Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL024C (URA6)20420110621e-149
CAGL0L09867g2601927891e-107
Scas_685.92001947821e-107
Sklu_2380.52891927891e-107
KLLA0E08030g3021937701e-104
Kwal_14.8682822007591e-102
ACR170C2891897133e-95
Scas_721.822212092066e-20
CAGL0K11418g2222262058e-20
YDR226W (ADK1)2222112032e-19
KLLA0F13376g2272172023e-19
Scas_681.182481941946e-18
Sklu_2123.22282171929e-18
CAGL0L11902g2511951939e-18
AGR187W2772191903e-17
Kwal_27.116072272171865e-17
AGR115C2512071876e-17
KLLA0C17754g2271851841e-16
Kwal_56.234892251891771e-15
YER170W (ADK2)2251861594e-13
Sklu_2063.3208140942e-04
ACL150W219140850.004
Sklu_2300.129346710.23
AAR041W51464720.23
Kwal_23.385952867710.28
KLLA0D09020g53057710.30
KLLA0D12386g211148690.40
YPR088C (SRP54)54172700.45
CAGL0K07986g53268700.45
Sklu_2259.252267690.48
YKL010C (UFD4)148363690.57
YDL166C (FAP7)19731670.70
KLLA0D18579g59293670.95
Sklu_1599.251348671.00
CAGL0G01232g73045661.3
KLLA0E03102g54453661.4
ADR282C221118641.8
Kwal_47.1746978136651.9
ABR019C73071633.0
AER188C217449633.9
Scas_617.742064624.2
CAGL0F02343g34519614.5
KLLA0A01386g37849614.8
CAGL0K02167g116258616.2
AFL002C1151116607.2
Sklu_1579.235635599.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL024C
         (201 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL024C (URA6) [3231] chr11 complement(392169..392783) Uridine-m...   413   e-149
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...   308   e-107
Scas_685.9                                                            305   e-107
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                         308   e-107
KLLA0E08030g complement(724562..725470) some similarities with s...   301   e-104
Kwal_14.868                                                           296   e-102
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...   279   3e-95
Scas_721.82                                                            84   6e-20
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...    84   8e-20
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...    83   2e-19
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...    82   3e-19
Scas_681.18                                                            79   6e-18
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                            79   9e-18
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...    79   9e-18
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...    78   3e-17
Kwal_27.11607                                                          76   5e-17
AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...    77   6e-17
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...    75   1e-16
Kwal_56.23489                                                          73   1e-15
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...    66   4e-13
Sklu_2063.3 YDL166C, Contig c2063 1224-1850                            41   2e-04
ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH] complement(8...    37   0.004
Sklu_2300.1 YKL107W, Contig c2300 3026-3907 reverse complement         32   0.23 
AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH] complement(...    32   0.23 
Kwal_23.3859                                                           32   0.28 
KLLA0D09020g 758818..760410 similar to sp|P20424 Saccharomyces c...    32   0.30 
KLLA0D12386g complement(1054141..1054776) similar to sp|Q12055 S...    31   0.40 
YPR088C (SRP54) [5513] chr16 complement(711399..713024) Signal r...    32   0.45 
CAGL0K07986g complement(791812..793410) highly similar to sp|P20...    32   0.45 
Sklu_2259.2 YPR088C, Contig c2259 679-2247 reverse complement          31   0.48 
YKL010C (UFD4) [3246] chr11 complement(421067..425518) Ubiquitin...    31   0.57 
YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential p...    30   0.70 
KLLA0D18579g complement(1565442..1567220) some similarities with...    30   0.95 
Sklu_1599.2 YJL194W, Contig c1599 2012-3553 reverse complement         30   1.00 
CAGL0G01232g complement(114924..117116) similar to sp|P09620 Sac...    30   1.3  
KLLA0E03102g complement(292918..294552) weakly similar to sgd|S0...    30   1.4  
ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)...    29   1.8  
Kwal_47.17469                                                          30   1.9  
ABR019C [610] [Homologous to ScYMR078C (CTF18) - SH] (427048..42...    29   3.0  
AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH] (986526..99...    29   3.9  
Scas_617.7                                                             28   4.2  
CAGL0F02343g 226725..227762 similar to sp|P43591 Saccharomyces c...    28   4.5  
KLLA0A01386g 125585..126721 weakly similar to sp|P40026 Saccharo...    28   4.8  
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    28   6.2  
AFL002C [3191] [Homologous to ScYAL001C (TFC3) - SH] (432329..43...    28   7.2  
Sklu_1579.2 YBR087W, Contig c1579 1374-2444                            27   9.2  

>YKL024C (URA6) [3231] chr11 complement(392169..392783)
           Uridine-monophosphate kinase (uridylate kinase),
           catalyzes the conversion of ATP and UMP to ADP and UDP
           [615 bp, 204 aa]
          Length = 204

 Score =  413 bits (1062), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 201/201 (100%), Positives = 201/201 (100%)

Query: 1   MTAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGS 60
           MTAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGS
Sbjct: 1   MTAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGS 60

Query: 61  QYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIV 120
           QYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIV
Sbjct: 61  QYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIV 120

Query: 121 ESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKV 180
           ESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKV
Sbjct: 121 ESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKV 180

Query: 181 VRVRCDRSVEDVYKDVQDAIR 201
           VRVRCDRSVEDVYKDVQDAIR
Sbjct: 181 VRVRCDRSVEDVYKDVQDAIR 201

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score =  308 bits (789), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/192 (75%), Positives = 166/192 (86%)

