Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR091C (JSN1)1091106346960.0
Scas_674.271067107626160.0
CAGL0M09108g110992425070.0
Kwal_33.143951076110623600.0
AGL305W1057109223300.0
KLLA0E05984g109496323240.0
Scas_672.26*107966115570.0
YPR042C (PUF2)107538711421e-138
CAGL0H08778g106539411001e-132
Scas_7.12472336852e-82
YGL014W (PUF4)8882042046e-16
AGL086C7352042029e-16
Kwal_47.175117072421931e-14
Scas_688.28282361903e-14
Scas_688.288312491823e-13
YLL013C (PUF3)8792531752e-12
Scas_707.378132651752e-12
CAGL0A00473g7862041742e-12
Sklu_2097.27873041715e-12
ADL056W8072691707e-12
KLLA0F15477g9303091681e-11
AAL152W7873041662e-11
CAGL0L05962g8972411582e-10
KLLA0A09097g8052351563e-10
Kwal_33.151137582791545e-10
CAGL0D05544g9112291529e-10
Kwal_20.27293891741435e-09
Sklu_2033.27442291448e-09
YGL178W (MPT5)8591351341e-07
KLLA0E13629g8222231313e-07
Scas_621.1041561930.007
YGR159C (NSR1)41477900.016
CAGL0E03245g425116870.033
AFR107W39680860.043
CAGL0H04763g383100820.14
KLLA0C11495g44551810.16
Sklu_1706.167251810.21
Sklu_2182.337170790.30
Sklu_1879.442161780.38
Scas_611.1210246720.48
KLLA0C12331g662111780.49
YDR432W (NPL3)41466760.63
CAGL0H10604g41670750.87
CAGL0C01419g63948751.0
Kwal_47.1857236378722.3
KLLA0C17600g59297722.3
CAGL0D05236g44327712.8
Kwal_27.1115856763712.9
Scas_700.545037704.4
YBL051C (PIN4)66840686.5
KLLA0E22726g103369679.5
Sklu_2238.351992679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR091C
         (1072 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR091C (JSN1) [2982] chr10 complement(594975..598250) Protein t...  1813   0.0  
Scas_674.27                                                          1012   0.0  
CAGL0M09108g 910473..913802 similar to sp|P47135 Saccharomyces c...   970   0.0  
Kwal_33.14395                                                         913   0.0  
AGL305W [4007] [Homologous to ScYJR091C (JSN1) - SH; ScYPR042C (...   902   0.0  
KLLA0E05984g 541992..545276 similar to sp|P47135 Saccharomyces c...   899   0.0  
Scas_672.26*                                                          604   0.0  
YPR042C (PUF2) [5475] chr16 complement(650430..653657) Protein t...   444   e-138
CAGL0H08778g 854147..857344 some similarities with tr|Q12221 Sac...   428   e-132
Scas_7.1                                                              268   2e-82
YGL014W (PUF4) [1959] chr7 (466144..468810) Protein with pumilio...    83   6e-16
AGL086C [4225] [Homologous to ScYGL014W (PUF4) - SH] (543176..54...    82   9e-16
Kwal_47.17511                                                          79   1e-14
Scas_688.2                                                             78   3e-14
Scas_688.28                                                            75   3e-13
YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein i...    72   2e-12
Scas_707.37                                                            72   2e-12
CAGL0A00473g complement(51137..53497) similar to sp|P25339 Sacch...    72   2e-12
Sklu_2097.2 YLL013C, Contig c2097 4468-6831                            70   5e-12
ADL056W [1685] [Homologous to ScYGL178W (MPT5) - SH] complement(...    70   7e-12
KLLA0F15477g complement(1429123..1431915) some similarities with...    69   1e-11
AAL152W [35] [Homologous to ScYLL013C (PUF3) - SH] complement(77...    69   2e-11
CAGL0L05962g complement(662298..664991) similar to sp|P39016 Sac...    65   2e-10
KLLA0A09097g 794827..797244 some similarities with sp|P25339 Sac...    65   3e-10
Kwal_33.15113                                                          64   5e-10
CAGL0D05544g complement(527482..530217) similar to tr|Q07807 Sac...    63   9e-10
Kwal_20.2729                                                           60   5e-09
Sklu_2033.2 YGL178W, Contig c2033 2461-4695                            60   8e-09
YGL178W (MPT5) [1813] chr7 (167356..167358,167999..170575) Prote...    56   1e-07
KLLA0E13629g complement(1201715..1204183) some similarities with...    55   3e-07
Scas_621.10                                                            40   0.007
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    39   0.016
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    38   0.033
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    38   0.043
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    36   0.14 
KLLA0C11495g complement(990832..992169) some similarities with s...    36   0.16 
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                            36   0.21 
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            35   0.30 
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         35   0.38 
Scas_611.12                                                            32   0.48 
KLLA0C12331g 1049113..1051101 similar to sgd|S0002904 Saccharomy...    35   0.49 
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    34   0.63 
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    33   0.87 
CAGL0C01419g complement(153063..154982) similar to sp|Q08925 Sac...    33   1.0  
Kwal_47.18572                                                          32   2.3  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...    32   2.3  
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    32   2.8  
Kwal_27.11158                                                          32   2.9  
Scas_700.5                                                             32   4.4  
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    31   6.5  
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...    30   9.5  
Sklu_2238.3 YKR016W, Contig c2238 5850-7409                            30   9.8  

>YJR091C (JSN1) [2982] chr10 complement(594975..598250) Protein that
            when overproduced can suppress the hyperstable
            microtubule phenotype of tub2-150 [3276 bp, 1091 aa]
          Length = 1091

 Score = 1813 bits (4696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/1063 (85%), Positives = 907/1063 (85%)

