Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YKL022C (CDC16)84082640710.0
Scas_685.1076079321360.0
Sklu_2380.677476319550.0
Kwal_14.87472277419440.0
KLLA0E07986g72177517720.0
ACR168W70777817580.0
CAGL0L09823g74359117420.0
Scas_705.559072251696e-12
YBR112C (SSN6)9662251662e-11
ADL344W9101961454e-09
KLLA0B09262g9412261455e-09
CAGL0D01364g11482171411e-08
Kwal_23.36708022171374e-08
AGL294W6562571268e-07
Scas_599.58092641195e-06
YBL084C (CDC27)7582341161e-05
Kwal_27.107406282471142e-05
YHR166C (CDC23)6262011052e-04
CAGL0C01903g7692481043e-04
Scas_680.356312241008e-04
KLLA0A05258g632272990.001
YHR117W (TOM71)63991970.002
KLLA0C15455g56696960.002
CAGL0I02288g639180960.003
AEL281C1390232900.016
Scas_666.23596138880.024
Kwal_56.24750619341860.043
Kwal_27.11737575208850.045
Sklu_1876.21090176860.047
KLLA0E20933g710249840.070
CAGL0K11209g590207800.19
ABR206W682243800.20
Sklu_2077.432368780.27
KLLA0F04191g88585770.51
KLLA0F24046g604317760.53
AFR453W56987760.64
CAGL0K05599g710128750.80
Kwal_56.2243332266731.2
Sklu_2239.3284101711.7
YDR244W (PEX5)61264721.8
KLLA0E09526g30882712.0
CAGL0J09570g54970712.4
Scas_698.2369840702.9
ACR173W285101693.2
KLLA0D10329g15446673.3
Scas_590.876279703.3
CAGL0M01914g67676693.8
YBR055C (PRP6)899195693.9
CAGL0D02882g66786694.6
KLLA0D01155g33566675.4
Kwal_23.5408141064686.1
CAGL0L12936g600107676.2
KLLA0B03520g1401107677.3
YPR189W (SKI3)143253677.4
CAGL0E01573g90452677.7
ADR106W79865677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YKL022C
         (826 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKL022C (CDC16) [3233] chr11 complement(394369..396891) Componen...  1572   0.0  
Scas_685.10                                                           827   0.0  
Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement      757   0.0  
Kwal_14.874                                                           753   0.0  
KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces c...   687   0.0  
ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH] complement...   681   0.0  
CAGL0L09823g 1050447..1052678 some similarities with sp|P09798 S...   675   0.0  
Scas_705.55                                                            70   6e-12
YBR112C (CYC8) [302] chr2 complement(462826..465726) General rep...    69   2e-11
ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH] complement(...    60   4e-09
KLLA0B09262g 814303..817128 some similarities with sp|P14922 Sac...    60   5e-09
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    59   1e-08
Kwal_23.3670                                                           57   4e-08
AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH] complement...    53   8e-07
Scas_599.5                                                             50   5e-06
YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of...    49   1e-05
Kwal_27.10740                                                          49   2e-05
YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component...    45   2e-04
CAGL0C01903g complement(199487..201796) similar to sp|P38042 Sac...    45   3e-04
Scas_680.35                                                            43   8e-04
KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces c...    43   0.001
YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import recept...    42   0.002
KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces...    42   0.002
CAGL0I02288g complement(203605..205524) similar to sp|P16522 Sac...    42   0.003
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    39   0.016
Scas_666.23                                                            39   0.024
Kwal_56.24750                                                          38   0.043
Kwal_27.11737                                                          37   0.045
Sklu_1876.2 YOL145C, Contig c1876 732-4004                             38   0.047
KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042 Saccha...    37   0.070
CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces...    35   0.19 
ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH] complement(...    35   0.20 
Sklu_2077.4 YOR007C, Contig c2077 4462-5433 reverse complement         35   0.27 
KLLA0F04191g 397611..400268 weakly similar to sp|P19735 Saccharo...    34   0.51 
KLLA0F24046g 2240454..2242268 similar to sp|P07213 Saccharomyces...    34   0.53 
AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH] complement(...    34   0.64 
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    33   0.80 
Kwal_56.22433                                                          33   1.2  
Sklu_2239.3 YJR088C, Contig c2239 5120-5974                            32   1.7  
YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein ...    32   1.8  
KLLA0E09526g complement(845298..846224) similar to sgd|S0003993 ...    32   2.0  
CAGL0J09570g complement(939447..941096) some similarities with s...    32   2.4  
Scas_698.23                                                            32   2.9  
ACR173W [1220] [Homologous to ScYJR088C - SH] complement(657718....    31   3.2  
KLLA0D10329g join(872320..872335,872448..872896) highly similar ...    30   3.3  
Scas_590.8                                                             32   3.3  
CAGL0M01914g 232780..234810 some similarities with sp|P14922 Sac...    31   3.8  
YBR055C (PRP6) [245] chr2 complement(344562..347261) U4/U6.U5 tr...    31   3.9  
CAGL0D02882g complement(300025..302028) similar to sp|Q07084 Sac...    31   4.6  
KLLA0D01155g complement(104847..105854) similar to sgd|S0005533 ...    30   5.4  
Kwal_23.5408                                                           31   6.1  
CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces...    30   6.2  
KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces c...    30   7.3  
YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein w...    30   7.4  
CAGL0E01573g complement(148847..151561) similar to sp|P42842 Sac...    30   7.7  
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    30   7.9  

>YKL022C (CDC16) [3233] chr11 complement(394369..396891) Component
           of anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2523 bp, 840 aa]
          Length = 840

 Score = 1572 bits (4071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/826 (93%), Positives = 775/826 (93%)

Query: 1   MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASP 60
           MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASP
Sbjct: 1   MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASP 60

Query: 61  FVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPS 120
           FVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPS
Sbjct: 61  FVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPS 120

Query: 121 AXXXXXXXXITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDN 180
           A        ITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDN
Sbjct: 121 ANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDN 180

Query: 181 DEDVHXXXXXXXXXXXXRESKLGHNGPXXXXXXXXXXXXXQLDVSELSAIERLRLWRFDA 240
           DEDVH            RESKLGHNGP             QLDVSELSAIERLRLWRFDA
Sbjct: 181 DEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDA 240

Query: 241 LMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRY 300
           LMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRY
Sbjct: 241 LMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRY 300

Query: 301 LLGLSFVKLQRFDDALDVIGEYNPFSEDPXXXXXXXXXXXXXXXXXXQPVTDGGIKMESS 360
           LLGLSFVKLQRFDDALDVIGEYNPFSEDP                  QPVTDGGIKMESS
Sbjct: 301 LLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESS 360

Query: 361 LCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFK 420
           LCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFK
Sbjct: 361 LCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFK 420

Query: 421 EFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFN 480
           EFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFN
Sbjct: 421 EFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFN 480

Query: 481 ECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATY 540
           ECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATY
Sbjct: 481 ECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATY 540

Query: 541 YMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHL 600
           YMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHL
Sbjct: 541 YMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHL 600

Query: 601 PKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKAL 660
           PKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKAL
Sbjct: 601 PKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKAL 660

Query: 661 EVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK 720
           EVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK
Sbjct: 661 EVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK 720

Query: 721 TKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDK 780
           TKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDK
Sbjct: 721 TKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDK 780

Query: 781 ASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGS 826
           ASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGS
Sbjct: 781 ASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGS 826

>Scas_685.10
          Length = 760

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/793 (52%), Positives = 570/793 (71%), Gaps = 73/793 (9%)

Query: 39  MRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPT-------DAQ-----NDRLQQP 86
           MRNP SP++  SQHNST+A SPFV N    RT+  LPT       +AQ     +++L Q 
Sbjct: 1   MRNPTSPNQTPSQHNSTIAISPFVGN----RTRSRLPTHRIHPATNAQRENPLSNQLNQS 56

Query: 87  WNRTNTATSPYQSLANSPLIQK-----LQANIMTPHQPSAXXXXXXXXITGNVVNDNNLL 141
           WNRT +  SPY+SLANSPL+QK     + A++ TPHQ +            N   +++LL
Sbjct: 57  WNRTVSGQSPYRSLANSPLVQKTNPSIITASLTTPHQKNTGTIPTNL----NANPNSSLL 112

Query: 142 ASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHXXXXXXXXXXXXRESK 201
           AS+SK ++FGSTI S+LRKVS+Q    +  +   +DE+   +++              S 
Sbjct: 113 ASLSKGNVFGSTISSSLRKVSIQPN-SNIPETNTKDENMSNEINKATTTTLTTNTTIVSP 171

Query: 202 LGHNGPXXXXXXXXXXXXXQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISN 261
                              ++D+SEL++IERLRLWR DALMQHMYRTAEYI +K+Y I+ 
Sbjct: 172 -------------------EIDLSELTSIERLRLWRHDALMQHMYRTAEYIGNKIYTITE 212

Query: 262 DPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGE 321
           DP+DAFWL QVYYNNN+++RA++L+T++NL+ +NI+CRYL+GL   KLQR+DDALDV+ E
Sbjct: 213 DPNDAFWLAQVYYNNNEFIRAIDLLTKDNLESLNIICRYLMGLCLFKLQRYDDALDVVDE 272

Query: 322 YNPFSE-----DPXXXXXXXXXXXXXXXXXXQPVTDGGIKMESSLCFLRGKIYFAQNNFN 376
            NPFS+     DP                      DGGIK+ESSLC+LRG I+ AQNN  
Sbjct: 273 LNPFSDSKQDSDPTI------------------APDGGIKVESSLCYLRGLIFAAQNNLK 314

Query: 377 KARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKIN 436
           KA+ AF+EA+LVD+KN+EAFE L+SKNL++P+EEWDL  SLDF   G+++E+++ LY +N
Sbjct: 315 KAKTAFKEAVLVDVKNYEAFESLISKNLISPEEEWDLLLSLDFSTLGDNEEMIRYLYTLN 374

Query: 437 LSKYINTEDITKS-NEILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEF 495
           +SKYI+ +D++K+  + L+ +Y L++N+D++R +++  Y+QCKF+ECLE CE  L+ DE+
Sbjct: 375 VSKYIH-QDVSKTAKQSLSDEYGLSNNIDILRYQIETLYSQCKFSECLEACEKALDGDEY 433

Query: 496 NTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYS 555
           N  ILP YI CLYE + KNKLFLLSH LAE FPKSAITWFSVATYYM+++ + +A+KY+S
Sbjct: 434 NPTILPTYISCLYEQNGKNKLFLLSHNLAEKFPKSAITWFSVATYYMAIEDVPKARKYFS 493

Query: 556 KSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSL 615
           K+SILDPSF+AAWLGFAHTY LEGE DQAL+AY+TA+RFFPG+H+P LFLGM++MA N+L
Sbjct: 494 KASILDPSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFPGIHVPNLFLGMEYMATNTL 553

Query: 616 NLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTIS 675
           +LAE YF LAYD C  DPL+LNEMGVMYFKKNE  K+K+YLKKALE V++   +S   IS
Sbjct: 554 SLAEEYFTLAYDTCRYDPLLLNEMGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVIS 613

Query: 676 IQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSL 735
           IQ+NL HTYRKL E E AIKCF+ VLE+  K++E++C+LG+LYLKTK+L KAID+LH+SL
Sbjct: 614 IQMNLAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKTKRLGKAIDYLHESL 673

Query: 736 YLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSL-TYDP 794
            LKP+N+SA  LL +ALELN ++ LD +HPL+  + L S  ++DK  + KKR ++ + + 
Sbjct: 674 ALKPSNTSAQELLLHALELNASIVLDENHPLVMNAELYSN-NEDKL-IQKKRGNISSTEA 731

Query: 795 VNMAKRLRTQKEI 807
            +M+K+++   ++
Sbjct: 732 ASMSKKMKMNGDM 744

>Sklu_2380.6 YKL022C, Contig c2380 14352-16676 reverse complement
          Length = 774

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/763 (49%), Positives = 517/763 (67%), Gaps = 65/763 (8%)

Query: 43  MSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLAN 102
           MS     SQHNSTLA SP V+  ++   Q++  +  Q+ +L++    T+TA +P+  + N
Sbjct: 54  MSTGNTPSQHNSTLAISPLVTKRTSLHGQKN--SQQQHQQLRRWCGATSTAQTPHHPVTN 111