Query: 9   PAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKN 68
           PAFS DQVSVIFVLGGPGAGKGTQC KLV DY FVHLSAGDLLRAEQ R GS++GELIK+
Sbjct: 63  PAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAGDLLRAEQNREGSEFGELIKH 122

Query: 69  CIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFF 128
            IKEG IVPQEITL+LL+ AI +N + N  KFL+DGFPRKMDQA+SFE+ IV SKF LFF
Sbjct: 123 YIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLFF 182

Query: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRS 188
           +CPE +MLERLLERGKTSGR+DDNIESIKKRF TF+ETSMPV+ YF+++ KVV+VRCD  
Sbjct: 183 ECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFEETSMPVVRYFDSQDKVVKVRCDHP 242

Query: 189 VEDVYKDVQDAI 200
           VEDVY  V+ A+
Sbjct: 243 VEDVYNQVKQAL 254

>Scas_685.9
          Length = 200

 Score =  305 bits (782), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/194 (74%), Positives = 165/194 (85%)

Query: 7   SQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELI 66
           S  AF+PDQVSVIFVLGGPGAGKGTQC KLV DY FVHLSAGDLLRAEQ R GS++G LI
Sbjct: 2   STTAFTPDQVSVIFVLGGPGAGKGTQCAKLVADYGFVHLSAGDLLRAEQNREGSEFGTLI 61

Query: 67  KNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFIL 126
           K+ I EG IVPQEITLALL+NAI +N      KFL+DGFPRKMDQA+SFE  IV SKFIL
Sbjct: 62  KHYITEGLIVPQEITLALLKNAIQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFIL 121

Query: 127 FFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCD 186
           FFDCPED+MLERLL+RGKTSGR DDNIESIKKRF TF+ETSMPV++YFE + KV+++RCD
Sbjct: 122 FFDCPEDVMLERLLDRGKTSGRVDDNIESIKKRFKTFEETSMPVVKYFEDQHKVIKIRCD 181

Query: 187 RSVEDVYKDVQDAI 200
             V+DVYK V+ A+
Sbjct: 182 SPVDDVYKQVKAAV 195

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score =  308 bits (789), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 168/192 (87%)

Query: 9   PAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKN 68
           PAFSP+ VSV+FVLGGPGAGKGTQC KLVKDY FVHLSAGDLLRAEQ R GS+YG LIK+
Sbjct: 92  PAFSPEDVSVVFVLGGPGAGKGTQCTKLVKDYGFVHLSAGDLLRAEQNRKGSEYGALIKH 151

Query: 69  CIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFF 128
            IKEG IVPQE+T+ALL+NAI +N +  K +FL+DGFPRKMDQAI+FE+ IV SKF LFF
Sbjct: 152 YIKEGLIVPQEVTVALLQNAIRENFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFF 211

Query: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRS 188
           DCPE +MLERLLERGKTSGR+DDNIESIKKRF TF ETSMPV+EYFE ++KV++V CD+ 
Sbjct: 212 DCPETVMLERLLERGKTSGRTDDNIESIKKRFRTFIETSMPVVEYFEKQNKVIKVSCDQP 271

Query: 189 VEDVYKDVQDAI 200
           +++VYK VQ A+
Sbjct: 272 IDEVYKKVQTAV 283

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score =  301 bits (770), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 166/193 (86%)

Query: 9   PAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKN 68
           PAFS D V V+FVLGGPGAGKGTQC KLVKD+ FVHLSAGDLLRAEQ R GSQYGELIK 
Sbjct: 105 PAFSKDDVLVVFVLGGPGAGKGTQCAKLVKDFGFVHLSAGDLLRAEQAREGSQYGELIKK 164

Query: 69  CIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFF 128
           CIK+G+IVPQE+T+ALL+NAI+ N  ++  KFL+DGFPRKMDQAI+FE +IV S   LFF
Sbjct: 165 CIKDGEIVPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFF 224

Query: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRS 188
           DCPE IMLERLL+RGKTSGR DDNIESI+KRF TF ETS+PV+EYFE ++KVV+V C++ 
Sbjct: 225 DCPEKIMLERLLQRGKTSGRIDDNIESIQKRFKTFVETSVPVVEYFEKQNKVVKVSCNQP 284

Query: 189 VEDVYKDVQDAIR 201
           V++VY+ V +AI+
Sbjct: 285 VDEVYQHVTEAIK 297

>Kwal_14.868
          Length = 282

 Score =  296 bits (759), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/200 (70%), Positives = 162/200 (81%)

Query: 2   TAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQ 61
            +  ++ PAFS   VSVIFVLGGPGAGKGTQC  LV+DY FVHLSAGDLLRAEQ R GS+
Sbjct: 79  NSKASTGPAFSDKDVSVIFVLGGPGAGKGTQCANLVRDYQFVHLSAGDLLRAEQNREGSK 138

Query: 62  YGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVE 121
           YG LIK+ IKEG IVPQE+T+ALL+ AI DN      +FL+DGFPRKMDQAI+FE  IV 
Sbjct: 139 YGALIKHYIKEGLIVPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVP 198

Query: 122 SKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVV 181
           SKF LFFDCPE +ML+RLLERGKTSGRSDDN+ESIKKRF TF ETSMPV+EYFE + KVV
Sbjct: 199 SKFTLFFDCPEKVMLQRLLERGKTSGRSDDNVESIKKRFKTFIETSMPVVEYFEKQDKVV 258

