
           FQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNNYLWIYLVQLTNVINSIHSQN
Sbjct: 361 FQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNNYLWIYLVQLTNVINSIHSQN 420

Query: 421 LSIGNTLNWRKVLITGDPGRIKLSHCNFMDLLFNDDTDTVVSSGGSTIEGQQQLDYKYLG 480
           LSIGNTLNWRKVLITGDPGRIKLSHCNFMDLLFNDDTDTVVSSGGSTIEGQQQLDYKYLG
Sbjct: 421 LSIGNTLNWRKVLITGDPGRIKLSHCNFMDLLFNDDTDTVVSSGGSTIEGQQQLDYKYLG 480

Query: 481 XXXXXXXXXXXXXXXXTAPKEYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSI 540
                           TAPKEYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSI
Sbjct: 481 ELLFNLSINIENSNNNTAPKEYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSI 540

Query: 541 HDLTSHFYDKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESRIDINW 600
           HDLTSHFYDKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESRIDINW
Sbjct: 541 HDLTSHFYDKMFMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESRIDINW 600

Query: 601 SESGTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGIQEKLMLVTPDELNCII 660
           SESGTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGIQEKLMLVTPDELNCII
Sbjct: 601 SESGTKFPIILFYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGIQEKLMLVTPDELNCII 660

Query: 661 ISYKELK 667
           ISYKELK
Sbjct: 661 ISYKELK 667

>Scas_685.7
          Length = 645

 Score =  502 bits (1292), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 251/458 (54%), Positives = 329/458 (71%), Gaps = 35/458 (7%)

Query: 217 KYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQV 276
           +YP IYPPPHS+LQYHLYAP+ P  L+  LKPNER+ + LFIPN++RE L KKNL+ LQ+
Sbjct: 204 RYPSIYPPPHSILQYHLYAPDPPPQLRLPLKPNERTPETLFIPNDLREQLVKKNLASLQI 263

Query: 277 FPSSGKVIPSIVQDYFNLVPLNFNNNDFL------NKTTLFKVFSNYDGKAYVLKRLPNI 330
           FPS G  IP IVQDYF LVPL+F+  +        +K +L+KVFSN DGK Y+L+R+ ++
Sbjct: 264 FPSGG-AIPDIVQDYFGLVPLDFHQKEVTKDRYQGHKNSLYKVFSNLDGKVYILRRIHDV 322

Query: 331 DKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFV 390
            + M+P +I+K +Q W+ + C  ++K RD+F TTKFGD S+CLV+D+YP + SLY++HF 
Sbjct: 323 -QIMDPQQIAKPFQKWNNLECNQIVKLRDLFLTTKFGDSSLCLVYDFYPQANSLYEHHFT 381

Query: 391 NFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD 450
           NFP  PIT +YLW YLVQLTN IN +HS+   IG  ++W K+++TGDPGRIKLS C  +D
Sbjct: 382 NFPLVPITQDYLWTYLVQLTNAINVVHSKGFYIG-LIDWDKIIVTGDPGRIKLSGCGAID 440

Query: 451 LL-FNDDTDTVVSSGGSTIEGQQQLDYKYLGXXXXXXXXXXXXXXXXTAPKEYRLEEITP 509
           +L  N++ D         +  +QQ+D++ LG                      ++     
Sbjct: 441 VLGANEELD---------LHSKQQMDFENLGQLLFKLAS--------------KIGNNAN 477

Query: 510 QSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVL 569
             ID++  +DD+FK VL+YL++D  D +K+I++L+  F DK+   +ESSQ Y EY E +L
Sbjct: 478 AKIDEL-SVDDQFKTVLQYLLNDTND-RKTINELSQLFIDKILSNVESSQGYAEYTEGIL 535

Query: 570 SRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIMD 629
           SRELENGRLFRL+ KLN IFG+IESR+DINWSESG KFPIILFYD+VFHQVD  GK +MD
Sbjct: 536 SRELENGRLFRLICKLNFIFGKIESRVDINWSESGEKFPIILFYDFVFHQVDETGKSVMD 595