Query: 1    MDKSKQMNINNLSNIPEVIDPGITIPIXXXXXXXXXXXXXQLQQQPQKLGSYRSRAGKFS 60
            MDKSKQMNINNLSNIPEVIDPGITIPI             QLQQQPQKLGSYRSRAGKFS
Sbjct: 1    MDKSKQMNINNLSNIPEVIDPGITIPIYEEEYENNGESNSQLQQQPQKLGSYRSRAGKFS 60

Query: 61   NTLSNLLPSISAKLHHSKKNSHGKNGAEFXXXXXXXXXTVASKTPRASPSRSKMMESSID 120
            NTLSNLLPSISAKLHHSKKNSHGKNGAEF         TVASKTPRASPSRSKMMESSID
Sbjct: 61   NTLSNLLPSISAKLHHSKKNSHGKNGAEFSSSNNSSQSTVASKTPRASPSRSKMMESSID 120

Query: 121  GVTMDRPGSLTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFNLPHQISRTRNNTMXXXXX 180
            GVTMDRPGSLTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFNLPHQISRTRNNTM     
Sbjct: 121  GVTMDRPGSLTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFNLPHQISRTRNNTMSSQIT 180

Query: 181  XXXXXAPKPRTSSGIWSSNASANDPMXXXXXXXXXXXXXXXXXXXXXXXDYSTKTAYFDN 240
                 APKPRTSSGIWSSNASANDPM                       DYSTKTAYFDN
Sbjct: 181  SISSIAPKPRTSSGIWSSNASANDPMQQHLLQQLQPTTSNNTTNSNTLNDYSTKTAYFDN 240

Query: 241  MVSTSGSQMADNKMNTNNLAIPNSVWSNTRQRSQSNASSIYTDAPLYEQPARASISSHYT 300
            MVSTSGSQMADNKMNTNNLAIPNSVWSNTRQRSQSNASSIYTDAPLYEQPARASISSHYT
Sbjct: 241  MVSTSGSQMADNKMNTNNLAIPNSVWSNTRQRSQSNASSIYTDAPLYEQPARASISSHYT 300

Query: 301  IPTQESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNVFPLQHQQPQLNNA 360
            IPTQESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNVFPLQHQQPQLNNA
Sbjct: 301  IPTQESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNVFPLQHQQPQLNNA 360

Query: 361  INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSK 420
            INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSK
Sbjct: 361  INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSK 420

Query: 421  ISFAKILPMHQQPPQFLLNSXXXXXXXXXXXXXXXXXXXXXXFNGAVTFQQQGNVSIPVF 480
            ISFAKILPMHQQPPQFLLNS                      FNGAVTFQQQGNVSIPVF
Sbjct: 421  ISFAKILPMHQQPPQFLLNSQGLPLGLENNNLQPQPLLQEQLFNGAVTFQQQGNVSIPVF 480

Query: 481  XXXXXXXXXXXXXXGSAGFSNVLHGYXXXXXXXXXXXXXXXEKEQCPFPLPPPNVNEKED 540
                          GSAGFSNVLHGY               EKEQCPFPLPPPNVNEKED
Sbjct: 481  NQQSQQSQHQNHSSGSAGFSNVLHGYNNNNSMHGNNNNSANEKEQCPFPLPPPNVNEKED 540

Query: 541  LLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKS 600
            LLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKS
Sbjct: 541  LLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKS 600

Query: 601  IDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTS 660
            IDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTS
Sbjct: 601  IDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTS 660

Query: 661  MGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQ 720
            MGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQ
Sbjct: 661  MGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQ 720

Query: 721  FIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGAL 780
            FIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGAL
Sbjct: 721  FIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGAL 780

Query: 781  LVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLF 840
            LVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLF
Sbjct: 781  LVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLF 840

Query: 841  GNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQ 900
            GNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQ
Sbjct: 841  GNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQ 900

Query: 901  PSRRLLEEVGLASPXXXXXXXXXXXXXXXXXXXXXMFATPDTSGQHMRGLXXXXXXXXXX 960
            PSRRLLEEVGLASP                     MFATPDTSGQHMRGL          
Sbjct: 901  PSRRLLEEVGLASPSSTHNKTKQQQQQHHNSSISHMFATPDTSGQHMRGLSVSSVKSGGS 960

Query: 961  XXXXXXXXXXXXXXXXXXXPGQPLNANSNSSMGYFSYPGVFPVSGFSGNASNGYAMNNDD 1020
                               PGQPLNANSNSSMGYFSYPGVFPVSGFSGNASNGYAMNNDD
Sbjct: 961  KHTTMNTTTTNGSSASTLSPGQPLNANSNSSMGYFSYPGVFPVSGFSGNASNGYAMNNDD 1020

Query: 1021 LSSQFDMLNFNNGTRLSLPQLSLTNHNNTTMELVNNVGSSQPH 1063
            LSSQFDMLNFNNGTRLSLPQLSLTNHNNTTMELVNNVGSSQPH
Sbjct: 1021 LSSQFDMLNFNNGTRLSLPQLSLTNHNNTTMELVNNVGSSQPH 1063

>Scas_674.27
          Length = 1067

 Score = 1012 bits (2616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1076 (52%), Positives = 698/1076 (64%), Gaps = 63/1076 (5%)

Query: 1    MDKSKQMNINN--LSNIPEVIDPGITIPIXXXXXXXXXXXXXQLQQQPQKLGSYRSRAGK 58
            M++ +  + NN  L NIPEVIDPGITIPI                QQ QKLGSYR+RAGK
Sbjct: 1    MEEKRTPSANNGLLHNIPEVIDPGITIPIYDDDELDT--------QQTQKLGSYRARAGK 52

Query: 59   FSNTLSNLLPSISAKLHHSKKNS--HGKNGAEFXXXXXXXXXTVASKTPRASPSRSKMME 116
            FSNTLSNLLPSISAKLHHSKKN   HGKNG EF         TV  K  + SP +     
Sbjct: 53   FSNTLSNLLPSISAKLHHSKKNGTVHGKNG-EFSPTNSSSGSTVDLKAQQVSPLKPM--- 108

Query: 117  SSIDGVTMDRPGSLTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFNLPHQISRTRNNTMX 176
             +    T      LTPPQ+  KLVHFPD++N  L P PR S+DSF    Q +R+RNNT+ 
Sbjct: 109  KNFTATTTGNLSDLTPPQENGKLVHFPDTTNYMLNP-PRSSNDSF----QFNRSRNNTVS 163

Query: 177  XXXXXXXXXAPKPRTSSG-IWSSNASANDPMXXXXXXXXXXXXXXXXXXXXXXXDYSTKT 235
                      P  +T++  +W+S   +N P                        + +T T
Sbjct: 164  SQITSLSSLQPNTQTNANNLWTS--VSNPPEAMQQQQMLQQFNSNNNPNILGMSNLNTIT 221

Query: 236  ---AYFDNMVSTSGSQMADNKMNTNNLAIPNS-VWSNTRQRSQSNASSIYTDAPLYEQPA 291
               +Y++  +S   S+  +N      L +P+S VW N RQRS SN SS+Y DA  Y+Q A
Sbjct: 222  PVPSYYEPSLSQQKSETLNNT-----LTVPSSNVWGNNRQRSHSNTSSLYVDAQFYDQEA 276

Query: 292  RASISSHYTIP----TQESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNV 347
            R+  +S YTI     +QE P + DE+DP++INWV+M+ TVP+INQI+NLLPTNTI+ISNV
Sbjct: 277  RSRATSSYTISQQPLSQEFPSVGDEVDPRAINWVSMETTVPTINQINNLLPTNTITISNV 336

Query: 348  FPLQHQQPQLNNAINLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSL 407
            FPLQ QQPQLNN INLTSTSLATLCSKYGEVIS+RT + LN+ALVEF++VESA++A   L
Sbjct: 337  FPLQQQQPQLNNTINLTSTSLATLCSKYGEVISSRTFKGLNIALVEFANVESAMRAKQDL 396

Query: 408  QGKEVSMIGAPSKISFAKILPMHQQPPQF-LLNSXXXXXXXXXXXXXXXXXXXXXXFNGA 466
            QGK+VS+IG PS +SFAKILPMH     F                           +NG+
Sbjct: 397  QGKDVSVIGTPSNVSFAKILPMHH----FNQQQQQLQQSRTADQSQQPQPLLQEQLYNGS 452

Query: 467  VTFQQQGNVSIPVFXXXXXXXXXXXXXXGSAG--FSNVLHG--YXXXXXXXXXXXXXXXE 522
            VTFQQQGNVS+PVF               S G  +S   H   +               E
Sbjct: 453  VTFQQQGNVSVPVFKQYSQYQQPFVNVSNSTGNTYSYPTHATSHGGSSSNGGTATTATNE 512

Query: 523  KEQCPFPLPPPNVNEKEDLLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPE 582
            KEQCPFPLPPP ++ ++  L +II  F+  +D  Q+ +LI   +N+KGT+DT NFGPLPE
Sbjct: 513  KEQCPFPLPPPKLSTQKSKLEDIIHSFDTKADRLQLEALINNGINYKGTNDTMNFGPLPE 572

Query: 583  PLSGREFDPPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHS 642
            PL+ ++FD PKLRELRK+ID+N  SDLE+EQLA+ MLDELPELSSDYLGNTIVQKLFE S
Sbjct: 573  PLTSKDFDAPKLRELRKNIDANTVSDLELEQLALCMLDELPELSSDYLGNTIVQKLFEKS 632

Query: 643  SDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQ 702
            SDI+KDIMLRKTSKYLTSMGVHKNGTWACQKMITMA TPRQI  V++GV DYCTPL NDQ
Sbjct: 633  SDIVKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAKTPRQIKLVSEGVNDYCTPLFNDQ 692

Query: 703  FGNYVIQCVLKFGFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLS 762
            FGNYVIQCVLKFGFPWN FIF+SII+NFW++VQNRYGARAVRACLEAHDIVT EQ++VLS
Sbjct: 693  FGNYVIQCVLKFGFPWNDFIFQSIISNFWIVVQNRYGARAVRACLEAHDIVTTEQTLVLS 752

Query: 763  AMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKV 822
            AMIV Y+EYL++N+NG LL+TWFLDT VLPNRHSILA RL   IV+LC HRLASLT+LK+
Sbjct: 753  AMIVCYSEYLASNNNGTLLLTWFLDTCVLPNRHSILAKRLLPNIVDLCRHRLASLTVLKI 812

Query: 823  LNYRGDDNARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLR 882
            LNYRGDD ARKI+ + +FG +++ +  PPK LT++L + NYGPTF++K+L+MPLLED++R
Sbjct: 813  LNYRGDDEARKILFEEIFGKLDSKE--PPKVLTQILTDANYGPTFIYKILSMPLLEDEIR 870

Query: 883  AHIIKQVRKVLTD-STQIQPSRRLLEEVGLA--SPXXXXXXXXXXXXXXXXXXXXXMFAT 939
            +H+IKQVRK+L +     Q  RRL+EEVGLA  S                      ++  
Sbjct: 871  SHVIKQVRKILMEHGLSQQQHRRLMEEVGLAPTSASMQQGGGGSGSHRKSSLSHLGVYNP 930

Query: 940  PDTSGQHMRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPG---------QPLNANSNS 990
             D +  HMRG+                                        QP+N  S +
Sbjct: 931  ADANPSHMRGMSVSSVRSNGSRHNTQVPIPQGAIQQQQSQQQPVPIPSIVQQPMNNASTN 990

Query: 991  SM--GYFSYPGVFPVSGFSGNASNG-YAMNNDDLSSQFDMLNFNNGTRLSLPQLSL 1043
            S+  GY++YPG+FP S       NG Y MN DDLSSQFDML  NNGT LSLPQLS+
Sbjct: 991  SINAGYYNYPGMFPGSFGPPTGMNGAYPMNTDDLSSQFDMLALNNGTHLSLPQLSV 1046