Query: 182 RVRCDRSVEDVYKDVQDAIR 201
            V CD SVE VY+ V+ A++
Sbjct: 259 SVSCDHSVEKVYEQVKAAVK 278

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score =  279 bits (713), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 128/189 (67%), Positives = 157/189 (83%)

Query: 13  PDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKE 72
           P   SV+FVLGGPG+GKGTQC +LV+   FVH+ AGDLLR EQ R GSQYGELIK+ IKE
Sbjct: 95  PADASVVFVLGGPGSGKGTQCSRLVERMQFVHVGAGDLLRDEQNRPGSQYGELIKHHIKE 154

Query: 73  GQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPE 132
           G IVPQE+T+ALLR AI ++ +A + KFL+DGFPRKMDQA +FE+ +V SKF+LFFDCPE
Sbjct: 155 GLIVPQEVTVALLRRAIEEHYRAGRRKFLVDGFPRKMDQAFTFEKTVVPSKFVLFFDCPE 214

Query: 133 DIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDV 192
            +MLERLL RG+TSGRSDDNIESIKKRF T+ ETSMPV+E+F  + KVVR+ CD+ VE+V
Sbjct: 215 RVMLERLLTRGQTSGRSDDNIESIKKRFRTYVETSMPVVEHFAQQDKVVRLSCDQPVEEV 274

Query: 193 YKDVQDAIR 201
           YK V+ A++
Sbjct: 275 YKQVEAAVK 283

>Scas_721.82
          Length = 221

 Score = 84.0 bits (206), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 103/209 (49%), Gaps = 33/209 (15%)

Query: 19  IFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQ 78
           + ++G PGAGKGTQ   LV+ +   HLS GD+LR++  +  ++ G+  K  + +G +V  
Sbjct: 8   MVLIGPPGAGKGTQAPNLVEKFHACHLSTGDMLRSQIAK-NTELGQEAKKIMDQGGLVSD 66

Query: 79  EITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILF----FDCPEDI 134
           EI + ++++ +++N  A K+ F++DGFPR + QA   ++ + E    L         +D+
Sbjct: 67  EIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDDL 125

Query: 135 MLERLLER--GKTSG-------------------------RSDDNIESIKKRFNTFKETS 167
           ++ R+  R     SG                         RSDDN +++KKR   +   +
Sbjct: 126 LVARITGRLIHPASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQT 185

Query: 168 MPVIEYFETKSKVVRVRCDRSVEDVYKDV 196
            P++++++       V   +    V+ ++
Sbjct: 186 EPIVDFYKKTGIWSGVDASQPPATVWDEI 214

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score = 83.6 bits (205), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 108/226 (47%), Gaps = 46/226 (20%)

Query: 12  SPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIK 71
           S D + ++ + G PGAGKGTQ   LV+ +   HL+ GD+LR++  + G++ G   K  + 
Sbjct: 3   SSDSIRMVLI-GPPGAGKGTQAPNLVERFHAAHLATGDMLRSQISK-GTELGLQAKKIMD 60

Query: 72  EGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFIL----- 126
           +G +V  +I + ++++ +++N  A K+ F++DGFPR + QA   +  + E    L     
Sbjct: 61  QGGLVSDDIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDNMLKERGTPLEKAVE 119

Query: 127 ---------------------------FFDCP-----EDIMLERLLERGKTSGRSDDNIE 154
                                       F+ P     +D+  E L++      RSDDN +
Sbjct: 120 LKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVTGEPLVQ------RSDDNED 173

Query: 155 SIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAI 200
           ++KKR   + + + P++++++       V   +  E V+  +  A+
Sbjct: 174 ALKKRLGAYHDQTEPIVDFYKKTGIWADVDASQPPETVWSAILKAL 219

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 104/211 (49%), Gaps = 37/211 (17%)

Query: 19  IFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQ 78
           + ++G PGAGKGTQ   L + +   HL+ GD+LR++  + G+Q G   K  + +G +V  
Sbjct: 9   MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK-GTQLGLEAKKIMDQGGLVSD 67

Query: 79  EITLALLRNAISDNVKANKHKFLIDGFPR------KMDQAISFERDIVESKFILFFDCPE 132
           +I + ++++ +++N  A K+ F++DGFPR      K+DQ +  +   +E    L  D  +
Sbjct: 68  DIMVNMIKDELTNN-PACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVD--D 124

Query: 133 DIMLERLLER--GKTSG-------------------------RSDDNIESIKKRFNTFKE 165
           ++++ R+  R     SG                         RSDDN +++KKR   +  
Sbjct: 125 ELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHA 184

Query: 166 TSMPVIEYFETKSKVVRVRCDRSVEDVYKDV 196
            + P++++++       V   +    V+ D+
Sbjct: 185 QTEPIVDFYKKTGIWAGVDASQPPATVWADI 215

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score = 82.4 bits (202), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 109/217 (50%), Gaps = 38/217 (17%)

Query: 13  PDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKE 72
           P+ + ++ + G PGAGKGTQ   L + +   HL+ GD+LR++  +  +  G   K  + +
Sbjct: 9   PESIRMVLI-GPPGAGKGTQAPNLTERFCACHLATGDMLRSQVAKQ-TPLGIEAKKIMDD 66