Query: 103 SPLIQKLQ--ANIMTPHQPSAXXXXXXXXITGNVVNDNNLLASMSKNSMFGSTIPSTLRK 160
           SPLIQK+Q   ++ TP  P+                   LLASMSK+ +FG  +PSTLRK
Sbjct: 112 SPLIQKIQNPTSLATPAPPAGDGSTA------------GLLASMSKSGLFGPAVPSTLRK 159

Query: 161 VSLQREYKDSVDGVVRDEDNDEDVHXXXXXXXXXXXXRESKLGHNGPXXXXXXXXXXXXX 220
           +S+ R    S DG    +D+                   S+L  N               
Sbjct: 160 ISVTR----SFDGQTSAKDDSN-----------------SELDDN--------LEVISGA 190

Query: 221 QLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYV 280
            +D+S LS  E+LRLWR DALMQH YRTAEYI DKVY+I+ DP+DAFWL QVYYNN  Y+
Sbjct: 191 TIDISTLSPAEKLRLWRHDALMQHHYRTAEYIGDKVYSITRDPNDAFWLAQVYYNNGSYI 250

Query: 281 RAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPXXXXXXXXXXX 340
           RAVEL++R+ LD  +++CRYL  L  +K++++DDALD++GE NPF +             
Sbjct: 251 RAVELLSRDGLDTSSVMCRYLTALCLIKMEKYDDALDIVGESNPFKD------------- 297

Query: 341 XXXXXXXQPV--TDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEM 398
                  Q V   DGGIK+ESSLC+LRGKIY AQNNF KA+ +F+EA+ VD+KNFEAF+ 
Sbjct: 298 ----VSAQHVKNQDGGIKLESSLCYLRGKIYSAQNNFEKAKQSFKEAVQVDVKNFEAFDE 353

Query: 399 LLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYK 458
           L+S NLLTP +EW+   +LDF +  +++E++K+LY   LSKY+N + I+++ E L  +Y 
Sbjct: 354 LISNNLLTPNQEWEFLSTLDFSDLDDNEELIKSLYTTKLSKYLNLDQISEAREYLINEYN 413

Query: 459 LADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFL 518
           L DN D++RS++D  +TQCKF++CL LCE VLE DEFN  +LP YI CLYEL  KNKLFL
Sbjct: 414 LEDNTDLIRSEIDTFFTQCKFSKCLCLCEQVLERDEFNFYVLPTYIACLYELGGKNKLFL 473

Query: 519 LSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALE 578
           +SH+LAE FPKS +TW  V TYY+S+++++EA+KY+SK+SILDP+F  AW+GFAHTYA E
Sbjct: 474 VSHKLAENFPKSPVTWLGVGTYYLSINKVAEARKYFSKASILDPNFGQAWIGFAHTYAAE 533

Query: 579 GEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNE 638
           GE +QA++AYSTASRFFPG HLP LFLGMQ++ MN+L+LAE Y  LAYDICP+DPL+LNE
Sbjct: 534 GEHEQAVSAYSTASRFFPGTHLPNLFLGMQYIVMNTLSLAEEYLTLAYDICPHDPLLLNE 593

Query: 639 MGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFR 698
           MGV+YFKK+++ KAKKY KKA E  K L+  S+  +SI  NLGHTYRK+ + E A+ CF+
Sbjct: 594 MGVIYFKKSDYPKAKKYFKKAWEASKRLNSDSKAWLSIHTNLGHTYRKMGDYERAVACFK 653

Query: 699 CVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTL 758
            VLE +++++ ++C++G +YLK +K++KAID LH +L L+P+N  A  LLK ALE+N+  
Sbjct: 654 IVLETSNQDTSVYCAIGLIYLKLRKIEKAIDSLHNALALQPSNQIAQDLLKQALEVNMCT 713

Query: 759 SLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRL 801
            LD +HPL+  S +   AS    + +KKR  +      +AKRL
Sbjct: 714 VLDETHPLVVSSKINESASNYFPN-SKKRDLVNQSAAKIAKRL 755

>Kwal_14.874
          Length = 722

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/774 (48%), Positives = 516/774 (66%), Gaps = 75/774 (9%)

Query: 43  MSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLAN 102
           MS     SQHNSTLA SP V + +    Q    T+A + R     +RT  A +P+ S+  
Sbjct: 1   MSRGNTPSQHNSTLAISPLVGSRTLQGPQHRNQTNASSTRQWSGEHRT--AQTPHHSVTY 58

Query: 103 SPLIQKLQ--ANIMTP-----HQPSAXXXXXXXXITGNVVNDNNLLASMSKNSMFGSTIP 155
           SPL+QK+Q  A++ TP     H  +A                  LLASM+KN +FG  IP
Sbjct: 59  SPLVQKIQNNASLATPAPVQDHGSTA-----------------GLLASMTKNGLFGPQIP 101

Query: 156 STLRKVSL---QREYKDSVDGVVRDEDNDEDVHXXXXXXXXXXXXRESKLGHNGPXXXXX 212
           STLRKVS+    R +  S  G                             G +       
Sbjct: 102 STLRKVSIVGDSRRHPGSSSGA----------------------------GGDITDPNAQ 133

Query: 213 XXXXXXXXQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQV 272
                    +D+++L A E+LRLWR D+LMQH YRTAE++ DKVY ++ DP+DAFWL QV
Sbjct: 134 LDSDHVISAIDIAQLPAAEKLRLWRHDSLMQHQYRTAEFLGDKVYAMTGDPNDAFWLAQV 193

Query: 273 YYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPXXX 332
           YYN+  Y+RAVEL++RNNLD  +++CRYL  L  ++L++++DALD++GE NPF  DP   
Sbjct: 194 YYNSGSYIRAVELLSRNNLDTSSVMCRYLTALCLIQLKKYEDALDIVGETNPF-RDPLGS 252

Query: 333 XXXXXXXXXXXXXXXQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKN 392
                              DGGIK+ESS+C+LRGKI+ A N+F+KA+D+ +EA+LVD+KN
Sbjct: 253 HVKNQ--------------DGGIKLESSMCYLRGKIFSALNDFDKAKDSLKEAVLVDVKN 298

Query: 393 FEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEI 452
           FEAF+ L+SKNLLTP EEW    SLDF +  ++++++++LY   LSKY+N + + K+++ 
Sbjct: 299 FEAFDELISKNLLTPSEEWAFIASLDFTDLDDNEDLIRSLYVSRLSKYLNLDQVFKAHDF 358

Query: 453 LAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSN 512
           L ++YKL+ N D++ SK D  +TQCKF++CL+LCE  LE DEFN +ILP +I CLYEL  
Sbjct: 359 LNEEYKLSSNTDLIHSKADTLFTQCKFSDCLKLCEEALEKDEFNFSILPIFISCLYELGG 418

Query: 513 KNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFA 572
           KNKLFL+SH++AE FPK  ITWF V  YYM  ++++EA+KY+SK+SILDPSF+ AW+GFA
Sbjct: 419 KNKLFLISHKMAENFPKHPITWFGVGAYYMCSNKVAEARKYFSKASILDPSFSQAWIGFA 478

Query: 573 HTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPND 632
           HTYA+EGE +QA++AYSTASRFFPG HLP LFLGMQ++ M +L LAE YFVLAYD+CP D
Sbjct: 479 HTYAVEGEHEQAISAYSTASRFFPGTHLPNLFLGMQYLIMGTLPLAEEYFVLAYDVCPYD 538

Query: 633 PLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEI 692
           PL+LNEMGV+YFKK ++ KAKKYLKKA E +K LD  S++ +SI  NL HTYRKL ENE 
Sbjct: 539 PLLLNEMGVLYFKKGDYSKAKKYLKKAWEAIKALDSESKSWVSIHTNLAHTYRKLGENEK 598

Query: 693 AIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNAL 752
           A+ CF+ VLE   K+++  C+LGY+YL+  +++KAID LH +L L+P+N +A  LLK AL
Sbjct: 599 AVTCFKLVLETAGKDTDTLCALGYVYLRMNRIEKAIDALHGALALRPSNQAAQDLLKQAL 658

Query: 753 ELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKE 806
           ++N++  LD SHPL+  S L  Q S     +++KR++   D  ++AKRL+  +E
Sbjct: 659 DVNMSTILDDSHPLVISSKLQDQNSD---VVSRKRAANRVDVRDIAKRLKHGQE 709

>KLLA0E07986g 720700..722865 similar to sp|P09798 Saccharomyces
           cerevisiae YKL022c CDC16 subunit of anaphase-promoting
           complex (cyclosome) singleton, start by similarity
          Length = 721

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/775 (45%), Positives = 496/775 (64%), Gaps = 84/775 (10%)

Query: 43  MSPSEQHSQH-NSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRT---------NT 92
           MS S     H  STLA SP V    A R   +     +ND +     R            
Sbjct: 1   MSSSHDTPSHVQSTLAISPLVQRTGANRGSMN-----RNDPIGNSQGRNVEGGRSNIPQI 55

Query: 93  ATSPYQSLANSPLIQKLQ--ANIMTPHQPSAXXXXXXXXITGNVVNDNNLLASMSKNSMF 150
           A +P+Q    SPL+QK++  +++ TP             +  N    ++LLASM+KN +F
Sbjct: 56  AQTPHQD--RSPLVQKIRDVSHLATP-----------AVMRHNGTAGSSLLASMTKNGLF 102

Query: 151 GSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHXXXXXXXXXXXXRESKLGHNGPXXX 210
           G  +PSTLRK S      D+V+  + +  NDED+                          
Sbjct: 103 GPALPSTLRKTSTS---TDTVE--LNNSTNDEDIDHASDNV------------------- 138

Query: 211 XXXXXXXXXXQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLG 270
                       DVS+LS++E+LRLWR DALMQH Y+TAE+I D +Y+++ DP+DAFWL 
Sbjct: 139 -----------FDVSDLSSVEKLRLWRHDALMQHHYKTAEHIGDLIYSMTKDPNDAFWLA 187

Query: 271 QVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPX 330
           QVYYN   YVRAVELI  + LD  +I+CRYL  L   KL + ++ALD+IG+ NPF  +P 
Sbjct: 188 QVYYNQGSYVRAVELIFTDQLDSESIMCRYLAALCLFKLNKLEEALDIIGDTNPFQSEPS 247

Query: 331 XXXXXXXXXXXXXXXXXQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDI 390
                                DGG+K+ESS+C LRG+IY + +N  +A++ F+EA+ VD+
Sbjct: 248 SPGN----------------ADGGVKLESSMCLLRGRIYVSLSNMEQAKECFKEAVQVDV 291

Query: 391 KNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSN 450
           KN+EAF+ LLSK++LT  E+WDL  SL F +  +++E+M+ LY   LSKY +  +I  + 
Sbjct: 292 KNYEAFDYLLSKHMLTTAEQWDLVRSLQFDDLDDNEEMMRCLYISRLSKYQHQTEIEHAR 351

Query: 451 EILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYEL 510
           ++L+  Y L DN  V+ +++++   Q KF +C++LCE VLE DE+N  +LP YI CL+  
Sbjct: 352 KVLSDKYYLKDNRTVLLAEIELLNNQSKFTQCMKLCEQVLEVDEYNLEVLPIYIQCLHSF 411

Query: 511 SNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLG 570
           + KNKLFLLSH+LAE FPKS +TWF+VATYY+ + ++SEA+KY+S+SSI+DPSF  +WLG
Sbjct: 412 AAKNKLFLLSHKLAENFPKSPVTWFAVATYYLCMGKVSEARKYFSRSSIMDPSFGYSWLG 471

Query: 571 FAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICP 630
           FAHTY  EGE +QAL+AYSTA+RFFPG HLP L+LGMQ+  M+ L+LAE YF++AYD+CP
Sbjct: 472 FAHTYVAEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYNRMDDLSLAEEYFMMAYDMCP 531

Query: 631 NDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNEN 690
            DPL+LNE+GV+YFK+  ++KAKKY+K+A + +K++   S+  ISI +NLGHTYRKL E+
Sbjct: 532 TDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAWISIVINLGHTYRKLGED 591

Query: 691 EIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKN 750
           E AIKCF+ VLE +   + + CSLG+LYL+ KK++KAID  HK+L L   N ++  LLK 
Sbjct: 592 ERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAIDSFHKALALDQGNQASNKLLKT 651

Query: 751 ALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSL---TYDPVNMAKRLR 802
           ALE+N  + +D +HP++  SN+ +  +   +  +KKR+SL   ++DPV  AKRL+
Sbjct: 652 ALEINAHMIIDENHPMVISSNIQNIPTSHVSKNDKKRTSLGITSFDPVTEAKRLK 706

>ACR168W [1215] [Homologous to ScYKL022C (CDC16) - SH]
           complement(650615..652738) [2124 bp, 707 aa]
          Length = 707

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/778 (45%), Positives = 492/778 (63%), Gaps = 84/778 (10%)

Query: 43  MSPSEQHSQHNSTLAASPFVSNVSAARTQQS---LPTDAQNDRLQQPWNRTNTAT-SPYQ 98
           MS     SQH STLA SPFV+N   ++ +Q    +P+  ++     P    ++ T +P  
Sbjct: 1   MSTGNTPSQHESTLAISPFVTNRGRSQQEQRRVMMPSTGEDSL--GPSGMADSGTHTPRN 58

Query: 99  SLANSPLIQKLQANIMTPHQPSAXXXXXXXXITGNVVNDNNLLASMSKNSMFGSTIPSTL 158
           S+ +SPL+QK Q  + TP+             TG       LL SMSK ++         
Sbjct: 59  SVVHSPLVQKTQ--LGTPYMAEGAA-------TGG------LLGSMSKTAL--------- 94

Query: 159 RKVSLQREYKDSVDGVVRDEDNDEDVHXXXXXXXXXXXXRESKLGHNGPXXXXXXXXXXX 218
                   +  +V   +R   N                 RE +                 
Sbjct: 95  --------FGPAVPSTLRKVSN----------------VREYR------RPGDSDGEGGE 124

Query: 219 XXQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQ 278
              +D++ELSA E+LRLWR DALMQH YRTAEYI DKVY+++ DP+DAFWL QVYYN  Q
Sbjct: 125 GYGVDLAELSAAEKLRLWRHDALMQHHYRTAEYIGDKVYSMTRDPNDAFWLAQVYYNMGQ 184

Query: 279 YVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPXXXXXXXXX 338
           Y+RAVEL++R+ LD  +++CRYL  L  VK++++DDALD++GE NPF +D          
Sbjct: 185 YIRAVELLSRDGLDASSVMCRYLTALCLVKMEKYDDALDIVGEVNPFKDDSAEHVRNL-- 242

Query: 339 XXXXXXXXXQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEM 398
                        DGGIK+ESSLC+LRG+IY AQNN + A++ F+EA+ VD+KNFEAF+ 
Sbjct: 243 -------------DGGIKLESSLCYLRGEIYSAQNNLDLAKECFKEAVCVDVKNFEAFDR 289

Query: 399 LLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYK 458
           L+S N+LTP EE +    LDF +  +++E+++ LY   LSKY +   +  ++  L  +Y 
Sbjct: 290 LISNNMLTPDEETEFIARLDFTDLDDNQELIRCLYSTKLSKYGDLTKLKAAHRFLLDEYH 349

Query: 459 LADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFL 518
           L DN DV  +++++   Q K+ ECLELCE VLE DEFN ++LP Y+ CLYEL  KNKLFL
Sbjct: 350 LEDNKDVQTTEIELLIFQGKYLECLELCEKVLEQDEFNFDVLPTYVQCLYELGGKNKLFL 409

Query: 519 LSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALE 578
           +SH+LAE+FPKS++TWF+V TYY S++ I+EA+KY+SK+S+LDP+F  AWLGFAHTYA+E
Sbjct: 410 VSHKLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVE 469

Query: 579 GEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNE 638
           GE +QAL+AYSTA+RFFPG HLP L+LGMQ+  M++L LAE YF++AYDICP DPL+LNE
Sbjct: 470 GEHEQALSAYSTAARFFPGTHLPHLYLGMQYSRMDTLTLAEEYFMMAYDICPTDPLLLNE 529

Query: 639 MGVMYFKKNEFVKAKKYLKKALEVVK-DLDPSSRTTISIQLNLGHTYRKLNENEIAIKCF 697
           +GV+YFKK ++ +AKK+ K+A E +      +S   IS  LNLGHTYRKL+E+E A+ CF
Sbjct: 530 LGVVYFKKMDYPRAKKFFKRACEAINMQQSDASSVAISTYLNLGHTYRKLDEDERALHCF 589

Query: 698 RCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVT 757
           + VLE+   ++ + C+L  +YLK KKLQKAID LH  L ++PN+ +   LLK AL++NV 
Sbjct: 590 KTVLERWKPSANVWCALATVYLKMKKLQKAIDALHSVLAMEPNHQTGQQLLKIALDVNVH 649

Query: 758 LSLDASHPLIDKSNL---MSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNN 812
           L LD  HPL+  + +   M  +S D     KKRS    DPV +AKRL+      D+ +
Sbjct: 650 LPLDNGHPLMVSAKISENMKMSSND-----KKRSLGNIDPVVIAKRLKQGSTSSDEGD 702

>CAGL0L09823g 1050447..1052678 some similarities with sp|P09798
           Saccharomyces cerevisiae YKL022c CDC16, hypothetical
           start
          Length = 743

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/591 (53%), Positives = 438/591 (74%), Gaps = 17/591 (2%)

Query: 221 QLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYV 280
           ++D++++  IERL+LWR DA +QH+Y TAE++A K+Y ++ D +DAFWL  +YY+   + 
Sbjct: 159 EIDIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHN 218

Query: 281 RAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPXXXXXXXXXXX 340
           R +EL+T++++  V+I+CRYLL   ++ ++ +DDALD++GE NPF++             
Sbjct: 219 RCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIE---- 274

Query: 341 XXXXXXXQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLL 400
                     +DGGIK+ESS+CFLRGKIY AQN+F++A++AF+EA+LVD KNFEA+  L+
Sbjct: 275 ----------SDGGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLV 324

Query: 401 SKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLA 460
             +LLT  EEW+L DSLDF   G+D  ++K+LY + LSK  N + IT++ +IL +DY LA
Sbjct: 325 DSHLLTTNEEWELLDSLDFDSLGDDSILVKSLYTLELSKNQNQDRITEAQDILRQDYDLA 384

Query: 461 DNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLS 520
           D++D+V S +DI + QCKF++CL +CE +L+ D+FN  ILP YI CLYE+ + NKLFLL+
Sbjct: 385 DDIDIVTSDIDILFNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLA 444

Query: 521 HRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGE 580
           H LAE  P++ ITW+ VATYYM LDRI EA+KY+SKSSI+DP+FA AWLGFAHT+ALEGE
Sbjct: 445 HELAEKDPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGE 504

Query: 581 QDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMG 640
           QDQA++AYSTA+RFFPGM LP LFLGMQ+MA N+L LAE YF LAY+  P DP++LNE+G
Sbjct: 505 QDQAISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIG 564

Query: 641 VMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCV 700
           V+ FKK E  KAK+YLKKA E  KD++ SS+T +S+Q+NL HTYR+L ENE AIK    +
Sbjct: 565 VLKFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNI 624

Query: 701 LEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSL 760
           LE  + +SEI+CSLG+LYLKT +LQKAID LH+ L + P NSSA  LL  ALELNVTL L
Sbjct: 625 LEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTLEL 684

Query: 761 DASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQN 811
           D +HPL+  SN++ +     + + K+R    ++ +N+ K+     ++ +Q+
Sbjct: 685 DENHPLVVNSNILDE-EHSASKIGKRRQP--FESINVDKKRNKAGQLTEQS 732

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 48/81 (59%), Gaps = 11/81 (13%)

Query: 90  TNTATSPYQSLANSPLIQKLQ-ANIMTPHQPSAXXXXXXXXITGNVVNDNNLLASMSKNS 148
              A SP   L  SPL+QK   A++ TP +              N  N+ +LLASMSKNS
Sbjct: 20  VGAARSP---LLTSPLVQKYAGASLATPRK-------HLGASNSNNGNNGSLLASMSKNS 69

Query: 149 MFGSTIPSTLRKVSLQREYKD 169
           M GSTIPSTLRKVSLQRE+ D
Sbjct: 70  MLGSTIPSTLRKVSLQREFHD 90

>Scas_705.55
          Length = 907

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 102/225 (45%), Gaps = 13/225 (5%)

Query: 528 PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTA 587
           P+S     S+A  Y S D    A + Y ++  ++P  +  W    H Y +  +  +A  +
Sbjct: 87  PQSTKALTSLAHLYRSRDMFQRAAELYERALSINPELSDVWATLGHCYLMLDDLQRAYNS 146

Query: 588 YSTASRFFPGMHLPKLF--LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFK 645
           Y  A       ++PKL+  +G+ +    SL+ AE  F    ++ P       +   +YF+
Sbjct: 147 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ----FEKANEIYFR 202

Query: 646 KNEFVKAKKYLKKALEVVK---DLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLE 702
                K +    +ALE  +   +  P+      I   LG     +NE + A + +  VL 
Sbjct: 203 LGIIYKHQGKWTQALECFRYILNQPPAPLQEWDIWFQLGSVLESMNEWQGAREAYEHVLL 262

Query: 703 KNDKNSEIHCSLGYLY----LKTKKLQKAIDHLHKSLYLKPNNSS 743
           +N+ ++++   LG LY    +     QKA+++L KSL + PN+S+
Sbjct: 263 QNENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEVDPNDST 307

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 101/252 (40%), Gaps = 40/252 (15%)

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
           +Y   LY LSN N             PK    W  +   Y     +  A++ ++K   LD
Sbjct: 146 SYQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELD 190

Query: 562 PSFAAA---WLGFAHTYALEGEQDQALTAYSTASRFF---PGMHLPK----LFLGMQFMA 611
           P F  A   +      Y  +G+  QAL  +    R+    P   L +      LG    +
Sbjct: 191 PQFEKANEIYFRLGIIYKHQGKWTQALECF----RYILNQPPAPLQEWDIWFQLGSVLES 246

Query: 612 MNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKN----EFVKAKKYLKKALEVVKDLD 667
           MN    A   +        N   VL ++G +Y   N    +  KA  YL K+LEV    D
Sbjct: 247 MNEWQGAREAYEHVLLQNENHAKVLQQLGCLYGMNNVSFYDPQKALNYLLKSLEV----D 302

Query: 668 PSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKA 727
           P+  TT     +LG  +   N+   A   F+  + ++ +N    CS+G LY +  + + A
Sbjct: 303 PNDSTTW---YHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 359

Query: 728 IDHLHKSLYLKP 739
           +D   +++ L P
Sbjct: 360 LDAYTRAIRLNP 371

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%)

Query: 666 LDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQ 725
           LDP ++ T    L++      + + + A   +   L+ N ++++   SL +LY      Q
Sbjct: 48  LDPVAQATAETWLSIASLAETVGDADRAAMAYDATLQFNPQSTKALTSLAHLYRSRDMFQ 107

Query: 726 KAIDHLHKSLYLKPNNSSATALL 748
           +A +   ++L + P  S   A L
Sbjct: 108 RAAELYERALSINPELSDVWATL 130

>YBR112C (CYC8) [302] chr2 complement(462826..465726) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by sequence-specific
           DNA-binding proteins, Sko1p-Ssn6p-Tup1p complex
           undergoes Hog1p-dependent conversion to a
           transcriptional activator [2901 bp, 966 aa]
          Length = 966

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 102/225 (45%), Gaps = 13/225 (5%)

Query: 528 PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTA 587
           P SA    S+A  Y S D    A + Y ++ +++P  +  W    H Y +  +  +A  A
Sbjct: 77  PSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNA 136

Query: 588 YSTASRFFPGMHLPKLF--LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFK 645
           Y  A       ++PKL+  +G+ +    SL+ AE  F    ++ P+      +   +YF+
Sbjct: 137 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKANEIYFR 192

Query: 646 KNEFVKAKKYLKKALEVVKDLDPSSRTTIS---IQLNLGHTYRKLNENEIAIKCFRCVLE 702
                K +    +ALE  + + P     +    I   LG     + E + A + +  VL 
Sbjct: 193 LGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYEHVLA 252