>CAGL0M09108g 910473..913802 similar to sp|P47135 Saccharomyces
           cerevisiae YJR091c suppresses the high-temperature
           lethality of TUB2-150, hypothetical start
          Length = 1109

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/924 (57%), Positives = 618/924 (66%), Gaps = 63/924 (6%)

Query: 12  LSNIPEVIDPGITIPIXXXXXXXXXXXXXQLQQQPQKLGSYRSRAGKFSNTLSNLLPSIS 71
            +NIPEVIDPGITIPI                +QPQKLGSYR+RAGKFSNTLSNLLPSIS
Sbjct: 5   FTNIPEVIDPGITIPIFEEDVDAMSL------EQPQKLGSYRARAGKFSNTLSNLLPSIS 58

Query: 72  AKLHHSKKNSHGKNGAEFXXXXXXXXXTVASKTPRASP----SRSKMMESSIDGVTMD-- 125
           AKLHHSKK   G                + + + ++S     +  + M S    V  D  
Sbjct: 59  AKLHHSKKQGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNTDQGMPSMTAAVAADMG 118

Query: 126 --RPGSL-------------TPPQDMEKLVHFPDSSNNFLIPAPRGSSDSF--NLPHQIS 168
             RP  +             TPP+D +KLVHFP+S+  +LI  PR S+DSF  NLP QIS
Sbjct: 119 PPRPAHVEGFSARGAAQDNTTPPRDADKLVHFPESTE-YLISRPRTSNDSFGNNLPRQIS 177

Query: 169 RTRNNTMXXXXXXXXXXAPKPRTSSGIWSSNASANDPMXXXXXXXXXXXXXXX-XXXXXX 227
           RTRNNTM           PKP  ++ +W++N + N                         
Sbjct: 178 RTRNNTMSSQITSISSIVPKPLPNT-VWNNNDTVNQQYQQQQQQQQQQQQQMVPQINTYN 236

Query: 228 XXDYSTKTAYFDNMVSTSGSQMADNKMNTNNLAIPNSVWSNTRQRSQSNASSIYTDAPLY 287
             D   +  Y D M         + +M  NNL + N+ W++ R RS SNASSIYTDAP Y
Sbjct: 237 AMDMGQQPNYGDTM---------NQQMGGNNLTV-NNAWNSNRPRSHSNASSIYTDAPQY 286

Query: 288 EQPARASISSHYTIPTQESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNV 347
           +   R+  +S Y       PL+ADE+DP+S+NWVT D  VP INQISNLLPTNTISISNV
Sbjct: 287 DTVGRSRAASSYAHGNSNIPLVADEVDPRSLNWVTTDLLVPPINQISNLLPTNTISISNV 346

Query: 348 FPLQHQQPQLNNAINLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSL 407
           FPLQ QQP LNNAINLTS SLATLCSKYGEVISARTLR +NMALVEF SV+SA++ALD+L
Sbjct: 347 FPLQQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVEFDSVDSAIRALDAL 406

Query: 408 QGKEVSMIGAPSKISFAKILPMHQQPPQFLLNSXXXXXXXXXXXXXXXXXXXXXXFNGAV 467
           QGKEVSMIGAPSK+SFAKILPMH Q                               NGAV
Sbjct: 407 QGKEVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVSQPLLQEQLN---NGAV 463

Query: 468 TFQQQGNVSIPVFXXXXXXXXXXXXXXGSAGFSNVLHGYXXXXXXXXXXXXXXXEKEQCP 527
           TF QQGN+SIPVF                  +SN  +                 +KEQCP
Sbjct: 464 TFHQQGNISIPVFNQNQ--------------YSNGQN--TNNNASSHPGTSSSSDKEQCP 507

Query: 528 FPLPPPNVNEKEDLLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPEPLSGR 587
           FPLPPP ++ K+  L +++  F ++ DE Q+ SLI  SL  K TSD  NFGPLP  +S +
Sbjct: 508 FPLPPPPLSGKKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSNK 567

Query: 588 EFDPPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIK 647
           +FD PKLRELRK+IDSN+ SD+EIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIK
Sbjct: 568 QFDAPKLRELRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIK 627

Query: 648 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYV 707
           DIMLRKT KYL SMGVHKNGTWACQK+IT A TPRQI  VT G+KDYCT L NDQFGNYV
Sbjct: 628 DIMLRKTGKYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQFGNYV 687

Query: 708 IQCVLKFGFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVT 767
           IQCVLKFG+PWN FIFESI++NFW IVQNRYGARAVRACLEAHDIVT EQ++VLSAMIV 
Sbjct: 688 IQCVLKFGYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLVLSAMIVI 747

Query: 768 YAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRG 827
           YAEYL+TNSNG LLVTWFLDT VL NRHSILAPRL   IV+LC HRLASLTILK+LNYRG
Sbjct: 748 YAEYLTTNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLTILKILNYRG 807

Query: 828 DDNARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIK 887
           DD ARK IL+++FGN    +  P + L ++LC+ NYGPTFV+KVL+MPLLEDD+R HII 
Sbjct: 808 DDAARKTILNTVFGNCETDE--PQQILYQILCDVNYGPTFVYKVLSMPLLEDDIRIHIIA 865

Query: 888 QVRKVLTDSTQIQPSRRLLEEVGL 911
           QVRK+L +S   Q  RRL+EEVGL
Sbjct: 866 QVRKILMESNTAQHHRRLMEEVGL 889

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 984  LNANSNSSMGYFSYPGVFPVSGFSGNASNGYAMNNDDLSSQFDMLNFNNGTRLSLPQLSL 1043
            + +N N++M Y +YPGVFP+   + N+S G    NDDL S+ DML   NGT LSLPQLS+
Sbjct: 995  VGSNQNNAMSYMNYPGVFPMGYPNNNSSYGI---NDDLVSKLDMLTLGNGTHLSLPQLSV 1051