Query: 73  GQIVPQEITLALLRNAISDNVKANKHKFLIDGFPR------KMDQAISFERDIVESKFIL 126
           G++V  EI + ++++ +++N    K  F++DGFPR      K+D+ ++ +   +E    L
Sbjct: 67  GKLVSDEIMINMIKDELTNNQDCKK-GFILDGFPRTIPQAEKLDEMLAQQGRPLEKAVEL 125

Query: 127 FFDCPEDIMLERLLER--GKTSG-------------------------RSDDNIESIKKR 159
             D  +++++ R+  R     SG                         RSDDN+E++KKR
Sbjct: 126 KID--DELLVSRITGRLVHPASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKKR 183

Query: 160 FNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDV 196
             ++ + + P++++++       V   +  + V+ D+
Sbjct: 184 LTSYHKQTEPIVDFYKKTGIWAGVDASQPPKTVWSDI 220

>Scas_681.18
          Length = 248

 Score = 79.3 bits (194), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 102/194 (52%), Gaps = 36/194 (18%)

Query: 19  IFVLGGPGAGKGTQCEKLVKDYSFVH-LSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVP 77
           +  LG PG+GKGTQ  +L++    V+ +S+GD+LR E  +A ++ G+L    I +G+++P
Sbjct: 10  LVFLGAPGSGKGTQISRLIQLLPTVNRISSGDILRQEI-QAETKLGQLASQFIAQGKLIP 68

Query: 78  QEITLALLRNAISD-NVKANKHK--FLIDGFPRKMDQAISFERDIVES----KFILFFDC 130
            ++   LL + + + N  A + K  +++DGFPR + QA  F+  + +       ++  D 
Sbjct: 69  DDLIDKLLISKLQEQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDV 128

Query: 131 PEDIMLERLLER--------------------GK--TSG-----RSDDNIESIKKRFNTF 163
           P +++LER+  R                    GK   +G     RSDD+  + KKR   +
Sbjct: 129 PTEVILERIENRYVHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEY 188

Query: 164 KETSMPVIEYFETK 177
            ET  P+ EY++++
Sbjct: 189 HETLGPLKEYYQSQ 202

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score = 78.6 bits (192), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 107/217 (49%), Gaps = 38/217 (17%)

Query: 13  PDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKE 72
           P+ + ++ + G PGAGKGTQ   L + +   HL+ GD+LR++  +  +  G   K  + +
Sbjct: 10  PESIRMVLI-GPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAKK-TALGLEAKKIMDQ 67

Query: 73  GQIVPQEITLALLRNAISDNVKANKHKFLIDGFPR------KMDQAISFERDIVESKFIL 126
           G +V  +I + +++  ++ N +  K+ F++DGFPR      K+D+ ++ +   +E    L
Sbjct: 68  GGLVSDDIMVNMIKEELATNPEC-KNGFILDGFPRTIPQAEKLDEMLAEQGKPLERAIEL 126

Query: 127 FFDCPEDIMLERLLER--GKTSG-------------------------RSDDNIESIKKR 159
             D  +++++ R+  R     SG                         RSDDN +++KKR
Sbjct: 127 KID--DELLVARITGRLVHPASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKR 184

Query: 160 FNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDV 196
            N + + + P++++++       V   ++   V+ D+
Sbjct: 185 LNAYHQQTEPIVDFYKKTGIWSGVDASQAPSTVWSDI 221

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score = 79.0 bits (193), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 96/195 (49%), Gaps = 34/195 (17%)

Query: 27  AGKGTQCEKLVKDY-SFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALL 85
           +GKGTQ  KL+K       +S+GD+LR E  ++G++ G L    I +G+++P ++   +L
Sbjct: 19  SGKGTQTSKLLKVLPELKSVSSGDILRHEL-KSGTELGVLAAKYIAQGKLIPDKVITQVL 77

Query: 86  RNAISDNVKAN-KHKFLIDGFPRKMDQAISFERDIVES----KFILFFDCPEDIMLERLL 140
              +S     N +  +L+DGFPR   QA S +  + E+      ++  D PE+++LER+ 
Sbjct: 78  IAHLSKEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERID 137

Query: 141 ER----------------GKTSG-----------RSDDNIESIKKRFNTFKETSMPVIEY 173
            R                 K +G           RSDDN++  KKR   +K+T  P+ E+
Sbjct: 138 NRYIHVGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEH 197

Query: 174 FETKSKVVRVRCDRS 188
           +  +  +  +  D S
Sbjct: 198 YAKQGILATISGDTS 212

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score = 77.8 bits (190), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 104/219 (47%), Gaps = 34/219 (15%)

Query: 13  PDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKE 72
           P+ + ++ + G PGAGKGTQ  KL + +   HL+ GD+LR++  +  +  G   K  + +
Sbjct: 60  PEAIRMVLI-GPPGAGKGTQAPKLKEKFCVCHLATGDMLRSQVAKQ-TALGVQAKKIMDQ 117

Query: 73  GQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFIL----FF 128
           G +V  EI + ++++ +  N +   + F++DGFPR + QA   +  +V     L      
Sbjct: 118 GGLVSDEIMVNMIKDELRSNPEC-ANGFILDGFPRTIPQAQKLDEMLVAQGKPLDRAVEL 176

Query: 129 DCPEDIMLERLLER--GKTSG-------------------------RSDDNIESIKKRFN 161
              +++++ R+  R     SG                         RSDDN +++KKR +
Sbjct: 177 KIDDELLVARITGRLVHPASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLD 236