Query: 703 KNDKNSEIHCSLGYLY----LKTKKLQKAIDHLHKSLYLKPNNSS 743
           +N  ++++   LG LY    ++    QKA+D+L KSL   P++++
Sbjct: 253 QNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDAT 297

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 101/253 (39%), Gaps = 42/253 (16%)

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
           AY   LY LSN N             PK    W  +   Y     +  A++ ++K   LD
Sbjct: 136 AYQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELD 180

Query: 562 PSFAAA---WLGFAHTYALEGEQDQALTAYSTASRFFPGMHLP------KLFLGMQFMAM 612
           P F  A   +      Y  +G+  QAL  +       P    P         LG    +M
Sbjct: 181 PHFEKANEIYFRLGIIYKHQGKWSQALECFR---YILPQPPAPLQEWDIWFQLGSVLESM 237

Query: 613 NSLNLA-ESY-FVLAYDICPNDPLVLNEMGVMYFKKN----EFVKAKKYLKKALEVVKDL 666
                A E+Y  VLA +   +   VL ++G +Y   N    +  KA  YL K+LE     
Sbjct: 238 GEWQGAKEAYEHVLAQNQ--HHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEA---- 291

Query: 667 DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQK 726
           DPS  TT     +LG  +    +   A   F+  + ++ +N    CS+G LY +  + + 
Sbjct: 292 DPSDATTW---YHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRD 348

Query: 727 AIDHLHKSLYLKP 739
           A+D   +++ L P
Sbjct: 349 ALDAYTRAIRLNP 361

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 71/183 (38%), Gaps = 43/183 (23%)

Query: 560 LDP---SFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPG--------MHL-------- 600
           LDP   S A  WL  A      G+ D+A  AY    +F P          HL        
Sbjct: 38  LDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQ 97

Query: 601 -------------PKL-----FLGMQFMAMNSLNLAESYFVLA-YDIC-PNDPLVLNEMG 640
                        P+L      LG  ++ ++ L  A + +  A Y +  PN P + + +G
Sbjct: 98  RAAELYERALLVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIG 157

Query: 641 VMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCV 700
           ++Y +      A++   K LE    LDP       I   LG  Y+   +   A++CFR +
Sbjct: 158 ILYDRYGSLDYAEEAFAKVLE----LDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYI 213

Query: 701 LEK 703
           L +
Sbjct: 214 LPQ 216

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 666 LDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQ 725
           LDP +++T    L++      L + + A   +   L+ N  +++   SL +LY      Q
Sbjct: 38  LDPLTQSTAETWLSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQ 97

Query: 726 KAIDHLHKSLYLKPNNSSATALL 748
           +A +   ++L + P  S   A L
Sbjct: 98  RAAELYERALLVNPELSDVWATL 120

>ADL344W [1396] [Homologous to ScYBR112C (CYC8) - SH]
           complement(103567..106299) [2733 bp, 910 aa]
          Length = 910

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 85/196 (43%), Gaps = 9/196 (4%)

Query: 528 PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTA 587
           P S     S+A  Y S D    A + Y ++  ++P     W    H Y +  +  +A  A
Sbjct: 93  PSSTKALTSLAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAA 152

Query: 588 YSTASRFFPGMHLPKLF--LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFK 645
           Y  A       ++PKL+  +G+ +    SL+ AE  F    ++ P+      ++  +YF+
Sbjct: 153 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKVNEIYFR 208

Query: 646 KNEFVKAKKYLKKALEVVKDLDPSSRTTIS---IQLNLGHTYRKLNENEIAIKCFRCVLE 702
                K +    +ALE  + + P     +    +   LG     + E + A + +  VL 
Sbjct: 209 LGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGAREAYEHVLS 268

Query: 703 KNDKNSEIHCSLGYLY 718
           +ND+++++   LG LY
Sbjct: 269 QNDRHAKVLQQLGCLY 284

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 95/253 (37%), Gaps = 42/253 (16%)

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
           AY   LY LSN N             PK    W  +   Y     +  A++ ++K   LD
Sbjct: 152 AYQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELD 196

Query: 562 PSFAAA---WLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPK-----------LFLGM 607
           P F      +      Y  +G+ +QAL  +    R+     LP+             LG 
Sbjct: 197 PHFEKVNEIYFRLGIIYKHQGKWNQALECF----RYI----LPQPPAPLQEWDVWFQLGS 248

Query: 608 QFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKN-EFVKAKKYLKKALEVVKDL 666
              +M     A   +            VL ++G +Y   N +F   +  L   L+ ++  
Sbjct: 249 VLESMGEWQGAREAYEHVLSQNDRHAKVLQQLGCLYGMNNVQFYDPQTALNLLLKSLE-- 306

Query: 667 DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQK 726
             +  T  +   +LG  +   N+   A   F+  + ++ +N    CS+G LY +  + + 
Sbjct: 307 --ADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRD 364

Query: 727 AIDHLHKSLYLKP 739
           A+D   +++ L P
Sbjct: 365 ALDAYTRAIRLNP 377

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 69/180 (38%), Gaps = 40/180 (22%)

Query: 560 LDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPG--------MHL----------- 600
           L  S A  WL  A      G+ D+A  AY    ++ P          HL           
Sbjct: 57  LSQSAAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDVFQRAA 116

Query: 601 ----------PKL-----FLGMQFMAMNSLNLAESYFVLA-YDIC-PNDPLVLNEMGVMY 643
                     P+L      LG  ++ ++ L  A + +  A Y +  PN P + + +G++Y
Sbjct: 117 ELYQRALAVNPELGDVWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIGILY 176

Query: 644 FKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEK 703
            +      A++   K LE    LDP       I   LG  Y+   +   A++CFR +L +
Sbjct: 177 DRYGSLDYAEEAFAKVLE----LDPHFEKVNEIYFRLGIIYKHQGKWNQALECFRYILPQ 232

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 667 DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQK 726
           +PSS   ++   +L H YR  +  + A + ++  L  N +  ++  +LG+ YL    LQ+
Sbjct: 92  NPSSTKALT---SLAHLYRSRDVFQRAAELYQRALAVNPELGDVWATLGHCYLMLDDLQR 148

Query: 727 AIDHLHKSLY 736
           A     ++LY
Sbjct: 149 AYAAYQQALY 158

>KLLA0B09262g 814303..817128 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8 general repressor
           of transcription singleton, hypothetical start
          Length = 941

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 95/226 (42%), Gaps = 13/226 (5%)

Query: 528 PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTA 587
           P S     S+A  Y S D    A + Y ++   +P     W    H Y +  E   A  A
Sbjct: 139 PSSTNALTSLAHLYRSRDMFQRAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAA 198

Query: 588 YSTASRFFPGMHLPKLF--LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFK 645
           Y  A       ++PKL+  +G+ +    SL+ AE  F    ++ P       +   +YF+
Sbjct: 199 YQQALYHLSNPNIPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ----FEKANEIYFR 254

Query: 646 KNEFVKAKKYLKKALEVVKDLDPSSRTTIS---IQLNLGHTYRKLNENEIAIKCFRCVLE 702
                K +    +ALE  + + P     +    +   LG     + E + A   +  ++ 
Sbjct: 255 LGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWFQLGSVLESMGEWQGARDAYEHIIS 314

Query: 703 KNDKNSEIHCSLGYLY----LKTKKLQKAIDHLHKSLYLKPNNSSA 744
           +ND+++++   LG LY    +     QKA++ L KSL +   ++++
Sbjct: 315 QNDRHAKVLQQLGCLYGMNNVSFYDPQKALNLLLKSLEIDSTDATS 360

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 98/254 (38%), Gaps = 36/254 (14%)

Query: 498 NILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKS 557
           N   AY   LY LSN N             PK    W  +   Y     +  A++ ++K 
Sbjct: 194 NAYAAYQQALYHLSNPN------------IPK---LWHGIGILYDRYGSLDYAEEAFAKV 238

Query: 558 SILDPSFAAA---WLGFAHTYALEGEQDQALTA--YSTASRFFPGMHLPKLF-LGMQFMA 611
             LDP F  A   +      Y  +G+ +QAL    Y       P       F LG    +
Sbjct: 239 LELDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYILPQPPAPLQEWDVWFQLGSVLES 298

Query: 612 MNSLNLAESYFVLAYDICPND--PLVLNEMGVMYFKKN----EFVKAKKYLKKALEVVKD 665
           M     A   +   + I  ND    VL ++G +Y   N    +  KA   L K+LE+   
Sbjct: 299 MGEWQGARDAY--EHIISQNDRHAKVLQQLGCLYGMNNVSFYDPQKALNLLLKSLEI--- 353

Query: 666 LDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQ 725
                 T  +   +LG  +   N+   A   F+  + ++ +N    CS+G LY +  + +
Sbjct: 354 ----DSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYR 409

Query: 726 KAIDHLHKSLYLKP 739
            A+D   +++ L P
Sbjct: 410 DALDAYTRAIRLNP 423

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%)

Query: 663 VKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTK 722
           +K LDP S++T    L++      L + ++A   +   L+ N  ++    SL +LY    
Sbjct: 97  LKPLDPLSQSTAETWLSIASLAETLGDADLAAMAYDATLQHNPSSTNALTSLAHLYRSRD 156

Query: 723 KLQKAIDHLHKSLYLKP 739
             Q+A +   ++L   P
Sbjct: 157 MFQRAAELYQRALSANP 173

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 68/183 (37%), Gaps = 43/183 (23%)

Query: 560 LDP---SFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPG--------MHL-------- 600
           LDP   S A  WL  A      G+ D A  AY    +  P          HL        
Sbjct: 100 LDPLSQSTAETWLSIASLAETLGDADLAAMAYDATLQHNPSSTNALTSLAHLYRSRDMFQ 159

Query: 601 -------------PKL-----FLGMQFMAMNSL-NLAESYFVLAYDIC-PNDPLVLNEMG 640
                        P+L      LG  ++ ++ L N   +Y    Y +  PN P + + +G
Sbjct: 160 RAAELYQRALSANPELGDIWATLGHCYLMLDELQNAYAAYQQALYHLSNPNIPKLWHGIG 219

Query: 641 VMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCV 700
           ++Y +      A++   K LE    LDP       I   LG  Y+   +   A++CFR +
Sbjct: 220 ILYDRYGSLDYAEEAFAKVLE----LDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYI 275

Query: 701 LEK 703
           L +
Sbjct: 276 LPQ 278

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 2/82 (2%)

Query: 534 WFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQ-DQALTAYSTAS 592
           W S+   Y  + +  +A   Y+++  L+P  +  W      Y     Q + AL AY  A+
Sbjct: 395 WCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAA 454

Query: 593 RFFP-GMHLPKLFLGMQFMAMN 613
           R  P  +H+ +    +    MN
Sbjct: 455 RLDPNNVHIRERLDALTAQIMN 476

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
           cerevisiae YBR112c CYC8 general repressor of
           transcription, hypothetical start
          Length = 1148

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 99/217 (45%), Gaps = 13/217 (5%)

Query: 536 SVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFF 595
           S+A  Y S D   +A + Y  +  ++P  +  W    H Y +  +  +A  AY  A    
Sbjct: 87  SLAHLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHL 146

Query: 596 PGMHLPKLF--LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAK 653
              ++PKL+  +G+ +    SL+ AE  F    ++ P+      +   +YF+     K +
Sbjct: 147 SNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPH----FEKANEIYFRLGIIYKHQ 202

Query: 654 KYLKKALEVVKDL---DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEI 710
               +ALE  + +    P+      I   LG     + E + A + +  VL +ND ++++
Sbjct: 203 GKWSQALECFRYILAQPPTPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKV 262

Query: 711 HCSLGYLY----LKTKKLQKAIDHLHKSLYLKPNNSS 743
              LG LY    ++    QKA+ +L KSL + P++++
Sbjct: 263 FQQLGCLYGMNNVQFYDPQKALSYLLKSLEVDPSDAT 299

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 100/250 (40%), Gaps = 36/250 (14%)

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
           AY   LY LSN N             PK    W  +   Y     +  A++ ++K   LD
Sbjct: 138 AYQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELD 182