Query: 1044 TNH 1046
            TNH
Sbjct: 1052 TNH 1054

>Kwal_33.14395
          Length = 1076

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1106 (47%), Positives = 665/1106 (60%), Gaps = 125/1106 (11%)

Query: 1    MDKSKQMNINNLSNIPEVIDPGITIPIXXXXXXXXXXXXXQLQQQPQKLGSYRSRAGKFS 60
            M+K+K     +L+ IPE IDPGI +P+                 QPQKLGSYR RAG+FS
Sbjct: 1    MEKAKPSQKQSLTQIPEAIDPGIILPLYEEELHSNDPS------QPQKLGSYRVRAGRFS 54

Query: 61   NTLSNLLPSISAKLHHSKKNSHGKNGAEFXXXXXXXXXTVASKTPRASPSRSKMMESSID 120
            NTLSNLLPSISAKLHHS+K + G                 +   P A+ S S   ++S  
Sbjct: 55   NTLSNLLPSISAKLHHSRKTTSG----------------TSKHAPDAALSGSSSEDASRS 98

Query: 121  GVTMDRPGSLTPPQ-------DMEKLVH-FPDSSNNFLIP-APRGSSDSFNLP------- 164
             +++ R   +TPP+       D  +L    P+ +++F  P   R S DSF+         
Sbjct: 99   QISLSR--QITPPEATALSSVDSSQLGGPLPEDTSSFFAPLGARNSGDSFSFSAANNGIH 156

Query: 165  --HQISRTRNNTMXXXXXXXXXXAPKPRTSSGIWSSNASANDPMXXXXXXXXXXXXXXXX 222
              + +SRTRNNT+             P+T+  +WS+N S N+                  
Sbjct: 157  PSNPLSRTRNNTVSSQVTSLSGM---PQTAGSLWSTNTSPNE---QHVLSSTNAMNTASF 210

Query: 223  XXXXXXXDYSTKTAYFDNMVSTSGSQMADNKMNTNNLAIP----NSVWSNTRQRSQSNAS 278
                   +YS+ T YFD  V T G    +   N+++L +P     ++W   RQRS SNAS
Sbjct: 211  SAASPVNEYSSNT-YFD--VKTVG----NPPNNSSSLTVPAPANGNIWG-ARQRSHSNAS 262

Query: 279  SIYTDAPLYEQ----PARASI-----------------SSHYTIPTQESPLIADEIDPQS 317
            SIYTDAP+Y+      +RAS                  +  ++ PT   P +AD+IDP+S
Sbjct: 263  SIYTDAPVYDNIGVNRSRASTFGLGLDQPQIILNNAPPARQHSPPT---PAVADDIDPRS 319

Query: 318  INWVTMDPTVPSINQISNLLPTNTISISNVFPLQHQQPQLNNAINLTSTSLATLCSKYGE 377
            INWVT DPTVP+INQIS LLPTNT+SISNV+ LQ QQPQL+NAINLTSTSLATLC K+G 
Sbjct: 320  INWVTTDPTVPAINQISTLLPTNTVSISNVYSLQQQQPQLSNAINLTSTSLATLCLKFGN 379

Query: 378  VISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKILPMHQQPPQFL 437
            VISARTL+ +NMA+VEF SVESA++A ++L GKEVS++GAPS +SFAK+LPMHQQP    
Sbjct: 380  VISARTLKRINMAIVEFDSVESAMRAKEALHGKEVSLVGAPSCVSFAKVLPMHQQP---- 435

Query: 438  LNSXXXXXXXXXXXXXXXXXXXXXXFNGAVTFQQQGNVSIPVFXXXXXXXXXXXXXXGSA 497
              S                      +NGAVT QQQGN+S+PV                  
Sbjct: 436  -MSSNQPIASGPGVSGPQSLLQEQLYNGAVTLQQQGNISVPVLGGCTRSQQQQPQMQNLQ 494

Query: 498  GFSNVLH----GYXXXXXXXXXXXXXXXEKEQCPFPLPPPNVNEKEDLLREIIELFEANS 553
               +  H    G                EKE CPFPLPPP V+E    L + +  F  + 
Sbjct: 495  QNVSSSHSTNTGANHSTANQNSSSHSTAEKEHCPFPLPPPRVSEYTQALEDTVNSFGTSH 554

Query: 554  DEYQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQ 613
            D  Q   ++  ++   GTSDT +FGPLP+PL  REFD PKLRE+RK+ID N  ++LEIEQ
Sbjct: 555  DSTQTRHVVNNAIKCSGTSDTADFGPLPDPLPNREFDAPKLREIRKAIDGNMMTELEIEQ 614

Query: 614  LAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQK 673
            LAI MLDELPEL SDYLGNTI QKLFEHSS +IKDIMLR+T+ +LTSMGVHKNGTWACQK
Sbjct: 615  LAITMLDELPELCSDYLGNTIAQKLFEHSSTVIKDIMLRQTNTFLTSMGVHKNGTWACQK 674

Query: 674  MITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESIIANFWVI 733
            +ITMA TPRQ   V +GV+ YCTPL NDQFGNYVIQCVLKFGFPWN FIFE II+NFW I
Sbjct: 675  IITMADTPRQKALVAKGVEKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFEHIISNFWTI 734

Query: 734  VQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPN 793
             QNRYGARAVRACLEAHDI+T EQ +VLSAMIV Y+EYL+TNSNGALLVTWFLDT  LP+
Sbjct: 735  AQNRYGARAVRACLEAHDIITREQLLVLSAMIVLYSEYLATNSNGALLVTWFLDTCTLPH 794