Query: 162 TFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAI 200
            +   + P++++++       V   +  + V+ D+  A+
Sbjct: 237 AYHAQTEPIVDFYKKTGIWAGVDASQPPKTVWSDILKAL 275

>Kwal_27.11607
          Length = 227

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 106/217 (48%), Gaps = 38/217 (17%)

Query: 13  PDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKE 72
           P+ V ++ + G PGAGKGTQ   L + +   HL+ GD+LR++  +  ++ G   K  + +
Sbjct: 9   PESVRMVLI-GPPGAGKGTQAPNLKERFCACHLATGDMLRSQVAQK-TELGLEAKKIMDQ 66

Query: 73  GQIVPQEITLALLRNAISDNVKANKHKFLIDGFPR------KMDQAISFERDIVESKFIL 126
           G +V  +I + ++++ +  N +  K  F++DGFPR      K+DQ ++ +   +E    L
Sbjct: 67  GGLVSDDIMVKMIKHELITNPEC-KSGFILDGFPRTIPQAEKLDQMLTEQGRPLEKAIEL 125

Query: 127 FFDCPEDIMLERLLER--GKTSG-------------------------RSDDNIESIKKR 159
             D  +++++ R+  R     SG                         RSDDN +++KKR
Sbjct: 126 KID--DELLVSRITGRLVHPASGRSYHKIFNPPKKEMTDDVTGEALVQRSDDNADALKKR 183

Query: 160 FNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDV 196
              + + + P++++++       V   +  + V+ D+
Sbjct: 184 LGAYHQQTEPIVDFYKKTGIWSGVDASQPPKTVWADI 220

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score = 76.6 bits (187), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 96/207 (46%), Gaps = 42/207 (20%)

Query: 19  IFVLGGPGAGKGTQCEKLVKDYSFVH-LSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVP 77
           + +LG PGAGKGTQ  +L++ +  +  +++GDLLR E   AGS  GE     I  G+++P
Sbjct: 33  LLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLP 91

Query: 78  QEITLALLRNAISDNVKANKH-----KFLIDGFPRKMDQA----ISFERDIVESKFILFF 128
                AL+ +AI D +   +       +L+DGFPR + QA     + ER       ++  
Sbjct: 92  D----ALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALERADAALTLVVEV 147

Query: 129 DCPEDIMLERLLER------GKT---------------------SGRSDDNIESIKKRFN 161
             PED++L+R+ +R      G+                      S R DD  E   KR  
Sbjct: 148 AVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQ 207

Query: 162 TFKETSMPVIEYFETKSKVVRVRCDRS 188
            +  T+ P+ E++  +  +  VR   S
Sbjct: 208 EYAATAGPLKEHYARQGILRTVRGPTS 234

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 91/185 (49%), Gaps = 34/185 (18%)

Query: 23  GGPGAGKGTQCEKLVKDY-SFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEIT 81
           G PG+GKGTQ  KL+K++ S   +S+GDLLR +Q   G+  G    + I++GQ++P ++ 
Sbjct: 13  GAPGSGKGTQTSKLLKEFGSIKAISSGDLLR-KQIEHGTPLGLSASSYIEKGQLLPDDLI 71

Query: 82  LALLRNAISDNVKANKH-KFLIDGFPRKMDQAISFERDIVES----KFILFFDCPEDIML 136
             ++ + +      N +  +L+DGFPR + QA   ++ ++E       ++  D P +++L
Sbjct: 72  TGVVCDELKSRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVIL 131

Query: 137 ERLLER--------------------GK-------TSGRSDDNIESIKKRFNTFKETSMP 169
           ER+  R                    GK        + R DD  E   KR   + +T  P
Sbjct: 132 ERIENRYVHVPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTP 191

Query: 170 VIEYF 174
           + E++
Sbjct: 192 LKEHY 196

>Kwal_56.23489
          Length = 225

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 89/189 (47%), Gaps = 34/189 (17%)

Query: 19  IFVLGGPGAGKGTQCEKLVKDYSFVH-LSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVP 77
           I +LG PG+GKGTQ  KL+  + ++  +S+GDLLR E  +  +  G L    I +G+++P
Sbjct: 6   ILLLGAPGSGKGTQTSKLLSHFKYIRSISSGDLLRQEIQKK-THLGSLASEYISQGKLLP 64

Query: 78  QEITLALLRNAISD-NVKANKHKFLIDGFPRKMDQAISFERDIVES----KFILFFDCPE 132
             +   L+ N ++   + ++   FL+DGFPR +DQA S    +         ++  D P 
Sbjct: 65  DSLVTELVTNELTARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPS 124

Query: 133 DIMLERLLER--------------------GK-------TSGRSDDNIESIKKRFNTFKE 165
            ++LER+  R                    GK        + R DD  E   KR   + +
Sbjct: 125 SVILERIENRYVHVPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQ 184

Query: 166 TSMPVIEYF 174
           T  P+ +++
Sbjct: 185 TVEPLKQFY 193

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 84/186 (45%), Gaps = 34/186 (18%)

Query: 23  GGPGAGKGTQCEKLVKDY-SFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEIT 81
           G PG+GKGTQ  +L+K       +S+GD+LR E  ++ S  G      I +G+++P ++ 
Sbjct: 21  GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEI-KSESTLGREATTYIAQGKLLPDDLI 79