Query: 562 PSFAAA---WLGFAHTYALEGEQDQALTA--YSTASRFFPGMHLPKLF-LGMQFMAMNSL 615
           P F  A   +      Y  +G+  QAL    Y  A    P       F LG    +M   
Sbjct: 183 PHFEKANEIYFRLGIIYKHQGKWSQALECFRYILAQPPTPLQEWDIWFQLGSVLESMGEW 242

Query: 616 NLAESYFVLAYDICPND--PLVLNEMGVMYFKKN----EFVKAKKYLKKALEVVKDLDPS 669
             A   +   + +  ND    V  ++G +Y   N    +  KA  YL K+LEV    DPS
Sbjct: 243 QGAREAY--EHVLLQNDHHAKVFQQLGCLYGMNNVQFYDPQKALSYLLKSLEV----DPS 296

Query: 670 SRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAID 729
             TT     +LG  +   ++   A   F+  + ++ +N    CS+G LY +  + + A+D
Sbjct: 297 DATTW---YHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 353

Query: 730 HLHKSLYLKP 739
              +++ L P
Sbjct: 354 AYTRAIRLNP 363

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 68/181 (37%), Gaps = 43/181 (23%)

Query: 560 LDP---SFAAAWLGFAHTYALEGEQDQALTAY--------STASRFFPGMHL-------- 600
           LDP   S A  WL  A      G+ D+A  AY        S+        HL        
Sbjct: 40  LDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQ 99

Query: 601 -------------PKL-----FLGMQFMAMNSLNLA-ESYFVLAYDIC-PNDPLVLNEMG 640
                        P+L      LG  ++ ++ L  A  +Y    Y +  PN P + + +G
Sbjct: 100 KAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIG 159

Query: 641 VMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCV 700
           ++Y +      A++   K LE    LDP       I   LG  Y+   +   A++CFR +
Sbjct: 160 ILYDRYGSLDYAEEAFAKVLE----LDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYI 215

Query: 701 L 701
           L
Sbjct: 216 L 216

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 529 KSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQ-DQALTA 587
           ++ I W S+   Y  + +  +A   Y+++  L+P  +  W      Y     Q   AL A
Sbjct: 330 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDA 389

Query: 588 YSTASRFFP-GMHLPK 602
           Y  A+R  P  +H+ K
Sbjct: 390 YKQAARLDPENIHIRK 405

>Kwal_23.3670
          Length = 802

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 94/217 (43%), Gaps = 13/217 (5%)

Query: 528 PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTA 587
           P S     S+A  Y S D    A + Y ++  ++P     W    H Y +  +  +A  A
Sbjct: 97  PSSTKALTSLAHLYRSRDMFQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAA 156

Query: 588 YSTASRFFPGMHLPKLF--LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFK 645
           Y  A       ++PKL+  +G+ +    SL+ AE  F    ++ P       +   +YF+
Sbjct: 157 YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQ----FEKANEIYFR 212

Query: 646 KNEFVKAKKYLKKALEVVKDL---DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLE 702
                K +    +ALE  + +    P+      +   LG     ++E + A + +  VL 
Sbjct: 213 LGIIYKHQGKWNQALECFRYILTQPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVLL 272

Query: 703 KNDKNSEIHCSLGYLY----LKTKKLQKAIDHLHKSL 735
           +N++++++   LG LY    ++    Q A++ L KSL
Sbjct: 273 QNERHAKVLQQLGCLYGMQNVQFYNTQTALNLLLKSL 309

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 98/252 (38%), Gaps = 40/252 (15%)

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
           AY   LY LSN N             PK    W  +   Y     +  A++ ++K   LD
Sbjct: 156 AYQQALYHLSNPN------------VPK---LWHGIGILYDRYGSLDYAEEAFAKVLELD 200

Query: 562 PSFAAA---WLGFAHTYALEGEQDQALTAYSTASRFF---PGMHLPK----LFLGMQFMA 611
           P F  A   +      Y  +G+ +QAL  +    R+    P   L +      LG    +
Sbjct: 201 PQFEKANEIYFRLGIIYKHQGKWNQALECF----RYILTQPPAPLQEWDVWFQLGSVLES 256

Query: 612 MNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKN-EFVKAKKYLK---KALEVVKDLD 667
           M+    A   +            VL ++G +Y  +N +F   +  L    K+LEV     
Sbjct: 257 MSEWQGAREAYEHVLLQNERHAKVLQQLGCLYGMQNVQFYNTQTALNLLLKSLEV----- 311

Query: 668 PSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKA 727
               T  +   +LG  +   N+   A   F+  + ++ +N    CS+G LY +  + + A
Sbjct: 312 --DSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDA 369

Query: 728 IDHLHKSLYLKP 739
           +D   +++ L P
Sbjct: 370 LDAYTRAIRLNP 381

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 71/183 (38%), Gaps = 43/183 (23%)

Query: 560 LDP---SFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPG--------MHL-------- 600
           +DP   S A  WL  A      G+ D+A  AY    ++ P          HL        
Sbjct: 58  VDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQ 117

Query: 601 -------------PKL-----FLGMQFMAMNSLNLAESYFVLA-YDIC-PNDPLVLNEMG 640
                        P+L      LG  ++ ++ L  A + +  A Y +  PN P + + +G
Sbjct: 118 RAAELYQRALTVNPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHLSNPNVPKLWHGIG 177

Query: 641 VMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCV 700
           ++Y +      A++   K LE    LDP       I   LG  Y+   +   A++CFR +
Sbjct: 178 ILYDRYGSLDYAEEAFAKVLE----LDPQFEKANEIYFRLGIIYKHQGKWNQALECFRYI 233

Query: 701 LEK 703
           L +
Sbjct: 234 LTQ 236

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 667 DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQK 726
           +PSS   ++   +L H YR  +  + A + ++  L  N +  +I  +LG+ YL    LQ+
Sbjct: 96  NPSSTKALT---SLAHLYRSRDMFQRAAELYQRALTVNPELGDIWATLGHCYLMLDDLQR 152

Query: 727 AIDHLHKSLY 736
           A     ++LY
Sbjct: 153 AYAAYQQALY 162

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 35/74 (47%)

Query: 666 LDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQ 725
           +DP +++T    L++      L + + A   +   L+ N  +++   SL +LY      Q
Sbjct: 58  VDPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSLAHLYRSRDMFQ 117

Query: 726 KAIDHLHKSLYLKP 739
           +A +   ++L + P
Sbjct: 118 RAAELYQRALTVNP 131

>AGL294W [4018] [Homologous to ScYBL084C (CDC27) - SH]
           complement(154711..156681) [1971 bp, 656 aa]
          Length = 656

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 106/257 (41%), Gaps = 20/257 (7%)

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDR-ISEAQKYYSKSSIL 560
            Y   L+ L +K +L  L H L     K+ ITW  +   + SL+R   EA K   K++ L
Sbjct: 409 VYSTLLWHLHDKIRLADLCHELMAQDDKNCITWCCLGNLF-SLNRDHDEAIKALKKATSL 467

Query: 561 DPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAES 620
           +P FA A+    H Y+     D A   Y  A    P  +     LGM  + +   + A  
Sbjct: 468 NPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYDEALL 527

Query: 621 YFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTI----SI 676
           +F  A  I P + ++    GV   +     KA  + + A E    L P+S   +     +
Sbjct: 528 HFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACE----LQPNSSLALFKKSQL 583

Query: 677 QLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLY 736
             NLG       +   A++ F  + +     + +H  LG LY    + + AI     ++ 
Sbjct: 584 LFNLG-------QYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMN 636

Query: 737 LKPNNSSATALLKNALE 753
           L PN      L+K ALE
Sbjct: 637 LDPN---GIQLVKEALE 650

>Scas_599.5
          Length = 809

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 114/264 (43%), Gaps = 30/264 (11%)

Query: 500 LPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSI 559
           L  +   L+ L +K  L  LS+ L + F     TW +V   +       EA + + K++ 
Sbjct: 559 LETFSTLLWHLHDKTNLTDLSNILMDEFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATK 618

Query: 560 LDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFP-----GMHLPKLFLGMQFMAMNS 614
           LDP+F  A       Y L+G +  ++ +Y TA  F+       +H    + G   M M S
Sbjct: 619 LDPNFVYA-------YTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYG---MGMCS 668

Query: 615 LNLAE-----SYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPS 669
           + L E      YF  A  I P++ +++   GV   K     KA  Y + A ++     P+
Sbjct: 669 MKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQI----QPT 724

Query: 670 SRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAID 729
           S      + +L ++  K  +   A+  F  +++   + + +   LG LY    + + AI 
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQ---ALDAFEELIKIAPEEATVQFILGQLYQIMGRKKDAIK 781

Query: 730 HLHKSLYLKPNNSSATALLKNALE 753
               ++ L P  S+   L+ +AL+
Sbjct: 782 RYTIAMNLDPKGSN---LISDALK 802

>YBL084C (CDC27) [117] chr2 complement(67166..69442) Component of
           anaphase-promoting complex (APC), required for the
           metaphase-anaphase transition and for Clb2p degradation
           [2277 bp, 758 aa]
          Length = 758

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 99/234 (42%), Gaps = 9/234 (3%)

Query: 507 LYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQ-KYYSKSSILDPSFA 565
           L+ L +K K   L++ L +T P    TW  +    +SL +  +A  K + K++ LDP+FA
Sbjct: 516 LWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNL-LSLQKDHDAAIKAFEKATQLDPNFA 574

Query: 566 AAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLA 625
            A+    H ++     D A T Y  A    P  +     LG   M +     A  YF  A
Sbjct: 575 YAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKA 634

Query: 626 YDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYR 685
             I P + +++   G    K     KA +Y     E+   L P+S  +   +  +G    
Sbjct: 635 RSINPVNVVLICCCGGSLEKLGYKEKALQY----YELACHLQPTSSLS---KYKMGQLLY 687

Query: 686 KLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKP 739
            +    +A++ F  +++    ++  H  LG  Y    + + AI  L  ++ L P
Sbjct: 688 SMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDP 741

>Kwal_27.10740
          Length = 628

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 101/247 (40%), Gaps = 10/247 (4%)

Query: 507 LYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAA 566
           L+ L++   L  L H L E    +  TW  +   +       E+ K + +S+ LDPSF  
Sbjct: 386 LWHLNDTTGLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTY 445

Query: 567 AWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAY 626
           A+    H Y+     D A+T Y  A       +     LGM  + +        +F  A 
Sbjct: 446 AYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKAR 505

Query: 627 DICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRK 686
            I P + +++   GV   K +   +A +    A E    L P S   +  +  L     K
Sbjct: 506 SINPVNVILICCCGVALEKLSHQERALQNYDLACE----LQPMSSLALFKRAQLLLAMGK 561

Query: 687 LNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATA 746
            N    A++ F  +++     + IH  LG LY    + Q A+  L  ++ L P  S    
Sbjct: 562 YN---YALESFEKLVKIAPDEATIHFLLGQLYQIVGRKQDAVKELTIAMNLDPKGSQ--- 615

Query: 747 LLKNALE 753
           L+K+ALE
Sbjct: 616 LIKSALE 622

>YHR166C (CDC23) [2453] chr8 complement(437170..439050) Component of
           anaphase-promoting complex (APC), required for Clb2p
           degradation and for the metaphase-anaphase transition
           [1881 bp, 626 aa]
          Length = 626

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 80/201 (39%), Gaps = 4/201 (1%)

Query: 489 VLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRIS 548
           +++ D +  N L  Y   LY +   +KL  L+  +++       T   +A YY +     
Sbjct: 355 IVKQDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHE 414

Query: 549 EAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQ 608
           ++  Y+ ++  LD     AW    H +        A+  Y  A    P        LG  
Sbjct: 415 KSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQA 474

Query: 609 FMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDP 668
           +  ++    +  YF  A  + P D  +   +G  Y K    V+A K  K++++  + +D 
Sbjct: 475 YALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQ 534

Query: 669 SSRTTISIQLNLGHTYRKLNE 689
           ++    SI   L   Y +L +
Sbjct: 535 NT----SIYYRLAQLYEELED 551

>CAGL0C01903g complement(199487..201796) similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex, hypothetical start
          Length = 769

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 104/248 (41%), Gaps = 12/248 (4%)