Query: 794  RHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLFGNVNAHDSSPPKE 853
            RH+ILAP+L   + ELC HRLASLT+LK+LNYRGD+ A++ IL+SLFG  +  +++ P+ 
Sbjct: 795  RHTILAPKLVSNLAELCCHRLASLTVLKLLNYRGDEKAKRFILESLFGKKD--NTTVPQI 852

Query: 854  LTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQPSRRLLEEVGLAS 913
            L ++L ++NYGPTFV+KVL+M LLE D+R H+++QVRKVL + T  Q  RRL++EVGL  
Sbjct: 853  LYQVLSDSNYGPTFVYKVLSMSLLEGDIRVHVVQQVRKVLMEITTSQNHRRLMDEVGLGG 912

Query: 914  PXXXXXXXXXXXXXXXXXXXXXMFATPDTSGQHMRGLXXXXXXXXXXXXXXXXXXXXXXX 973
                                       D +G HMR +                       
Sbjct: 913  GAVSSTVTNSSSTGSKHRPSISHVFNMDNTG-HMRNVSVGSAMSGGSRPRALSNSGLS-- 969

Query: 974  XXXXXXPGQPL-NANSNSSM---------------GYFSYPGVFPVSGFSGNASNGYAMN 1017
                     PL N N+N  +               GY++YPGVFPVS    +++ GY++N
Sbjct: 970  -------AMPLSNPNTNGIVSGQVPPQAQQMAVPGGYYNYPGVFPVS----SSNRGYSVN 1018

Query: 1018 NDDLSSQFDMLNFNNGTRLSLPQLSL 1043
             DDL+SQF+ML   N T++SLPQLS+
Sbjct: 1019 GDDLASQFEMLGLQNNTQISLPQLSM 1044

>AGL305W [4007] [Homologous to ScYJR091C (JSN1) - SH; ScYPR042C (PUF2)
            - SH] complement(128699..131872) [3174 bp, 1057 aa]
          Length = 1057

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1092 (47%), Positives = 658/1092 (60%), Gaps = 131/1092 (11%)

Query: 10   NNLSNIPEVIDPGITIPIXXXXXXXXXXXXXQLQQQPQKLGSYRSRAGKFSNTLSNLLPS 69
            ++LS IPEVIDPGIT+PI              +  QPQKLGSYR+RAG+FSNTLSNLLPS
Sbjct: 34   HSLSKIPEVIDPGITVPIYEEDIVGDQGGT-DVDGQPQKLGSYRARAGRFSNTLSNLLPS 92

Query: 70   ISAKLHHSKKNSHGKNGAEFXXXXXXXXXTVASKTPRASPSRSKMMESSIDGVTMDRPGS 129
            ISAKLHH++K   GK              TV                     V  +  GS
Sbjct: 93   ISAKLHHNRKGGTGKVAPSAADADAGAGSTV---------------------VAGEMAGS 131

Query: 130  LTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFN------------LPHQISRTRNNTMXX 177
            +TPPQD+  +V FP+    + +  PR SS+S+             + +  +RTRNNT+  
Sbjct: 132  ITPPQDLHNVVSFPEP---YGLAQPRTSSESYTYGSGYSGHLQPTVSNPATRTRNNTVSS 188

Query: 178  XXXXXXXXAP--KPRTSSGIWSSNASA-NDPMXXXXXXXXXXXXXXXXXXXXXXXDYSTK 234
                         P TS+ IW++N S   DP+                       D+  +
Sbjct: 189  QITSLSSMGQLGTPSTSN-IWTNNGSGPADPISNMLTTQFNPIPLP---------DFG-Q 237

Query: 235  TAYFDNMVSTSGSQMADNKMNTNNLAIP---NSVWSNTRQRSQSNASSIYTDAPLYEQ-- 289
            + Y+D +      Q      +TN+L +P   N  W   R RSQSNASSIY DA L++   
Sbjct: 238  SNYYDVITQQQPPQ------STNSLNVPSGGNIFWEK-RTRSQSNASSIYADA-LFDTSG 289

Query: 290  -----PAR------ASISSHYTI--------PTQESPLIADEIDPQSINWVTMDPTVPSI 330
                 P R      AS ++H  +        P    P++ DE+DP+S+NWV+ DPTVP I
Sbjct: 290  MQQAPPTRSRASTFASTTAHQNMLNTPVMSAPLSAGPIVQDEVDPRSLNWVSTDPTVPPI 349

Query: 331  NQISNLLPTNTISISNVFPLQHQQPQLNNAINLTSTSLATLCSKYGEVISARTLRNLNMA 390
            NQIS+LLP+NTISISN+FPLQ QQP  +NA+NLTSTSLATLC  +G+V+SARTL+ +NMA
Sbjct: 350  NQISHLLPSNTISISNIFPLQQQQPHFSNAVNLTSTSLATLCLNFGKVLSARTLKTVNMA 409

Query: 391  LVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKILPMHQQP------------PQFLL 438
            +VEF +V++A++A D+L GK+VS++GAPS + FAK+LPMHQQ             PQ LL
Sbjct: 410  IVEFETVDAAMRAKDALNGKDVSLVGAPSAVFFAKVLPMHQQASTLPPIQTNPNGPQSLL 469

Query: 439  NSXXXXXXXXXXXXXXXXXXXXXXFNGAVTFQQQGNVSIPVFXXXXXXXXXXXXXXGSAG 498
                                    F+GAVTF QQ  +SIPVF               S  
Sbjct: 470  QEQL--------------------FSGAVTFHQQNGISIPVFNASGAGSQHHLASQQSQS 509

Query: 499  FSNVLHGYXXXXXXXXXXXXXXXEKEQCPFPLPPPNVNEKEDLLREIIELFEANSDEYQI 558
             S+V   +               EKE CPFP+PP ++ ++  LL +II  F    D+ Q+
Sbjct: 510  QSHVTK-HPNLTHSFTSLSHTPSEKEHCPFPMPPADIKDQVSLLIDIIRSFGVEHDQDQV 568