Query: 82  LALLRNAISD-NVKANKHKFLIDGFPRKMDQAISFERDIVES----KFILFFDCPEDIML 136
             L+   +S          +L+DGFPR   QA + +  + +       ++  D PE  +L
Sbjct: 80  TRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTIL 139

Query: 137 ERLLER----------------GKTSG-----------RSDDNIESIKKRFNTFKETSMP 169
           ER+  R                 K  G           R DD  E  KKR   +K+T+ P
Sbjct: 140 ERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEP 199

Query: 170 VIEYFE 175
           + +Y++
Sbjct: 200 LKDYYK 205

>Sklu_2063.3 YDL166C, Contig c2063 1224-1850
          Length = 208

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 63/140 (45%), Gaps = 25/140 (17%)

Query: 19  IFVLGGPGAGKGTQCEKLVK---DYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQI 75
           I V G PG GK T CE LV+   DY++ ++S  D  R  +   G  Y E+ K+ I +   
Sbjct: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHIVDEDK 65

Query: 76  VPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIM 135
           +  E+   LLR       K+     + D FP ++               ++   C   I+
Sbjct: 66  LLDELE-PLLRKG-----KSIVDWHVNDVFPERL------------IDLVVVLRCDNSIL 107

Query: 136 LERLLERGKTSGRSDDNIES 155
            +RL +RG    + ++N+++
Sbjct: 108 YDRLHKRGYHDSKIEENLDA 127

>ACL150W [899] [Homologous to ScYDL166C (FAP7) - SH]
           complement(87745..88404) [660 bp, 219 aa]
          Length = 219

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 58/140 (41%), Gaps = 25/140 (17%)

Query: 19  IFVLGGPGAGKGTQCEKL---VKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQI 75
           I V G PG GK T CE L   + DY + ++S  D  R      G  Y E  K+ I +   
Sbjct: 10  ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDG--YDEARKSHIVDEDR 65

Query: 76  VPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIM 135
           +  E+   L R     +   N      D FP ++               ++   C   I+
Sbjct: 66  LLDELEPLLRRGGAIVDWHVN------DIFPERL------------IDLVVVLRCDNAIL 107

Query: 136 LERLLERGKTSGRSDDNIES 155
            +RL +RG  S + ++NI++
Sbjct: 108 HDRLQKRGYHSSKIEENIDA 127

>Sklu_2300.1 YKL107W, Contig c2300 3026-3907 reverse complement
          Length = 293

 Score = 32.0 bits (71), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 2   TAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSA 47
           TA    +P+  P   + +FV+G PGAGK    + L  D S+  +SA
Sbjct: 128 TAPKLGRPSVLPGVGTRVFVMGYPGAGKVGNVDDLNSDKSYGVMSA 173

>AAR041W [227] [Homologous to ScYPR088C (SRP54) - SH]
           complement(414310..415854) [1545 bp, 514 aa]
          Length = 514

 Score = 32.3 bits (72), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 10  AFSPDQ--VSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIK 67
           A+ P +   +V+  +G  GAGK T C KL   YS      G L+ A+  RAG+ + +L +
Sbjct: 97  AYQPKKKKSNVVMFVGLQGAGKSTSCSKLAVYYSKRGFKVG-LVCADTFRAGA-FDQLKQ 154

Query: 68  NCIK 71
           N IK
Sbjct: 155 NAIK 158

>Kwal_23.3859
          Length = 528

 Score = 32.0 bits (71), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 7   SQPAFSPDQ--VSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGE 64
           +QP F P +   +VI  +G  G+GK T C KL   YS      G L+ A+  RAG+ + +
Sbjct: 94  TQP-FQPKKRKQNVIMFVGLQGSGKTTSCTKLAVYYSKRGFKVG-LVCADTFRAGA-FDQ 150

Query: 65  LIKNCIK 71
           L +N IK
Sbjct: 151 LKQNAIK 157

>KLLA0D09020g 758818..760410 similar to sp|P20424 Saccharomyces
           cerevisiae YPR088c SRP54 signal recognition particle
           subunit, start by similarity
          Length = 530

 Score = 32.0 bits (71), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 15  QVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIK 71
           Q +VI  +G  G+GK T C KL   YS      G L+ A+  RAG+ + +L +N IK
Sbjct: 106 QSNVIMFVGLQGSGKTTSCTKLAVYYSKRGYKVG-LVCADTFRAGA-FDQLKQNAIK 160

>KLLA0D12386g complement(1054141..1054776) similar to sp|Q12055
           Saccharomyces cerevisiae YDL166c singleton, start by
           similarity
          Length = 211

 Score = 31.2 bits (69), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 62/148 (41%), Gaps = 29/148 (19%)

Query: 11  FSPDQVSVIFVLGGPGAGKGTQCEKL---VKDYSFVHLSAGDLLRAEQGRAGSQYGELIK 67
           F P+    I V G PG GK T CE L   + +Y++ ++S  D  +      G  Y +  K
Sbjct: 6   FKPN----IIVSGTPGCGKSTTCELLSRRLPEYTYYNIS--DFAKEHDCYDG--YDDARK 57

Query: 68  NCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILF 127
           + I +   +  E+   L +     +   N      D FP ++               ++ 
Sbjct: 58  SNIVDDDKLLDELEPLLRKGGCIIDWHVN------DVFPERL------------VDLVVV 99