Query: 507 LYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISE-AQKYYSKSSILDPSFA 565
           L+ L +  +L  L   L   +P    TW  V  Y +SL +  E A + + K++ +DP FA
Sbjct: 527 LWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNY-LSLKKDHEDAIEAFEKATKIDPKFA 585

Query: 566 AAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLA 625
            A+    H  +     D A   +  A    P  +     +G+  M +   + A  YF  A
Sbjct: 586 YAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKA 645

Query: 626 YDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYR 685
             I P + +++   GV   K     KA +Y     E+   L P+S      + NL +   
Sbjct: 646 RQIYPINAVLICCCGVALEKLEYQDKALEY----YELACTLQPNSNLARFKRANLLYAMG 701

Query: 686 KLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSAT 745
           + N   +A++ F  + +   +   +H  LG LY    +  +AI     ++ L P  +   
Sbjct: 702 RYN---LALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEAIREFTVAMNLDPKGNQ-- 756

Query: 746 ALLKNALE 753
            L+ +ALE
Sbjct: 757 -LILDALE 763

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 10/86 (11%)

Query: 654 KYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCS 713
           ++LK + E+  +++ S R+ +   +  G+   K N NE      R  L      + +HC 
Sbjct: 120 RFLKSSNEI--EMESSERSLLKFDIIEGN--EKENRNE------RMPLPHGPTEATVHCL 169

Query: 714 LGYLYLKTKKLQKAIDHLHKSLYLKP 739
           LG LY K  K+  +  H  K+L   P
Sbjct: 170 LGNLYYKISKMDDSKGHYQKALSYNP 195

>Scas_680.35
          Length = 631

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 91/224 (40%), Gaps = 19/224 (8%)

Query: 485 LCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSL 544
           L E V++ D +  + L  Y   LY +   +KL  L+  +A+     + T   +A YY + 
Sbjct: 356 LFEQVVKMDPYRLDDLDTYSNILYVMQKHSKLAYLAQFVAQIDKFRSETCCIMANYYSAR 415

Query: 545 DRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTA----SRFFPGMHL 600
               ++  Y+ ++  L+    +AW    H +        A+  Y  A     R F   + 
Sbjct: 416 QEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWY- 474

Query: 601 PKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKAL 660
               LG  +  ++    +  YF  A  + P D  +   +G  Y K     +A K  ++A+
Sbjct: 475 ---GLGQAYEVLDMHLYSLYYFQKACTLKPLDRRMWQALGTCYTKIGNKTEAIKCFERAI 531

Query: 661 EVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKC----FRCV 700
           ++  + D  +    ++  NL   Y +LN+   A  C     RCV
Sbjct: 532 QLSGNADQDT----TLMYNLAKLYDQLND---AANCKQYMIRCV 568

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 7/101 (6%)

Query: 639 MGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFR 698
           M   Y  + E  K+  Y ++AL + K    +S  T+     +GH + +L  +  AI+C+R
Sbjct: 408 MANYYSARQEHEKSIMYFRRALTLNKKC--TSAWTL-----MGHEFVELKNSHAAIECYR 460

Query: 699 CVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKP 739
             ++ N ++ +    LG  Y        ++ +  K+  LKP
Sbjct: 461 RAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKP 501

>KLLA0A05258g 466776..468674 similar to sp|P16522 Saccharomyces
           cerevisiae YHR166c CDC23 subunit of anaphase-promoting
           complex (cyclosome), start by similarity
          Length = 632

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 104/272 (38%), Gaps = 27/272 (9%)

Query: 419 FKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSK-VDICYTQC 477
           FKEFG D             KYI         E L +  K+  N   +R++   I Y   
Sbjct: 310 FKEFGGD-----------FDKYI---------EELGEIMKVFPNFSFLRAQHALINYKYM 349

Query: 478 KFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSV 537
            +     + + ++  D +  + L  Y   LY L    KL  L+   A        T   +
Sbjct: 350 DYANAEIVFDELVTMDPYRLDDLDTYSNVLYVLQKPYKLAYLAQYAANVDIYRPETCCII 409

Query: 538 ATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPG 597
           A Y+ S  +  ++  Y+ ++ +LD S+  AW+   H +        A+  Y  AS   P 
Sbjct: 410 ANYFSSKQQHEKSILYFRRALMLDKSYTHAWILMGHEFIEMKNSHAAIECYRRASDVNPR 469

Query: 598 MHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLK 657
                  LG  +  ++  + A  YF  A  + P D  +       Y K ++ V+A K  +
Sbjct: 470 DFQAWYGLGQAYEVLDKHSFALYYFQKACALKPLDKRMWFASASCYEKLDKTVQAIKCFQ 529

Query: 658 KALEVVKDLDPSSRTTISIQLNLGHTYRKLNE 689
           ++ ++      S    ISI   L   + K N+
Sbjct: 530 RSSQL------SGEQDISILYRLAKLHEKNND 555

>YHR117W (TOM71) [2405] chr8 (342351..344270) Minor import receptor
           of the mitochondrial outer membrane, similar to Tom70p
           in sequence and in function, has tetratricopeptide (TPR)
           repeats [1920 bp, 639 aa]
          Length = 639

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 663 VKDLDPSSRTTISIQL-NLG-HTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK 720
           +K L PS R   ++QL N G H +   N NE AIK ++  +E +      + ++   Y+ 
Sbjct: 115 LKGLSPSQRQAYAVQLKNRGNHFFTAKNFNE-AIKYYQYAIELDPNEPVFYSNISACYIS 173

Query: 721 TKKLQKAIDHLHKSLYLKPNNSSATALLKNA 751
           T  L+K I+   K+L +KP++S   ALL+ A
Sbjct: 174 TGDLEKVIEFTTKALEIKPDHSK--ALLRRA 202

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 3/102 (2%)

Query: 565 AAAWLGFAHTYALEGEQDQA-LTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFV 623
           A +  GF +     GE D A L   S + R    + L     G  F    + N A  Y+ 
Sbjct: 94  AKSGEGFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNR--GNHFFTAKNFNEAIKYYQ 151

Query: 624 LAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKD 665
            A ++ PN+P+  + +   Y    +  K  ++  KALE+  D
Sbjct: 152 YAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193

>KLLA0C15455g 1341570..1343270 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, start by similarity
          Length = 566

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 9/96 (9%)

Query: 647 NEFVKAKKYLKKALEVVKDL---DPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEK 703
           + F  +K+ + K L+V   L   DP       +QL LG  +    E    I CFR  LE 
Sbjct: 392 DRFNLSKQVITKYLQVANALPQVDPE------VQLGLGTLFYANEEFGKTIDCFRTALEV 445

Query: 704 NDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKP 739
           N  +  +   LG     + + ++AI   HK+L LKP
Sbjct: 446 NPNDELMWNRLGASLANSNRSEEAIQAYHKALALKP 481

>CAGL0I02288g complement(203605..205524) similar to sp|P16522
           Saccharomyces cerevisiae YHR166c CDC23, hypothetical
           start
          Length = 639

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 74/180 (41%)

Query: 484 ELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMS 543
           ++ E ++E+D +  + +  +   LY +    KL  L+  +++       T   +A YY +
Sbjct: 363 QIFEKIMEDDPYRLDDMDTFSNILYVMQKNAKLAYLAQFVSQIDRFRPETCCVIANYYSA 422

Query: 544 LDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKL 603
                ++  Y+ ++  LD    +AW    H +      + A+ +Y  A    P       
Sbjct: 423 RQEHEKSIMYFRRALTLDKKTTSAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWY 482

Query: 604 FLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVV 663
            LG  +  ++    +  YF  A  + P D  +   +G  Y K     +A K  ++AL++ 
Sbjct: 483 GLGQAYEVLDMHLYSLYYFQRACILKPLDKRMWQALGSCYAKVGNHAEAIKCYERALQLT 542

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/232 (16%), Positives = 87/232 (37%), Gaps = 41/232 (17%)

Query: 444 EDITKSNEILAKDYKLADNVDVVRSKVDICYTQ--CKFNECLELCETVLENDEFNTNILP 501
           +D+T++     K ++L D  D+V +K  + Y    C +     +C+ V++ND        
Sbjct: 603 QDLTRAFRCYVKAFEL-DAGDLVAAKYMVEYYSDLCNWQAAANICDRVIKND-------- 653

Query: 502 AYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
                              H  +  +P   +       YY+ L + +E+ +++  +  +D
Sbjct: 654 ------------------MHLNSVNWPYRVL-----GVYYLELQQEAESIEWFQSALRID 690

Query: 562 PSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESY 621
            S   AW+G    YA  G  + ++  +  A    P      LFL +    ++    +   
Sbjct: 691 SSDVEAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISLCQLSEFEKSLEA 750

Query: 622 FVLAYDICPNDPL-------VLNEMGVMYFKKNEFVKAKKYLKKALEVVKDL 666
                +  P + +        L E  + +F +   +KA     + + +++ +
Sbjct: 751 LRKLVNKYPQEAIFKERLSATLVEHALQFFDQGYLIKAATCAAEVISIIEGI 802

>Scas_666.23
          Length = 596

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 60/138 (43%), Gaps = 21/138 (15%)

Query: 614 SLNLAESYFVLAYDICPNDPLV-------LNEMGVMYFKKNEFVKAKKYLKKALEVVKDL 666
           S   A  YF+      P+D  V       L   G+  F KN  ++A + +KKALE    L
Sbjct: 281 SFTKATEYFLKQLSETPDDETVKEKTAIALEHQGIFKFLKNNPLEAHEDIKKALE----L 336

Query: 667 DPSSRTTISIQLNL---GHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKK 723
            P   + I + L L   G T       E A+K        +DKN+ ++   G +Y  T++
Sbjct: 337 HPRINSYIYMALILADKGDTDNYFANYEKAMKL-------DDKNAALYYHRGQMYFITQQ 389

Query: 724 LQKAIDHLHKSLYLKPNN 741
            +KA +   K+  L P N
Sbjct: 390 YEKAGEDFDKAKELDPEN 407

>Kwal_56.24750
          Length = 619

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 73/341 (21%), Positives = 138/341 (40%), Gaps = 11/341 (3%)

Query: 361 LCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFK 420
           L +LRG +Y  Q+  + A ++F  ++ +   N+  +  LLS  +    E   L   L+ K
Sbjct: 220 LHYLRGVLYKIQDISSNAINSFLSSLSIFPYNWACWTELLS-CISRSDESILLLKILNEK 278

Query: 421 EFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLA--DNVDVVRSK-VDICYTQC 477
              E  ++M   +K++L +  N        E+   DY L+   N   ++++   I Y   
Sbjct: 279 FTDEKSQLMLKFFKLSLFQEFNGNIDDFIQEL---DYLLSIFPNFAFLKTQHALINYHYM 335

Query: 478 KFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSV 537
            +     + E +++ D +    +  Y   LY +   +KL  L+   +      A T   +
Sbjct: 336 DYVSAGLIFENIIKIDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCII 395

Query: 538 ATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPG 597
           A YY +     ++  Y+ ++  L+    +AW    H +        A+  Y  A    P 
Sbjct: 396 ANYYSAKQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPR 455

Query: 598 MHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLK 657
                  LG  +  ++    +  YF  +  + P D  +   +   Y K     ++ K   
Sbjct: 456 DFKAWYGLGQAYEVLDMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVGNAAESIKCYT 515

Query: 658 KALEVVKDLDPSSRTTISIQLNLGHTYRK--LNENEIAIKC 696
           +AL++  D D    TTI  +L L H  ++  ++  E  IKC
Sbjct: 516 RALQLSFDSDLD--TTILYRLALLHEKQRDIISCKEYMIKC 554

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 7/97 (7%)

Query: 643 YFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLE 702
           Y  K E  K+  Y ++AL + K      + T +  L +GH + +L  +  AI+C+R  ++
Sbjct: 399 YSAKQEHEKSIMYFRRALTLNK------KCTSAWTL-MGHEFVELKNSHAAIECYRRAVD 451

Query: 703 KNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKP 739
            N ++ +    LG  Y        ++ +  KS  LKP
Sbjct: 452 INPRDFKAWYGLGQAYEVLDMHLYSLYYFQKSCALKP 488

>Kwal_27.11737
          Length = 575

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 81/208 (38%), Gaps = 33/208 (15%)