Query: 630 LTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667
           LTHVLRCLNKLDAG  EKL+L TPDE+NCIIISYKELK
Sbjct: 596 LTHVLRCLNKLDAGAPEKLILATPDEMNCIIISYKELK 633

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (3%)

Query: 1  MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEA-TTPT 59
          MDKIN +WAKDIPCRN+TIYGYCKK K+GCPFKHS+  T     ++  P+ V ++   P 
Sbjct: 1  MDKINAEWAKDIPCRNVTIYGYCKKIKDGCPFKHSE--TDEPAAEIQEPVPVQQSPVAPV 58

Query: 60 MTSVPKFNAKVSASFTPMTVGSDSL 84
           +   KFN K SASFTPM+  +  L
Sbjct: 59 PSFSRKFNPKSSASFTPMSSKTPEL 83

>Sklu_2380.3 YKL025C, Contig c2380 7858-9726 reverse complement
          Length = 622

 Score =  480 bits (1236), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 259/536 (48%), Positives = 344/536 (64%), Gaps = 48/536 (8%)

Query: 148 YDPFNAPIFTPSSTSSIHTNANAHSF-PFPSIANSGGININATDDXXXXXXXXXXX---- 202
           ++P+ A  FTPS ++ +    ++ SF P+ + +  GG +  AT                 
Sbjct: 107 FNPYVADSFTPSGSAGV----SSPSFNPYSAPSGIGGASSTATHTQTAPVTGFTQRPPDP 162

Query: 203 -XXXXXXXXIESSNLK----YPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLF 257
                    I SS +     +P IYPPPHS+LQYHLYAP+ P  LK  LKPNER+ + LF
Sbjct: 163 RSSLTSAGPIASSRVSATQNFPTIYPPPHSILQYHLYAPDPPPHLKVPLKPNERTPETLF 222

Query: 258 IPNNIREDLTKKNLSILQVFPSSGKVIPSIVQDYFNLVPLNFNNND------FLNKTTLF 311
           IPN++RE+L KKN S LQVFPS G  +P IV DYF LVPL F++          ++ +L+
Sbjct: 223 IPNDLREELVKKNQSALQVFPSGGS-LPEIVGDYFGLVPLEFHSRASYKQRYMGHQNSLY 281

Query: 312 KVFSNYDGKAYVLKRLPNIDKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSI 371
           KVFSN DGK Y+++R+ +++ +    ++S+ +Q+W K++C N++K +D F T  F D S+
Sbjct: 282 KVFSNSDGKIYIMRRIHDVNIT-EATQVSRPFQMWQKVSCANVVKIKDAFITRAFNDSSL 340

Query: 372 CLVFDYYPNSLSLYDYHFVNFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRK 431
           C+V +Y+P S SLY+ HFVNF   PIT +YLW YLVQLTN +  +HSQNLSI N L W K
Sbjct: 341 CVVHEYFPQSSSLYETHFVNFTLTPITQDYLWAYLVQLTNALKEVHSQNLSI-NILGWDK 399

Query: 432 VLITGDPGRIKLSHCNFMDLLFNDDTDTVVSSGGSTIEGQQQLDYKYLGXXXXXXXXXXX 491
           V++TG+PGRIK+S C   D+L + ++          IE +QQ D++ LG           
Sbjct: 400 VIVTGEPGRIKVSDCGVYDILHSLES--------RDIEEEQQKDFEELGKLLNGLVT--- 448

Query: 492 XXXXXTAPKEYRLEEITPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKM 551
                      ++      S  D++ +D  FK VL YL+ +  D KK++ +L S F D++
Sbjct: 449 -----------KIASSKDTSTQDLK-VDSDFKIVLDYLLLN--DHKKNVRELASLFTDRI 494

Query: 552 FMVLESSQTYTEYMESVLSRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIIL 611
             V+ S QT+ E  E+ LSRELENGRLFRL+ KLN IFGR ESR+DINWSESG KFPIIL
Sbjct: 495 LSVVSSLQTHVECTEAYLSRELENGRLFRLMCKLNFIFGRTESRVDINWSESGEKFPIIL 554