Query: 559  NSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQLAIAM 618
              ++  ++ + GTSDT +FGPLPEPL  REFD PKLRELRK +D++  SDLEIEQLA+AM
Sbjct: 569  QHIVSDAIAYNGTSDTADFGPLPEPLPHREFDAPKLRELRKLMDTDNVSDLEIEQLAVAM 628

Query: 619  LDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMA 678
            LDELPELSSDYLGNTIVQKLFE+SS IIKDIMLR+TSKYLTSMGVHKNGTWACQKM TMA
Sbjct: 629  LDELPELSSDYLGNTIVQKLFENSSTIIKDIMLRQTSKYLTSMGVHKNGTWACQKMTTMA 688

Query: 679  HTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESIIANFWVIVQNRY 738
             TPRQ+  V +GV  YCTPL NDQFGNYVIQCVLKFGFPWN FIFESI++NF  IVQNRY
Sbjct: 689  DTPRQMDLVAKGVYKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFESIVSNFCTIVQNRY 748

Query: 739  GARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSIL 798
            GARAVRACLEAHDI+T EQ +VLSAMI+ YAEYL+TNSNGALLVTWFLDTS LPNRHSIL
Sbjct: 749  GARAVRACLEAHDIITQEQLLVLSAMILLYAEYLATNSNGALLVTWFLDTSSLPNRHSIL 808

Query: 799  APRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLFGNVNAHDSSPPKELTKLL 858
              +L   IVELC  RLASLTILK+LN+R D++A+++ILD++FG +++ DS PP+ L +LL
Sbjct: 809  TEKLLPHIVELCCDRLASLTILKILNFRSDEHAKRVILDTIFGALDS-DSGPPQTLYQLL 867

Query: 859  CETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQPSRRLLEEVGLASPXXXX 918
             +TNYG TFV+K+L+ PLLE ++R H+I+QVR VL + +  Q  RRL+EEVG A+     
Sbjct: 868  SDTNYGSTFVYKILSTPLLEGEIRNHVIQQVRHVLMEHSGPQ-HRRLMEEVGFANSSTTG 926

Query: 919  XXXXXXXXXXXXXXXXXMFATPDTSGQHMRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXX 978
                                  D+SG HMR +                            
Sbjct: 927  SSGNNSSASSKHRPAVSHVYATDSSG-HMRTVSVSSNRSSGSVPRTLTSSQSHSAATSQQ 985

Query: 979  XPGQPLNANSNSSMGYFSYPGVFPVSGFSGNASNGYAMNNDDLSSQFDMLNFNNGTRLSL 1038
             PG      S+S++  ++YPG FP +      S  ++M  DDL++QFD+LN NN  ++ L
Sbjct: 986  SPG------SSSTVCGYNYPGTFPTN------SGSFSMAADDLATQFDILNINNNAQMPL 1033

Query: 1039 PQLSLTNHNNTT 1050
            PQ+S+   N  T
Sbjct: 1034 PQISMNQVNTNT 1045

>KLLA0E05984g 541992..545276 similar to sp|P47135 Saccharomyces
           cerevisiae YJR091c JSN1 suppresses the high-temperature
           lethality of TUB2-150, start by similarity
          Length = 1094

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/963 (52%), Positives = 608/963 (63%), Gaps = 86/963 (8%)

Query: 1   MDKSKQM--NINNLSNIPEVIDPGITIPIXXXX-XXXXXXXXXQLQQQPQKLGSYRSRAG 57
           M+K K    +++ LSNIPEVIDPG+TIPI              QL  QPQKLGSYRS+AG
Sbjct: 1   MEKRKASGDSMSGLSNIPEVIDPGVTIPIYEDDFTLSGGNNIDQLPIQPQKLGSYRSKAG 60

Query: 58  KFSNTLSNLLPSISAKLHHSKKNSHGKNGAEFXXXXXXXXXTVASKTPRASPSRSKMMES 117
           KFSNTLSNLLPSISAKLHH+KK S G +              ++S    A+ S       
Sbjct: 61  KFSNTLSNLLPSISAKLHHNKKGSKGSSAV----GEGNHSGELSSDDATANTSEQTSKSG 116

Query: 118 SIDGVTMDRPGSLTPPQDME--KLVHFPDSSNNFLIPA-PRGSSDSF-----NLPHQ--- 166
           SI  + +  PG +TPP D++  + +H PDSS+  L+P+ PR S DSF     ++P Q   
Sbjct: 117 SIAQINLSVPGHITPPLDVDYNQAIHLPDSSS-LLVPSQPRLSGDSFTFATNSVPLQPTA 175

Query: 167 ---ISRTRNNTMXXXXXXXXXXAPKPRTSSGIWSSNASANDPMX--------XXXXXXXX 215
              ISRTRNNT+                   +W  N  + +PM                 
Sbjct: 176 SNTISRTRNNTVSSQITGPSNVNGLVPNVGNVWFPNDMSVNPMSPPGIQTTTNPTNVNNN 235

Query: 216 XXXXXXXXXXXXXXDYSTKTAYFDNMVSTSGSQMADNKMNTNNLAIPNS----------- 264
                          Y     YFD   S++         N NNL +P +           
Sbjct: 236 NNNNNSHLAPGTYSPYEATGNYFDLNTSSN---------NINNLGVPGATTAGAHQFQSQ 286

Query: 265 ----VWSNTRQRSQSNASSIYTDAPLYEQPARASISSHYTIP-----------TQESPLI 309
               VW N+R RSQSNASSIYTDAP Y+Q    S +S + IP              +P++
Sbjct: 287 QIGGVW-NSRPRSQSNASSIYTDAPTYDQMDTRSRASTFIIPPSMDPQLKATAASTNPIV 345