Query: 546 RISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHL-PKLF 604
           ++SEA   +  +   DP    AWL           Q Q    YS        + L P+  
Sbjct: 303 KLSEAALAFEAAVQEDPRHVDAWLKLGLV------QTQNEMEYSGIGALEECLRLDPQNL 356

Query: 605 LGMQFMAMNSLNLAESYFVLAYD-------------ICPNDPLVLNEMGVMYFKKNEFVK 651
            GM  +A++ +N  E Y V A+              + PND    N   +  +  N+ + 
Sbjct: 357 EGMVTLAISYIN--EGYDVSAFKMLDKWLETKYPDLVVPNDSSQTN---IDRYSMNQAIT 411

Query: 652 AKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIH 711
            +      L+VV  L    +   S+QL LG  +   ++ +  + CFR  L     +  + 
Sbjct: 412 LR-----FLQVVNKL---PQVDASLQLGLGILFYSNDDYDKTVDCFRAALAVRPDDELMW 463

Query: 712 CSLGYLYLKTKKLQKAIDHLHKSLYLKP 739
             LG     + + ++AI    K+L LKP
Sbjct: 464 NRLGASLANSNRSEEAIQAYRKALQLKP 491

>Sklu_1876.2 YOL145C, Contig c1876 732-4004
          Length = 1090

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 75/176 (42%), Gaps = 31/176 (17%)

Query: 545 DRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLF 604
           +++++A+ +   +   DP++    L     Y   G+ D+AL    T+  F  G+H   L 
Sbjct: 120 NQLTQAEVHLKDAIGYDPTWIGNMLATIDLYYQRGQYDKAL---ETSELFVKGIHAEDLR 176

Query: 605 LGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVK 664
            G Q                     PN   +L    ++Y KKN +V + K  ++ L +  
Sbjct: 177 NGRQSK-------------------PNVMFLLLRAKLLYQKKN-YVASLKIFQELLVLNP 216

Query: 665 DLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIH--CSLGYLY 718
            L P  R      + +G  + +L ++++AIK +   LE N+KN  +     LG  Y
Sbjct: 217 VLQPDPR------IGIGLCFWQLKDHKMAIKSWERSLELNNKNVNVRTLVLLGTFY 266

>KLLA0E20933g 1860517..1862649 weakly similar to sp|P38042
           Saccharomyces cerevisiae YBL084c CDC27 subunit of
           anaphase-promoting complex (cyclosome), start by
           similarity
          Length = 710

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 92/249 (36%), Gaps = 56/249 (22%)

Query: 560 LDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAE 619
           LD     AW    + ++L  + D+A+TA+  A +  P                       
Sbjct: 487 LDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDP----------------------- 523

Query: 620 SYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLN 679
            +F  AY +           G  Y   + F  AK   +KAL + K       T  +    
Sbjct: 524 -FFAYAYTL----------QGHEYSNNDAFDNAKSCFRKALTIEK-------THYNALYG 565

Query: 680 LGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKP 739
           LG    KL + E A+  F      N  N  ++C  G    + ++ ++A++    +  L+P
Sbjct: 566 LGMCCVKLGKFEEALLFFEKARALNPVNVILNCCCGVALERLQQPERALNFYELATELQP 625

Query: 740 NNSSATALLKNALELNV--------------TLSLDASHPLIDKSNLMSQASKDKASLNK 785
            NSS     K+ L LN+              +L+ D +H      NL     K + ++N+
Sbjct: 626 -NSSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQ 684

Query: 786 KRSSLTYDP 794
              ++  DP
Sbjct: 685 YTIAMNLDP 693

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 99/252 (39%), Gaps = 20/252 (7%)

Query: 507 LYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAA 566
           L+ L +K  L  L   L      + I W S+   +       EA   + K+  LDP FA 
Sbjct: 468 LWHLQDKTHLSALCAELLTLDKYNPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAY 527

Query: 567 AWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLF-LGMQFMAMNSLNLAESYFVLA 625
           A+    H Y+     D A + +  A       H   L+ LGM  + +     A  +F  A
Sbjct: 528 AYTLQGHEYSNNDAFDNAKSCFRKALT-IEKTHYNALYGLGMCCVKLGKFEEALLFFEKA 586

Query: 626 YDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTI----SIQLNLG 681
             + P + ++    GV   +  +  +A  +     E+  +L P+S   +     + LN+G
Sbjct: 587 RALNPVNVILNCCCGVALERLQQPERALNF----YELATELQPNSSLALFKKSQLLLNMG 642

Query: 682 HTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNN 741
                  +   A+  F  +       + +H  LG LY    K Q A++    ++ L P  
Sbjct: 643 -------QYSSALHNFERLESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYTIAMNLDPKG 695

Query: 742 SSATALLKNALE 753
           S    L+K A+E
Sbjct: 696 SQ---LIKEAME 704

>CAGL0K11209g 1088471..1090243 similar to sp|P35056 Saccharomyces
           cerevisiae YDR244w PAS10 peroxisomal targeting signal
           receptor, hypothetical start
          Length = 590

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 76/207 (36%), Gaps = 31/207 (14%)

Query: 546 RISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFL 605
           ++SEA   +  +   DP    AWL          ++   ++A  T  +  P         
Sbjct: 301 KLSEAALAFEAAIKQDPKHVDAWLKLGIVQIQNEKELNGMSALETCLKLDPN-------- 352

Query: 606 GMQFMAMNSLNLAESYFVLAYDICPND----------PLVLNEM---GVMYFKKNEFVKA 652
                AM   NLA SY    YD+   +          P   N     G     +N   K 
Sbjct: 353 --NLEAMK--NLAISYINEGYDMSAYNMLNRWADTKYPGFYNSAELEGKRDEHENIHSKM 408

Query: 653 KKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHC 712
            +     +  +  +DP       IQL LG  +   +E +  I CF+  L+ N  +  +  
Sbjct: 409 TRRFLSLVNRINSVDPD------IQLCLGLLFYANDEFDRTIDCFQAALKVNPNDELMWN 462

Query: 713 SLGYLYLKTKKLQKAIDHLHKSLYLKP 739
            LG     + + ++AI   H++L LKP
Sbjct: 463 RLGASLANSNRSEEAIQAYHRALQLKP 489

>ABR206W [800] [Homologous to ScYHR166C (CDC23) - SH]
           complement(787181..789229) [2049 bp, 682 aa]
          Length = 682

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 94/243 (38%), Gaps = 45/243 (18%)

Query: 487 ETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDR 546
           + +++ D +  + L  Y   LY +   +KL  LS   A+       T   +A Y+ +  +
Sbjct: 408 DEIVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIANYFSAKQQ 467

Query: 547 ISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLG 606
             +A  Y+ ++  L+ +   AW                                    +G
Sbjct: 468 HEKAIMYFRRALTLNKTCTNAW----------------------------------TLMG 493

Query: 607 MQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDL 666
            +F+ M + + A   +  A DI P D      +G  Y   +  + A  YL+KA   +K L
Sbjct: 494 HEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACS-LKPL 552

Query: 667 DPSSRTTISIQLNLGHTYRKLNENEIAIKCF-RCVLEKNDKNSEIHCSLGYLYLKTKKLQ 725
           D        +   L + Y KL+    AIKCF R     ND++  I   L  LY   +++Q
Sbjct: 553 DK------RMWQALANCYDKLDRPNQAIKCFQRASQLSNDQDITILYYLATLY---ERVQ 603

Query: 726 KAI 728
            AI
Sbjct: 604 DAI 606

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 60/139 (43%), Gaps = 13/139 (9%)

Query: 643 YFK-KNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVL 701
           YF  K +  KA  Y ++AL +       ++T  +    +GH + ++  +  AI+C+R  +
Sbjct: 461 YFSAKQQHEKAIMYFRRALTL-------NKTCTNAWTLMGHEFVEMKNSHAAIECYRRAV 513

Query: 702 EKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLD 761
           + N  + +    LG  Y    +   A+ +L K+  LKP +      L N  +      LD
Sbjct: 514 DINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKPLDKRMWQALANCYD-----KLD 568

Query: 762 ASHPLIDKSNLMSQASKDK 780
             +  I      SQ S D+
Sbjct: 569 RPNQAIKCFQRASQLSNDQ 587

>Sklu_2077.4 YOR007C, Contig c2077 4462-5433 reverse complement
          Length = 323

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582
           E  P +A+ + + A  Y SL +  E+ +    +  ++PS++  +  LGFA  YAL G+ +
Sbjct: 125 EVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK-YAL-GKPE 182

Query: 583 QALTAYST 590
           +AL AY T
Sbjct: 183 EALEAYKT 190

>KLLA0F04191g 397611..400268 weakly similar to sp|P19735
           Saccharomyces cerevisiae YBR055c PRP6
           snRNP(U4/U6)-associated splicing factor singleton, start
           by similarity
          Length = 885

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 616 NLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALE-VVKDLDP------ 668
           +L ++ F  A +     P+V+ E+G ++ K++++ KA K+  +A E  ++  DP      
Sbjct: 767 SLRKTTFQDALEATKEHPMVITEIGKVFQKEHQYAKAYKWFIRASENNLQFGDPWVWLYI 826

Query: 669 --SSRTTISIQLNLGHTYRKLNENE 691
             S    + +Q+N   T +KL ENE
Sbjct: 827 CESCMNPVDLQINEEKTLKKLKENE 851

>KLLA0F24046g 2240454..2242268 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 mitochondrial outer membrane
           specialized import receptor, start by similarity
          Length = 604

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 127/317 (40%), Gaps = 33/317 (10%)

Query: 403 NLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKY-INTEDITKSNEILAKDYKLAD 461
            +  P+  +D +D  +  +  E K+ ++NLYK     Y +  E+ TK+ E+  K+ + + 
Sbjct: 249 GIFNPETSFDDYDGENEADV-ELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSP 307

Query: 462 NVDVVRSKVDICYTQC---KF------NECLELCETVLENDEFNTNILPAYIGCLYELSN 512
           + + ++ K  I +      KF         + L E++  N   +T I  A I      +N
Sbjct: 308 DNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEAN 367

Query: 513 KNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFA 572
           + K +    +  E  P  +  ++     +  ++   EA   + K+  L+P    A++  A
Sbjct: 368 QYKEYF--DKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA 425

Query: 573 HTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPND 632
                +   D   T +S A R FP       F      A NSL+ A   + +A  +    
Sbjct: 426 CLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDAL 485

Query: 633 PLVLNEMGVMYFKKNE---------FVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHT 683
           P +   +  M  K            FV+A +  ++A ++    DP S      Q  +G  
Sbjct: 486 PGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKI----DPRSE-----QAKIGLA 536

Query: 684 YRKLNENEI--AIKCFR 698
             KL + EI  AI+ F 
Sbjct: 537 QLKLQQEEIDDAIQLFE 553

>AFR453W [3645] [Homologous to ScYDR244W (PEX5) - SH]
           complement(1251018..1252727) [1710 bp, 569 aa]
          Length = 569

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 653 KKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHC 712
           ++YL+ A   + ++DP       +QL LG  +    + +  I CFR  L     +  +  
Sbjct: 403 EQYLRVA-NALPEVDPD------VQLGLGILFYANEDFDKTIDCFRAALAVRPDDECMWN 455

Query: 713 SLGYLYLKTKKLQKAIDHLHKSLYLKP 739
            LG     + + ++AI   H+++ LKP
Sbjct: 456 RLGASLANSNRSEEAIQAYHRAIQLKP 482

>CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces
           cerevisiae YOR080w, hypothetical start
          Length = 710

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 638 EMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTI-SIQLNLGHTYRKLNENEIAIKC 696
           E+G  YFK  ++ KA+   +KAL++V   D  S+  I  ++  + H     +E    +KC
Sbjct: 12  ELGTTYFKSEDYRKARSLFEKALKLV---DSYSKDEIKKLRGEIYHVDELPDELYKRVKC 68

Query: 697 FRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNV 756
            R +   + K+ +I  +L   + K   L  A+   HK + L+P N   T + K  + + +
Sbjct: 69  ERII--THPKHVKILDNLSACWEKQNILDNALKLSHKMVKLEPFNIK-TYIRKGRILMKL 125