Query: 612 FYDYVFHQVDSNGKPIMDLTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667
           FYDYVFHQVD  GK IMDLTHVLRCLNKLDAG+ EK+MLVTPDE+NCIIISYKELK
Sbjct: 555 FYDYVFHQVDEAGKSIMDLTHVLRCLNKLDAGVTEKIMLVTPDEMNCIIISYKELK 610

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 14/83 (16%)

Query: 1  MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPT- 59
          MDK N +WAKDIPC+NITI+G+CK E +GC F H  + T T +N            TPT 
Sbjct: 1  MDKANTEWAKDIPCKNITIHGFCKFENDGCIFNHGSSGTKTGVN------------TPTG 48

Query: 60 -MTSVPKFNAKVSASFTPMTVGS 81
           M S  KFNAK ++SFTP  + S
Sbjct: 49 IMNSASKFNAKTASSFTPSKITS 71

>ACR172W [1219] [Homologous to ScYKL025C (PAN3) - SH]
           complement(655564..657402) [1839 bp, 612 aa]
          Length = 612

 Score =  462 bits (1189), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 237/460 (51%), Positives = 308/460 (66%), Gaps = 35/460 (7%)

Query: 214 SNLKYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSI 273
           +   +P +YPP HS+LQYHLYAP+ P  L+  LK NER+ + LFIPNN+RE L K+NLS 
Sbjct: 170 AGTAFPTVYPPSHSILQYHLYAPDPPPHLQVPLKANERTPETLFIPNNLREHLLKRNLSA 229

Query: 274 LQVFPSSGKVIPSIVQDYFNLVPLNFNNND------FLNKTTLFKVFSNYDGKAYVLKRL 327
           LQVFPS G  +P IV DYF LVPL F+N          ++ +L+KVFSN+DGK Y+++R+
Sbjct: 230 LQVFPSDGN-LPDIVGDYFGLVPLEFHNRQTGKGRYLGHQNSLYKVFSNFDGKVYIIRRI 288

Query: 328 PNIDKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDY 387
            ++ K+ +  +IS  ++ W K++C N++K +D F T  FGD S+C+V DYYP S SLY+ 
Sbjct: 289 HDV-KTTDVGQISLPFRKWQKVSCPNVVKVKDAFTTLAFGDSSLCVVHDYYPQSNSLYET 347

Query: 388 HFVNFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCN 447
           H  N+   P+T  YLW YLVQL+N +N +H   LS+ N ++  KV++TGDPGRIK+    
Sbjct: 348 HVANYTVVPVTQKYLWSYLVQLSNALNEVHRHGLSM-NNISLDKVIVTGDPGRIKVGDSA 406

Query: 448 FMDLLFNDDTDTVVSSGGSTIEGQQQLDYKYLGXXXXXXXXXXXXXXXXTAPKEYRLEEI 507
             D+L  D+        G  I  +QQ DY  +G                      R+   
Sbjct: 407 VHDILAFDE--------GRDIAKEQQADYSAVGALLMDLAQ--------------RMLGT 444

Query: 508 TPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMES 567
             Q +D M  ID  FK VL YL+SD    KK+I + T+ F  KM  ++ SSQTY+EY+E 
Sbjct: 445 RDQPLDSM-DIDPLFKRVLAYLLSDE---KKTIAEFTALFSHKMLDIISSSQTYSEYIEQ 500

Query: 568 VLSRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPI 627
            LSRELENGRLFRL+ KLN IFGR+ES +DI+WSE+G KFPIILFYDYVFHQVD NGK +
Sbjct: 501 HLSRELENGRLFRLMCKLNFIFGRMESSMDIHWSEAGDKFPIILFYDYVFHQVDENGKSV 560

Query: 628 MDLTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667
           MDLTHVLRCLNKLD G+ EK++LVTPDE+NCIIISYKELK
Sbjct: 561 MDLTHVLRCLNKLDTGVSEKIILVTPDEMNCIIISYKELK 600

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 41/82 (50%), Gaps = 7/82 (8%)

Query: 1  MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKH------SDNTTATTINDVPPPIDVGE 54
          M+K   DWAKD PC+NITIYGYCK E +GC F H      S NT              G 
Sbjct: 3  MNKSKTDWAKDTPCKNITIYGYCKYENDGCIFNHGKPLSTSSNTGGAAAGSAEDSAASGG 62