Query: 128 FDCPEDIMLERLLERGKTSGRSDDNIES 155
             C   I+ +RL +RG  + + ++N+++
Sbjct: 100 LRCDNGILYDRLNKRGYHNAKIEENMDA 127

>YPR088C (SRP54) [5513] chr16 complement(711399..713024) Signal
           recognition particle subunit [1626 bp, 541 aa]
          Length = 541

 Score = 31.6 bits (70), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 2   TAATTSQPAFSPDQ--VSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAG 59
           T   + + AF P +   ++I  +G  G+GK T C KL   YS      G L+ A+  RAG
Sbjct: 93  TCEGSEEKAFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVG-LVCADTFRAG 151

Query: 60  SQYGELIKNCIK 71
           + + +L +N I+
Sbjct: 152 A-FDQLKQNAIR 162

>CAGL0K07986g complement(791812..793410) highly similar to sp|P20424
           Saccharomyces cerevisiae YPR088c, start by similarity
          Length = 532

 Score = 31.6 bits (70), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 6   TSQPAFSPDQ--VSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYG 63
           T    F P +   ++I  +G  G+GK T C KL   YS      G L+ A+  RAG+ + 
Sbjct: 95  TDHKVFQPKKKATNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVG-LVCADTFRAGA-FD 152

Query: 64  ELIKNCIK 71
           +L +N +K
Sbjct: 153 QLKQNAVK 160

>Sklu_2259.2 YPR088C, Contig c2259 679-2247 reverse complement
          Length = 522

 Score = 31.2 bits (69), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 7   SQPAFSPDQ--VSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGE 64
           +QP F P +   ++I  +G  G+GK T C KL   YS      G L+ A+  RAG+ + +
Sbjct: 94  TQP-FQPKKKKQNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVG-LVCADTFRAGA-FDQ 150

Query: 65  LIKNCIK 71
           L +N IK
Sbjct: 151 LKQNAIK 157

>YKL010C (UFD4) [3246] chr11 complement(421067..425518)
           Ubiquitin-protein ligase (E3 enzyme) functioning in
           ubiquitin fusion degradation pathway [4452 bp, 1483 aa]
          Length = 1483

 Score = 31.2 bits (69), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 122 SKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVV 181
           S+FI+    PED   ER+L   K +G SD  + S +++F++  +  +P++    T +   
Sbjct: 469 SRFIVVLFPPED---ERILSADKYTGNSDRGVISNQEKFDSLVQCLIPILVEIYTNAADF 525

Query: 182 RVR 184
            VR
Sbjct: 526 DVR 528

>YDL166C (FAP7) [705] chr4 complement(163450..164043) Essential
          protein important for Skn7p-dependent transcription of
          target genes during oxidative stress [594 bp, 197 aa]
          Length = 197

 Score = 30.4 bits (67), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 19 IFVLGGPGAGKGTQCEKL---VKDYSFVHLS 46
          I V G PG GK + CE L   +KDY + ++S
Sbjct: 10 IIVTGTPGCGKSSTCEFLKNKLKDYKYYNIS 40

>KLLA0D18579g complement(1565442..1567220) some similarities with
           sp|P49686 Saccharomyces cerevisiae YDR192c NUP42 nuclear
           pore protein singleton, hypothetical start
          Length = 592

 Score = 30.4 bits (67), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 13/93 (13%)

Query: 109 MDQAISFERDIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSM 168
           MD+  SF      S + L   CP +++  R             +  S + RF+ +K    
Sbjct: 69  MDEVRSFLSYPNGSSYGLAAPCPVNVIANR-------------DYSSAESRFDYWKSIKQ 115

Query: 169 PVIEYFETKSKVVRVRCDRSVEDVYKDVQDAIR 201
             I  +ET++K  R   ++ V  V K+ + A R
Sbjct: 116 GTIPQYETEAKARRNDMEKCVTFVKKEAKRAAR 148

>Sklu_1599.2 YJL194W, Contig c1599 2012-3553 reverse complement
          Length = 513

 Score = 30.4 bits (67), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 19  IFVLGGPGAGKGTQCEKLVKD--YSFVHLSAGDLLRAEQGRAGSQYGE 64
           +++ G PG GK  Q + +V++   S V  SA  + + E+G A + Y E
Sbjct: 122 LYITGPPGTGKTAQLDLIVRERFQSLVLGSADRVPKHEEGLANTAYFE 169

>CAGL0G01232g complement(114924..117116) similar to sp|P09620
           Saccharomyces cerevisiae YGL203c KEX1 carboxypeptidase,
           hypothetical start
          Length = 730

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 89  ISDNVKANKHKFLIDGFPR-KMDQAISFERDIVESKFILFFDCPE 132
           ISD +K+ +H  L+DG  R ++++++++  DI    F +  D PE
Sbjct: 619 ISDYIKSRRHPILVDGDGRSRLNKSVTWASDIENGSFDIEDDDPE 663

>KLLA0E03102g complement(292918..294552) weakly similar to
           sgd|S0005664 Saccharomyces cerevisiae YOR138c,
           hypothetical start
          Length = 544

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 24  GPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIV 76
            P   KG   E +  DY  VH +AG LL  ++   GS+Y E+    I   Q++
Sbjct: 96  NPHWFKG---ELVQSDYRLVHRNAGPLLIHKRELTGSEYLEMQPELIPRMQLL 145

>ADR282C [2023] [Homologous to ScYMR157C - SH] (1182869..1183534)
           [666 bp, 221 aa]
          Length = 221