Query: 757 TLSLDASH 764
           T   DA H
Sbjct: 126 TKYRDAYH 133

>Kwal_56.22433
          Length = 322

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582
           +  P +A+ + + A  + SL +  EA K    +  ++PS++  +  LGFA  YAL G+ +
Sbjct: 125 QVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ-YAL-GKPE 182

Query: 583 QALTAY 588
           +AL AY
Sbjct: 183 EALDAY 188

>Sklu_2239.3 YJR088C, Contig c2239 5120-5974
          Length = 284

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 4/101 (3%)

Query: 523 LAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDP--SFAAAWLGFAHTY-ALEG 579
           L E FP  A  W+   T Y SL +   +   + +   + P    A A LG    Y AL G
Sbjct: 151 LVEKFPSDAELWWMCGTEYYSLGQFDRSAYCFEEVLCITPFNYVAFAQLGEVLYYKALRG 210

Query: 580 EQDQALTAYSTASRFFPGMHLPKLFL-GMQFMAMNSLNLAE 619
            +    T  ++   F   + L ++F+ G  F+A  S  L++
Sbjct: 211 NRASKDTLKNSLDNFLRSVELSEMFVKGWSFIAKISKELSK 251

>YDR244W (PEX5) [1078] chr4 (950555..952393) Peroxisomal protein
           (peroxin), receptor for proteins carrying peroxisomal
           targeting signal 1 (PTS1) sequence, contains
           tetratricopeptide (TPR) repeats [1839 bp, 612 aa]
          Length = 612

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%)

Query: 676 IQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSL 735
           IQL LG  +   ++ +  I CF   L  N  +  +   LG     + + ++AI   H++L
Sbjct: 459 IQLCLGLLFYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRAL 518

Query: 736 YLKP 739
            LKP
Sbjct: 519 QLKP 522

>KLLA0E09526g complement(845298..846224) similar to sgd|S0003993
           Saccharomyces cerevisiae YLR003c, start by similarity
          Length = 308

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 624 LAYDICPNDP-LVLNEMGVMYFKKNEFVKAKKYLK-KALEVVKD----LDPSSRTTISIQ 677
           LA  I   +P L   E+  +YFKK +F+  +KY K ++L   +D       S R+ I  Q
Sbjct: 111 LATSIRDKNPDLSALELDELYFKKQDFLSTEKYEKDRSLNNFQDFIHTFSKSPRSIILSQ 170

Query: 678 LNL--GHTYRKLNENEIAIKCF 697
            N+     YR +N ++ A+K F
Sbjct: 171 SNIRVADVYRSVNGHQTAVKLF 192

>CAGL0J09570g complement(939447..941096) some similarities with
           sp|P35056 Saccharomyces cerevisiae YDR244w PAS10
           peroxisomal targeting signal receptor, hypothetical
           start
          Length = 549

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 28/70 (40%)

Query: 522 RLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQ 581
           +L E  PK  ITW  +     +  R   A + Y  +  L PSF  A      T    GE 
Sbjct: 416 KLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSFVRARYNLGSTLVKNGEL 475

Query: 582 DQALTAYSTA 591
            + + +  TA
Sbjct: 476 QRGIESLLTA 485

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 694 IKCFRCVLEKNDKNSEIHC--SLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLK-- 749
           I  F   L+++++   + C   LG + L+ ++ + A+D    +L L+P +  A  LL   
Sbjct: 273 ILAFEAALQEHEQQHMVDCWYRLGIVQLQNEQEESAMDAFQHALELEPGHLEALKLLAVS 332

Query: 750 -----NALELNVTLS 759
                NA+E  V LS
Sbjct: 333 HINQGNAVEATVCLS 347

>Scas_698.23
          Length = 698

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 627 DICPNDPLVLN--EMGVMYFKKNEFVKAKKYLKKALEVVK 664
           D  PND LV     +G  YF+  ++ KA K  +KA+E+ K
Sbjct: 3   DTLPNDSLVEKALSLGTTYFQSEKYTKAIKIFQKAIELTK 42

>ACR173W [1220] [Homologous to ScYJR088C - SH]
           complement(657718..658575) [858 bp, 285 aa]
          Length = 285

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 43/101 (42%)

Query: 652 AKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIH 711
           A KYLK  LE   + D  S   + +   L    R     E+ +K    +LEK   ++E+ 
Sbjct: 103 AAKYLKNLLEKQLEYDTDSVDYLQVGKKLIALERPALSTELWMKKLLSLLEKFPLDAELW 162

Query: 712 CSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNAL 752
            +L   Y K  +  +AI    + L + P   SA A L   L
Sbjct: 163 WTLAMEYYKLGQFDQAIYCFEEVLLISPLAYSAFAQLAEVL 203

>KLLA0D10329g join(872320..872335,872448..872896) highly similar to
           sp|Q04493 Saccharomyces cerevisiae YML094w GIM5 Gim
           complex component singleton, start by similarity
          Length = 154

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 477 CKFNECLELCETVLENDEFNTNILPAYIGCLYELSNK---NKLFLL 519
            KF EC++  +TV  +D  N N+L    G LY +S K   NK F++
Sbjct: 42  SKFKECIDDIKTVSRDDNANQNLLVPLSGSLY-VSGKIQDNKKFMV 86

>Scas_590.8
          Length = 762

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 34/79 (43%), Gaps = 2/79 (2%)

Query: 36  RVLMRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPW-NRTNTAT 94
           +V  R   SP    SQ      + PF SN      QQ +PT   N  L     +  NT T
Sbjct: 81  KVQRRRTSSPPVSQSQQKLKFQSGPFQSN-DKITLQQPIPTSKSNMSLTSNMLSPENTET 139

Query: 95  SPYQSLANSPLIQKLQANI 113
           SP ++L+ SP +     NI
Sbjct: 140 SPRRALSTSPQVPVSSTNI 158

>CAGL0M01914g 232780..234810 some similarities with sp|P14922
           Saccharomyces cerevisiae YBR112c CYC8, general repressor
           of transcription, hypothetical start
          Length = 676

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 16/76 (21%)

Query: 528 PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSF----------------AAAWLGF 571
           P     W SVA+ Y++L ++ ++   YS++  L  SF                A AW G 
Sbjct: 332 PNLPFIWISVASLYLTLGQLEDSLATYSQAISLAMSFENVLPPKELSYYKRFAAVAWHGI 391

Query: 572 AHTYALEGEQDQALTA 587
           +  Y +  +   A+ A
Sbjct: 392 SQVYTVTLQLTNAIEA 407

>YBR055C (PRP6) [245] chr2 complement(344562..347261) U4/U6.U5
           tri-snRNP-associated splicing factor, contains
           tetratricopeptide (TPR) repeats [2700 bp, 899 aa]
          Length = 899

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 75/195 (38%), Gaps = 36/195 (18%)

Query: 503 YIGCL-YELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILD 561
           Y+  L Y+  N+  +  L+ R  ++FP     +  +   Y S+  I  +++ Y   + L 
Sbjct: 639 YVNFLRYQDLNEEAIKFLNERCLKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTRLV 698

Query: 562 PSFAAAWLGFAHTYALE-----------------------------------GEQDQALT 586
           P+    W+  +    ++                                   G  DQA  
Sbjct: 699 PNCPLLWVSLSKIDEIDLKNPVRARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAEL 758

Query: 587 AYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKK 646
             + A + FP   L  +     F   N  +L ++ F  A     ND  VL E+GV ++ +
Sbjct: 759 LVTQALQKFPSNALLWVEQIKLFKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAE 818

Query: 647 NEFVKAKKYLKKALE 661
            ++  + K+L++AL+
Sbjct: 819 AQYETSLKWLERALK 833

>CAGL0D02882g complement(300025..302028) similar to sp|Q07084
           Saccharomyces cerevisiae YLR006c SSK1 two-component
           signal transducer, hypothetical start
          Length = 667

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 15/86 (17%)

Query: 29  SNLKSSNRVLMRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWN 88
           +NL +S+++L  +P S  EQ  Q N+              R+ Q+ P D QN R +   N
Sbjct: 99  TNLNTSDKILSHSPSSLKEQILQTNNN-------------RSPQNSPLDRQNYRTRWLAN 145

Query: 89  --RTNTATSPYQSLANSPLIQKLQAN 112
             R+N+A+  +QS+ N+ +   L +N
Sbjct: 146 HRRSNSASPTFQSIPNNRITPILNSN 171

>KLLA0D01155g complement(104847..105854) similar to sgd|S0005533
           Saccharomyces cerevisiae YOR007c SGT2, start by
           similarity
          Length = 335

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 525 ETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQD 582
           E  P +A+ + + A  Y SL +  +A K   ++  +DP+++  +  LGFA  YAL  + +
Sbjct: 123 EVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAK-YAL-NKPE 180

Query: 583 QALTAY 588
           +AL AY
Sbjct: 181 EALDAY 186

>Kwal_23.5408
          Length = 1410

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 528  PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEG--EQDQAL 585
            P+    W+ +A   +  + I  A+    KS  + P  ++ WLG A     EG  E+   L
Sbjct: 994  PRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEGLVEESSRL 1053

Query: 586  TAYS 589
             A+S
Sbjct: 1054 FAHS 1057

>CAGL0L12936g 1380327..1382129 similar to sp|P07213 Saccharomyces
           cerevisiae YNL121c TOM70 or sp|P38825 Saccharomyces
           cerevisiae YHR117w TOM7, hypothetical start
          Length = 600

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 8/107 (7%)

Query: 635 VLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAI 694
            L  +G+  F KN+   ++K LK+AL     L P   T I + L +        ++E   
Sbjct: 315 ALEYLGIFDFLKNDLDNSEKNLKEALA----LHPRVNTYIYLALTMADR----GQSEDYF 366

Query: 695 KCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNN 741
             F   +  +  N+ ++   G +Y  T+  +KA +   KS    P N
Sbjct: 367 SYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKN 413

>KLLA0B03520g 317409..321614 similar to sp|P17883 Saccharomyces
           cerevisiae YPR189w SKI3 antiviral protein singleton,
           start by similarity
          Length = 1401

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 643 YFKKNEFVKAKKYLKKALEVV----KDLDP---SSRTTISIQLNLGHTYRKLNENE-IAI 694
           Y   NEF  A  Y++     V    +DL     +S+   ++     +TY +  +N  IA+
Sbjct: 404 YVSHNEFQLAIPYIRSGTSAVAYATRDLGAWLKNSKFDFTLLYATTYTYFEAPKNHNIAL 463

Query: 695 KCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNN 741
             F  VL ++ KN++     G ++++ K  Q+A   L  ++   P+N
Sbjct: 464 SLFDKVLLEDPKNAQAKMGKGLIFIEMKNWQEACKFLKDAVVEFPDN 510

>YPR189W (SKI3) [5603] chr16 (912658..916956) Antiviral protein with
            tetratricopeptide (TPR) repeats, part of a system to
            protect cells from double-stranded RNA (dsRNA) viruses
            [4299 bp, 1432 aa]
          Length = 1432

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 528  PKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGE 580
            PK+  TWF++A   +       AQ+  +K   L P  ++ WLG A     +G+
Sbjct: 1016 PKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQGD 1068

>CAGL0E01573g complement(148847..151561) similar to sp|P42842
           Saccharomyces cerevisiae YNL313c, start by similarity
          Length = 904

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 11/52 (21%), Positives = 27/52 (51%)

Query: 533 TWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQA 584
           TW+      +  +++  A + +++ + LDP+ A +W   +  Y  +G+  +A
Sbjct: 635 TWYFYGCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEA 686

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 17/65 (26%)

Query: 251 YIADKVYNISNDPDDAF-------W----LGQVY------YNNNQYVRAVELITRNNLDG 293
           Y+ D + N+S DPD+ F       W    +G V+      Y N  +V+   +  + N+  
Sbjct: 94  YLHDYIVNLSKDPDETFLQFYVRRWKRFTIGAVFLNHAFDYMNRYWVQKERIDCKRNIFD 153

Query: 294 VNILC 298
           VN LC
Sbjct: 154 VNTLC 158

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,940,652
Number of extensions: 1124321
Number of successful extensions: 4730
Number of sequences better than 10.0: 109
Number of HSP's gapped: 4786
Number of HSP's successfully gapped: 167
Length of query: 826
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 716
Effective length of database: 12,788,129
Effective search space: 9156300364
Effective search space used: 9156300364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)