Query: 55 ATTPTMTSVPKFNAKVSASFTP 76
           T    T    FNAK + SFTP
Sbjct: 63 VTVGN-TGKSTFNAKTATSFTP 83

>Kwal_14.863
          Length = 628

 Score =  435 bits (1118), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 231/457 (50%), Positives = 300/457 (65%), Gaps = 36/457 (7%)

Query: 218 YPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVF 277
           +P IYPP HS+LQYHLYAP+ P  LK  LK NER+ + LFIPNN+RE+L KKN + LQVF
Sbjct: 189 FPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPETLFIPNNMREELLKKNHAALQVF 248

Query: 278 PSSGKVIPSIVQDYFNLVPLNFNNNDFLNK-------TTLFKVFSNYDGKAYVLKRLPNI 330
           PS G  +P IV DYF LVPL F+N    NK        +L+KVFSN+DGK Y+++R+ ++
Sbjct: 249 PSGGN-LPEIVGDYFGLVPLEFHNR-VSNKDRYQGHQNSLYKVFSNFDGKVYIMRRIHDV 306

Query: 331 DKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFV 390
            K     ++ K +Q W K+  +N+++ +D F T  F D S+C+V +Y+P S SLY+ HFV
Sbjct: 307 -KMKESVQLFKPFQDWKKVVNSNVVETKDAFITRAFNDASLCVVHEYFPQSSSLYETHFV 365

Query: 391 NFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD 450
           +F   PIT + LW YLVQL + I + H++NL+  N +   KV++TG+PGR+K+      D
Sbjct: 366 SFSPTPITQDLLWSYLVQLCSAIQAAHTRNLAF-NNICLDKVIVTGNPGRVKIGDSCVHD 424

Query: 451 LLFNDDTDTVVSSGGSTIEGQQQLDYKYLGXXXXXXXXXXXXXXXXTAPKEYRLEEITPQ 510
           +L+  D   V+         +Q+ D+  LG                T             
Sbjct: 425 ILYFQDERDVLK--------EQKHDFADLGGLLKDLAAKLVGSQDNTV------------ 464

Query: 511 SIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESVLS 570
              D   +DD FK VL YL+  +  S K++ +L + F  K+  ++ S QT+TEY ES+L+
Sbjct: 465 ---DSLAVDDDFKQVLNYLL--DPKSLKTLPELMALFSHKILPIISSLQTFTEYTESILA 519

Query: 571 RELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIMDL 630
           RELEN RLFRL+ K+N IFGRIESRIDINWSESG KFPIILFYDYVFHQ D  GKP+MDL
Sbjct: 520 RELENARLFRLMCKMNFIFGRIESRIDINWSESGEKFPIILFYDYVFHQADETGKPVMDL 579

Query: 631 THVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667
           THVLRCLNKLDAGI EKLMLVTPDE+NCIIISYKELK
Sbjct: 580 THVLRCLNKLDAGIGEKLMLVTPDEMNCIIISYKELK 616

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 44/76 (57%), Gaps = 18/76 (23%)

Query: 1  MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATTPTM 60
          MDK N +WAKDIPC+NITIYG+CK E EGC F H                  G A   T 
Sbjct: 15 MDKANAEWAKDIPCKNITIYGFCKYENEGCIFNH------------------GNANQNTN 56

Query: 61 TSVPKFNAKVSASFTP 76
          ++  KFNAK ++SFTP
Sbjct: 57 SAGLKFNAKTASSFTP 72

>CAGL0L09889g 1055765..1057918 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease, start by similarity
          Length = 717

 Score =  402 bits (1034), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/463 (46%), Positives = 310/463 (66%), Gaps = 30/463 (6%)

Query: 215 NLKYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSIL 274
           NL+YP IYPP HS+LQYHLYAP+ P  L+  LK NER+   LFIPN++RE+L K+NL+ L
Sbjct: 263 NLRYPTIYPPTHSILQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASL 322

