Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL023W2772738811e-120
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL023W
         (273 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL023W (YKL023W) [3232] chr11 (393364..394197) Protein of unkno...   343   e-120

>YKL023W (YKL023W) [3232] chr11 (393364..394197) Protein of unknown
           function [834 bp, 277 aa]
          Length = 277

 Score =  343 bits (881), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 186/273 (68%)

Query: 1   MNKEELLGFLLDDSIDSQKRCVTDHEAYSNWLKNDNDERTAHEESSSQSTIAALNKKKQT 60
           MNKEELLGFLLDDSIDSQKRCVTDHEAYSNWLKNDNDERTAHEESSSQSTIAALNKKKQT
Sbjct: 1   MNKEELLGFLLDDSIDSQKRCVTDHEAYSNWLKNDNDERTAHEESSSQSTIAALNKKKQT 60

Query: 61  EAAQEDXXXXXXXXXXXXXXADPRNLXXXXXXXXXXXXXXPREENVNTEKHIVMLEVEDF 120
           EAAQED              ADPRNL              PREENVNTEKHIVMLEVEDF
Sbjct: 61  EAAQEDIEELLNGLEGIIGGADPRNLKSKSKRKTKKGGSKPREENVNTEKHIVMLEVEDF 120

Query: 121 SDMSTHEDVNGASPSPNLDRSXXXXXXXXXXXXLSYDELKDKLEVTTRKSRLECKDLKKK 180
           SDMSTHEDVNGASPSPNLDRS            LSYDELKDKLEVTTRKSRLECKDLKKK
Sbjct: 121 SDMSTHEDVNGASPSPNLDRSKKNEKRRKNAKELSYDELKDKLEVTTRKSRLECKDLKKK 180

Query: 181 VHGXXXXXXXXXXXXXXXKIENQTLIEINNKLLKNTNEDEINKSQXXXXXXXXXXXXXXX 240
           VHG               KIENQTLIEINNKLLKNTNEDEINKSQ               
Sbjct: 181 VHGLERRNLELEQRLEELKIENQTLIEINNKLLKNTNEDEINKSQRNKEKDRKRRERRTA 240

Query: 241 XXXXXXXXXXXXXXXXXNKTSQSFPSSTDMNGQ 273
                            NKTSQSFPSSTDMNGQ
Sbjct: 241 RRKDERKQEKKQEKKQDNKTSQSFPSSTDMNGQ 273

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.303    0.122    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,633,749
Number of extensions: 211848
Number of successful extensions: 497
Number of sequences better than 10.0: 4
Number of HSP's gapped: 496
Number of HSP's successfully gapped: 4
Length of query: 273
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 173
Effective length of database: 13,134,309
Effective search space: 2272235457
Effective search space used: 2272235457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 61 (28.1 bits)