Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR094C (IME1)36035414780.0
CAGL0M09042g45239810.044
Scas_691.2d26558760.13
KLLA0E05918g21117740.21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR094C
         (354 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR094C (IME1) [2985] chr10 complement(604486..605568) Transcrip...   573   0.0  
CAGL0M09042g 901459..902817 weakly similar to sp|P21190 Saccharo...    36   0.044
Scas_691.2d                                                            34   0.13 
KLLA0E05918g 534222..534857 no similarity, hypothetical start          33   0.21 

>YJR094C (IME1) [2985] chr10 complement(604486..605568)
           Transcription factor required for sporulation, positive
           regulator of IME2 and many sporulation genes [1083 bp,
           360 aa]
          Length = 360

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/354 (83%), Positives = 294/354 (83%)

Query: 1   MQADMHGKLHAALEDGXXXXXXXXXXXXNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKS 60
           MQADMHGKLHAALEDG            NIYYDTTTDQEDRPCFSFGSTISPRSWHFEKS
Sbjct: 1   MQADMHGKLHAALEDGFFLFPFEQQQQPNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKS 60

Query: 61  DKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERG 120
           DKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERG
Sbjct: 61  DKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERG 120

Query: 121 KKXXXXXXXXXXXXXXXXXXXXXTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQ 180
           KK                     TFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQ
Sbjct: 121 KKSSESTRSSSLSSLFSNDESASTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQ 180

Query: 181 KDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTD 240
           KDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTD
Sbjct: 181 KDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTD 240

Query: 241 NIHSFNNRHYSNHKXXXXXXXXXXXXXXXASDNVYEADPFIDEPQVPSYYYPLEIAFDVE 300
           NIHSFNNRHYSNHK               ASDNVYEADPFIDEPQVPSYYYPLEIAFDVE
Sbjct: 241 NIHSFNNRHYSNHKSTNCNYYNNTSNNNNASDNVYEADPFIDEPQVPSYYYPLEIAFDVE 300

Query: 301 KSPPPSLQKLNSKELEFLKKLNSKLXXXXXXXXXXXXNDQDYYDKVRFQEISYK 354
           KSPPPSLQKLNSKELEFLKKLNSKL            NDQDYYDKVRFQEISYK
Sbjct: 301 KSPPPSLQKLNSKELEFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISYK 354

>CAGL0M09042g 901459..902817 weakly similar to sp|P21190
           Saccharomyces cerevisiae YJR094c IME1 transcription
           factor required for sporulation, hypothetical start
          Length = 452

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 21/39 (53%)

Query: 316 EFLKKLNSKLXXXXXXXXXXXXNDQDYYDKVRFQEISYK 354
           EF   L SKL             +Q+YYDKVRFQEI YK
Sbjct: 408 EFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILYK 446

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 50  ISPRSWHFEKSDKIASSQLQNLVHTQPIHLINPQIL 85
           +SP   +F KS    S     ++HTQP  LINP+IL
Sbjct: 196 VSP---NFSKSTNYTSKLPIEIIHTQPHKLINPKIL 228

>Scas_691.2d
          Length = 265

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 14/58 (24%)

Query: 311 NSKELEFLKKLNSKLXXXXXX--------------XXXXXXNDQDYYDKVRFQEISYK 354
           N++E EFLK+L+ KL                           +Q+Y+DKVRFQEIS+K
Sbjct: 202 NTQEFEFLKQLHMKLARYTTKPTTNYLYCNPDPNKCQLQLSLEQEYFDKVRFQEISFK 259

>KLLA0E05918g 534222..534857 no similarity, hypothetical start
          Length = 211

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 15/17 (88%)

Query: 338 NDQDYYDKVRFQEISYK 354
           ND DY+DK+RFQEI YK
Sbjct: 189 NDLDYFDKIRFQEIDYK 205

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,784,334
Number of extensions: 526021
Number of successful extensions: 1517
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1508
Number of HSP's successfully gapped: 31
Length of query: 354
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 251
Effective length of database: 13,030,455
Effective search space: 3270644205
Effective search space used: 3270644205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)