Query: 275 QVFPSSGKVIPSIVQDYFNLVPLNFNNNDFL------NKTTLFKVFSNYDGKAYVLKRLP 328
           Q+FPS G  +P IV+DYF LVPL+F+    +      +K +L+KVFSN DG+ Y+L+R+ 
Sbjct: 323 QLFPSGGN-LPHIVKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIH 381

Query: 329 NIDKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYH 388
           +++ S +P  ISK +Q WSKI+ +N++  +D+F TT FGD S+ +V+DYYPN+ SLY+ H
Sbjct: 382 DVNIS-DPTIISKTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAH 440

Query: 389 FVNFPKFPITNNYLWIYLVQLTNVINSIHSQN-LSIGNTLNWRKVLITGDPGRIKLSHCN 447
           FVN+P   +T + LW Y VQ+ N +  IH+ N ++IG+ L+  K+++TG  GRIK+S   
Sbjct: 441 FVNYPTVEVTEDLLWSYAVQILNGLREIHNTNGVNIGD-LDCDKIILTGK-GRIKISAGA 498

Query: 448 FMDLLFNDDTDTVVSSGGSTIEGQQQLDYKYLGXXXXXXXXXXXXXXXXTAPKEYRLEEI 507
             D++  +      +      E  ++ ++  LG                      ++   
Sbjct: 499 EYDIM--NMCCPEDNEDDDNEEKLRKRNFVDLGEILFKLAS--------------KMCNC 542

Query: 508 TPQSIDDMRQIDDKFKDVLKYLISDNGDSKKSIHDLTSHF--YDKMFMVLESSQTYTEYM 565
             + + ++ Q+ +K K+++K L  +      ++  +   +   D +F V+E+ QTY+EY 
Sbjct: 543 HGKDVANLAQVSEKLKNLIKSLAFEQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSEYA 602

Query: 566 ESVLSRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSN-G 624
           E+VLSRELENGRLFRL+ KLN IFGR+E+R+DINWSE G KF I+LFYDYVFHQ+D N G
Sbjct: 603 ENVLSRELENGRLFRLICKLNFIFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTG 662

Query: 625 KPIMDLTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667
           KP+ DLTHVLRCLNKLDAG++E ++LVTPDELN  ++SYK++K
Sbjct: 663 KPVTDLTHVLRCLNKLDAGVEENILLVTPDELNTAVVSYKKVK 705

 Score = 98.2 bits (243), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 62/118 (52%), Gaps = 35/118 (29%)

Query: 1   MDKINPDWAKDIPCRNITIYGYCKKEKEGCPFKHSDNTTAT------TINDVPPPIDV-- 52
           MDKINPDWA+D+PCRN+ IYG+CKK+ EGCPFKH D+  AT        + VP P  V  
Sbjct: 1   MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTSTPKVADTVPAPSGVIQ 60

Query: 53  ---------------------------GEATTPTMTSVPKFNAKVSASFTPMTVGSDS 83
                                        A T + + VPKFNAK SASFTPM+  +D 
Sbjct: 61  QPSKISVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFNAKASASFTPMSKAADG 118

>KLLA0E08085g 727056..729026 similar to sp|P36102 Saccharomyces
           cerevisiae YKL025c PAN3 component of the PAB1P-dependent
           poly(A) ribonuclease singleton, start by similarity
          Length = 656

 Score =  399 bits (1025), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/459 (46%), Positives = 289/459 (62%), Gaps = 35/459 (7%)

Query: 217 KYPRIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQV 276
           ++P +YPP HS+LQYHLYAP+ P  LK  LKPNER+ + LFI N++R+ L K N + LQV
Sbjct: 213 QFPTVYPPTHSVLQYHLYAPDPPPHLKIPLKPNERTPETLFINNHLRDRLVKNNQTALQV 272

Query: 277 FPSSGKVIPSIVQDYFNLVPLNFNNNDF------LNKTTLFKVFSNYDGKAYVLKRLPNI 330
           FP     +P IV DYF LVP++F+N          +K +L+KVFSN DGK Y ++R+ ++
Sbjct: 273 FPRGS--LPDIVGDYFGLVPMDFHNRTSDKKRYNGHKNSLYKVFSNLDGKIYFMRRIHDV 330