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 48/118 (40%), Gaps = 20/118 (16%)

Query: 11  FSPDQVSVIFVLG--------GPGAGKGTQCEKLVKDY-SFVHLSAGDLLRAEQGRAGSQ 61
           F PD++ V+ VL          P   +  + ++ ++ + +  H     LL       G  
Sbjct: 85  FKPDELEVLAVLADVPVEKIRAPAGARAVRVQQALERFRTDEHDKYHALLEELHAVHGDD 144

Query: 62  YGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDI 119
           Y   +          P+   +AL+   + +  +A     L+ GFPR M +AI FE ++
Sbjct: 145 YSAHL----------PKGALVALMGRYLKEVCQAGDSVVLL-GFPRNMQEAIQFESEV 191

>Kwal_47.17469
          Length = 781

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 13  PDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAG 48
           PDQ +  +V G P A KG + EK V  +  +H   G
Sbjct: 246 PDQTTFDYVEGRPLAPKGAEWEKAVAYWKTLHTDEG 281

>ABR019C [610] [Homologous to ScYMR078C (CTF18) - SH]
           (427048..429240) [2193 bp, 730 aa]
          Length = 730

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 2   TAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKD--YSFVHLSAGDLLRAEQGRAG 59
            AA   +      Q  ++ + G PG GK +    L +   Y+ + L+A D       R G
Sbjct: 166 AAAEQPEDPLQRPQKRILLLHGPPGIGKTSVAHVLARQAGYAVMELNASD------ERGG 219

Query: 60  SQYGELIKNCI 70
           ++  E ++NC+
Sbjct: 220 TRLREKVRNCL 230

>AER188C [2690] [Homologous to ScYFR019W (FAB1) - SH] (986526..993050)
            [6525 bp, 2174 aa]
          Length = 2174

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 152  NIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAI 200
            + +++ K F   +E  M  ++  + K K +RV+  + + +VYK+V+DA+
Sbjct: 1596 HFDALSKEFELQRE--MERLQMNKNKYKAMRVKSSKPIVEVYKNVKDAV 1642

>Scas_617.7
          Length = 420

 Score = 28.5 bits (62), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%)

Query: 42  FVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFL 101
           F H+  G L +AE  ++     + I+   KE  ++  EITL +  N   + +      F+
Sbjct: 238 FSHIELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFI 297

Query: 102 IDGF 105
            +GF
Sbjct: 298 EEGF 301

>CAGL0F02343g 226725..227762 similar to sp|P43591 Saccharomyces
          cerevisiae YFR007w, start by similarity
          Length = 345

 Score = 28.1 bits (61), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 15/19 (78%)

Query: 18 VIFVLGGPGAGKGTQCEKL 36
          ++F++G PG+GK T  EKL
Sbjct: 26 LVFIVGPPGSGKSTIAEKL 44

>KLLA0A01386g 125585..126721 weakly similar to sp|P40026
           Saccharomyces cerevisiae YER038c hypothetical protein
           singleton, hypothetical start
          Length = 378

 Score = 28.1 bits (61), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 7/49 (14%)

Query: 57  RAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKH--KFLID 103
           RA  +Y     NC   G+++P E    L+ +  SD+V+A KH  KF++D
Sbjct: 199 RANIEYT----NC-PYGKLIPVETMCGLIESNNSDSVQAFKHFIKFILD 242

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 28.1 bits (61), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 120 VESKFILFFDCPEDIMLERLLERGKTSGRSDDNIE-SIKKRFNTFKETSMPVIEYFET 176
            +SK+I   D PE++ LE  L      G S+ N     +   NT   T  PV + FE+
Sbjct: 5   TDSKYIEEVDIPENLQLEIDLSDPLLKGNSNSNTNVCTQSTLNTTTSTVSPVRKRFES 62

>AFL002C [3191] [Homologous to ScYAL001C (TFC3) - SH]
           (432329..435720,435784..435847) [3456 bp, 1151 aa]
          Length = 1151

 Score = 27.7 bits (60), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 79  EITLALLRNAISDNVKANKHKFL----IDG--FPRKM----DQAISFERDIVESKFILFF 128
           ++ L +  N +  NVK N  + L    +DG    R +    D  ++F +DI+++  I FF
Sbjct: 581 DVELLVAANKLKVNVKPNGRRVLYLPSMDGEQIERYLNSVRDTKVAFSKDIIKNTDIYFF 640

Query: 129 DCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVR 184
           D  E         RG  S       ++  KR +  K T+  V     TK + VR +
Sbjct: 641 DQTE----HNRFHRGTKSAERVKAFQNKSKRADK-KSTTGAVKNTINTKPRRVRTK 691

>Sklu_1579.2 YBR087W, Contig c1579 1374-2444
          Length = 356

 Score = 27.3 bits (59), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 60  SQYGELIKNCIKEGQIVPQEITLALLRNAISDNVK 94
           S   +L+ +CI   +++ QE+T  LL N I+D +K
Sbjct: 284 STLYDLLAHCIP-AKVILQELTFGLLNNKINDKLK 317

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,273,807
Number of extensions: 260865
Number of successful extensions: 972
Number of sequences better than 10.0: 56
Number of HSP's gapped: 947
Number of HSP's successfully gapped: 58
Length of query: 201
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 104
Effective length of database: 13,238,163
Effective search space: 1376768952
Effective search space used: 1376768952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)