Query: 331 DKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFV 390
            K  +  ++SK +Q WS +   N+   +D F T+ F D S+C+VFDYYP S SLY+ + +
Sbjct: 331 -KITDSAQVSKPFQTWSHLRSANITVLKDSFVTSAFNDSSLCMVFDYYPQSQSLYETYGL 389

Query: 391 NFPKFPITNNYLWIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNFMD 450
                 +   YLW +LVQLT  +  +HS  L++ N L+W+KV++TG+PGRIK++     D
Sbjct: 390 ANSVNELNQEYLWAFLVQLTIALQEVHSNGLAL-NDLDWKKVIVTGEPGRIKVTDIGVYD 448

Query: 451 LLFNDDTDTVVSSGGSTIEGQQQLDYKYLGXXXXXXXXXXXXXXXXTAPKEYRLEEITPQ 510
            L            G  +  +QQ +Y                    + P           
Sbjct: 449 TL-------NYHQEGRMLHTEQQQNYL---SLAELLLNLVQRLCGASGP----------- 487

Query: 511 SIDDMR--QIDDKFKDVLKYLISDNGDSKKSIHDLTSHFYDKMFMVLESSQTYTEYMESV 568
            +DD++   ID  FK  ++YL  D  ++ K+I D T  F  K+  V+ S Q  +EY+E  
Sbjct: 488 -LDDVKSYHIDPLFKKCIQYL-QDTSNNNKNIEDFTKLFSHKVLSVVNSLQYNSEYLEQQ 545

Query: 569 LSRELENGRLFRLVNKLNCIFGRIESRIDINWSESGTKFPIILFYDYVFHQVDSNGKPIM 628
           LSRELEN RLFRL+ KLN I+GR+ESRIDINW+ESG KFPIILF+DYVFHQ D  GK +M
Sbjct: 546 LSRELENARLFRLMCKLNAIYGRLESRIDINWAESGEKFPIILFFDYVFHQKDDTGKNVM 605

Query: 629 DLTHVLRCLNKLDAGIQEKLMLVTPDELNCIIISYKELK 667
           DLTHVLRCLNKLDAG+ E+LMLVTPDE+NCIIISYKELK
Sbjct: 606 DLTHVLRCLNKLDAGVSERLMLVTPDEMNCIIISYKELK 644

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 42/74 (56%), Gaps = 11/74 (14%)

Query: 6  PDWAKDIPCRNITIYGYCKKEKEGCPFKH--SDNTTATTINDVPPPIDVGEATTPTMTSV 63
          PD  K   CRNI I+GYCK E EGC F H  S  T   T ++VP        T  +MT +
Sbjct: 13 PDSFKGTQCRNIIIHGYCKFENEGCQFNHGNSKETEGQTTDEVP--------TQRSMTPL 64

Query: 64 -PKFNAKVSASFTP 76
            KFNAK S+SFTP
Sbjct: 65 NVKFNAKTSSSFTP 78

>Kwal_47.17868
          Length = 365

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 11/92 (11%)

Query: 361 FQTTKFGDLSICLVFDYYPNSLSLYDYHFV----NFPKFPITNNYLWIYLVQLTNVINSI 416
           ++T   G++ + L+ +Y P SL     HFV    N P+  I      +Y+ QL   +N +
Sbjct: 97  YETDPQGEVYLNLILEYMPQSLYQRLRHFVSQRSNMPRIEIK-----LYMYQLAKSLNYL 151

Query: 417 HSQNLSIGNTLNWRKVLITGDPGRIKLSHCNF 448
           H+        +  + +L+  DP    L  C+F
Sbjct: 152 HTNARVCHRDIKPQNLLV--DPQTFALKLCDF 181

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
           (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 220 RIYPPPHSLLQYHLYAPEQPSSLKSLLKPNERSADQLFIPNNIREDLTKKNLSILQVFPS 279
           R YP   S LQY  Y  ++ +  +S  KP++ S+ + F+ NN  E+L  + LS+ Q+F  
Sbjct: 201 RKYPSKWSQLQYTYYITKKQAGQQSTQKPSQVSSMKRFVLNN--EEL--RFLSLQQIFDR 256

Query: 280 SGKVIPS 286
           +   +PS
Sbjct: 257 AMNDLPS 263

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 18/136 (13%)

Query: 313 VFSNYDGKAYVLKRL----PNIDKSMNPNKISKIYQIWSKINCTNLIKFRDIFQTTKFGD 368
           V  + DG+ + +KR     P         K++  +   S +   N+I+  D+ Q    G+
Sbjct: 280 VIKSTDGQLFAVKRFRPRAPRETLKEYSRKVTSEFCTGSTLRHQNIIETLDMLQE---GE 336

Query: 369 LSICLVFDYYPNSLSLYDYHFVNFPKF-PITNNYLWIYLVQLTNVINSIHSQNLSIGNTL 427
           L   +V +Y P       Y F N      +T + +W Y  Q+   ++ +HSQ L+    L
Sbjct: 337 L-FLVVMEYCP-------YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLHSQGLA-HRDL 387

Query: 428 NWRKVLITGDPGRIKL 443
                ++T D G +KL
Sbjct: 388 KLDNCVVTAD-GILKL 402

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 4/106 (3%)

Query: 344 QIWSKINCTNLIKFRDIF-QTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNNYL 402
           +I   +   N+I  +  F +  +  D+ + L+ DY P SL     HFV+  + P+    +
Sbjct: 80  EIMKMLQHRNIIDLKYYFYEIDEREDVFLNLILDYMPQSLYQRLRHFVH-QRTPMPRLEI 138

Query: 403 WIYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNF 448
            IY+ QL   +N +H         +  + +L+  DP    L  C+F
Sbjct: 139 KIYMYQLFKALNYLHHTANVCHRDIKPQNLLV--DPNSWCLRLCDF 182

>Scas_709.51
          Length = 759

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 13 PCRNITIYGYCKKEKEGCPFKHSDNTTATTINDVPPPIDVGEATT 57
          PC N      C K++  C + +S NTT    ND P  ID  E++T
Sbjct: 49 PCLN------CIKKEIDCEYNNSSNTTKKEPNDPPADIDAAESST 87

>ADR126C [1867] [Homologous to ScYKL072W (STB6) - SH; ScYMR053C
           (STB2) - SH] (929234..931309) [2076 bp, 691 aa]
          Length = 691

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 48/89 (53%), Gaps = 10/89 (11%)

Query: 279 SSGKVIPSIVQDYFNLVPLNFNN-NDFLNKTTLFKVFSNYDGKAYVLKRLPNIDKS--MN 335
           S   V+  ++  YF LV  + ++  D L+++++F          Y  +R   ++K+  ++
Sbjct: 264 SVSAVVSLLLACYFKLVVADVSSLKDPLDESSMFSAV-------YAFQRRHGLEKTACLD 316

Query: 336 PNKISKIYQIWSKINCTNLIKFRDIFQTT 364
              +SK++++ SK   T++ KF+ + ++T
Sbjct: 317 LRTVSKLFEVTSKTFNTDIFKFKRVVKST 345

>KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA61157.1
           Kluyveromyces lactis protein kinase, start by similarity
          Length = 415

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 3/105 (2%)

Query: 344 QIWSKINCTNLIKFRDIFQTTKFGDLSICLVFDYYPNSLSLYDYHFVNFPKFPITNNYLW 403
           +I   I+  NLI  +  F      +L + L+ DY P SL      F++  + P+    + 
Sbjct: 130 EIMKLISHPNLIDLKYYFLEQSDQELYLNLIVDYMPMSLYQRLKEFISLHQ-PMDRYEIK 188

Query: 404 IYLVQLTNVINSIHSQNLSIGNTLNWRKVLITGDPGRIKLSHCNF 448
           IY+ QL   +N +H         +  + +L+  DP  + L  C+ 
Sbjct: 189 IYMFQLFKSLNYLHQVVNVCHRDIKPQNILV--DPDTLLLKICDL 231

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,322,163
Number of extensions: 946238
Number of successful extensions: 2982
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3034
Number of HSP's successfully gapped: 36
Length of query: 667
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 559
Effective length of database: 12,857,365
Effective search space: 7187267035
Effective search space used: 7187267035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)