Query: 310 ADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNVFPLQHQQPQLNNAINLTSTSLA 369
            D++D +SINWVT DP+VPSIN ISNLLPTNTISISNVF LQ QQP L+N +NLTSTSLA
Sbjct: 346 QDDMDSRSINWVTTDPSVPSINHISNLLPTNTISISNVFSLQQQQPHLSNTVNLTSTSLA 405

Query: 370 TLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKILPM 429
           TLC K+G VISARTLR +NMA+VEF+SVE+A+KA ++L GKEVS++GAPS +SFAK+LPM
Sbjct: 406 TLCLKFGTVISARTLRGVNMAIVEFASVEAAIKAKEALNGKEVSLVGAPSTVSFAKVLPM 465

Query: 430 HQQPPQFLLNSXXXXXXXXXXXXXXXXXXXXXXFNGAVTFQQQGNVSIPVFXXXXXXXXX 489
           HQQ                              F+GAV FQQQGNVS+P F         
Sbjct: 466 HQQ--LPQTQQTQQQNNHQSTAINPQSLLQEQLFSGAVQFQQQGNVSVPSFTGNTHAQSS 523

Query: 490 XXXXXGSAGFSNVLHGYXXXXXXXXXXXXXXXEKEQCPFPLPPPNVNEKEDLLREIIELF 549
                 S  F                      EKEQCPFPLPPP+  E   LL + I  F
Sbjct: 524 ------SQAF-----------VSPTNPSSSNSEKEQCPFPLPPPSFKENITLLNDTINKF 566

Query: 550 EANSDEYQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDL 609
             N D  Q   +I  ++ + GTSDT +FGPLPEPLS REFD P+LRELRKSIDS   SDL
Sbjct: 567 GINYDTSQYQHIIANAIEYNGTSDTTDFGPLPEPLSTREFDAPRLRELRKSIDSGQMSDL 626

Query: 610 EIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTW 669
           EIEQL +AMLDE+PELSSDYLGNTIVQKLFEH+S +IKDIMLRKTS YLTSMGVHKNGTW
Sbjct: 627 EIEQLVLAMLDEIPELSSDYLGNTIVQKLFEHASSVIKDIMLRKTSVYLTSMGVHKNGTW 686

Query: 670 ACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESIIAN 729
           ACQKMIT A TPRQ M V  GV  YCTPL NDQFGNYVIQCVLKFGFPWN FIFE+I++N
Sbjct: 687 ACQKMITNADTPRQKMYVANGVYKYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFENIVSN 746

Query: 730 FWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTS 789
           FW IVQNRYGARAVRACLEAHDI+T EQ ++LSAMIV + +YL+TNSNGALLVTWFLDT 
Sbjct: 747 FWNIVQNRYGARAVRACLEAHDIITQEQLLLLSAMIVFFVKYLATNSNGALLVTWFLDTC 806

Query: 790 VLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLFGNV-NAHDS 848
            LP RHSILA  L   I EL  H+LASLTILK+LNYRGD+ A++ ILD++FG + N   S
Sbjct: 807 TLPKRHSILAEALLPNIFELGCHKLASLTILKILNYRGDEVAKRAILDTIFGPMDNEISS 866

Query: 849 SPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQPSRRLLEE 908
            PP+ L +LL +TNYGP+FV+KVL++P+LE D+R H+I+QVR +LT  + I   RRLLEE
Sbjct: 867 KPPQLLYQLLSDTNYGPSFVYKVLSIPMLEGDVRHHVIEQVRYILTTESNITQHRRLLEE 926

Query: 909 VGL 911
           VGL
Sbjct: 927 VGL 929

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)

Query: 994  YFSYPGVFPVSGFSGNASNGYAMNNDDLSSQFDMLNFNNGTRLSLPQLSL 1043
            Y++YPG+FP S     +++   +N DDL S FDML FNNGT++SLPQL++
Sbjct: 1022 YYTYPGMFPASQPYQYSTSTSGLN-DDLVSNFDMLTFNNGTQISLPQLTM 1070

>Scas_672.26*
          Length = 1079

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/661 (47%), Positives = 432/661 (65%), Gaps = 36/661 (5%)

Query: 268 NTRQRSQSNASSIYTDAPLYEQPARASISSHYTIPTQES---PLIADEIDPQSINWVTMD 324
           + ++R+QS    ++ D P  +   R   ++ + +P Q+     L+ D +DP S+NWV+  
Sbjct: 268 DVKRRAQSINYHMF-DGPKLQNNERRRANTTF-VPIQQQQDVTLLLDNVDPMSLNWVSAS 325

Query: 325 PTVPSINQISNLLPTNTISISNVFPL-QHQ---QPQLNNAINLTSTSLATLCSKYGEVIS 380
           P VPS N++ NL PTNTI  +N+FP+ QH    QP +   I  TS SLA+LCSK+G VIS
Sbjct: 326 PAVPSANRVGNLGPTNTILFTNIFPVPQHSLQAQPMVPAPI--TSASLASLCSKFGHVIS 383

Query: 381 ARTLRNLN--MALVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKILPMH-QQPPQF- 436
           +R L  L   +ALVEF+S+E+A+  +++LQG+++S  G P+ ++FAKILP + QQ PQ  
Sbjct: 384 SRILGGLEFPLALVEFNSIEAAIHTMENLQGRDLSGAGVPTILAFAKILPGYVQQQPQLP 443

Query: 437 -LLNSXXXXXXXXXX-XXXXXXXXXXXXFNGAVTFQQQGNVSIPVFXXXXXXXXXXXXXX 494
            + NS                        N +  F  QGNV                   
Sbjct: 444 PVTNSFPIAQTSDNAPHSLLQEQLYNMNNNNSHGFIPQGNV-----------LQLSGFPT 492

Query: 495 GSAGFSNVLHGYXXXXXXXXXXXXXXXEKEQCPFPLPPPNVNEKEDLLREIIELFEANSD 554
            + G S+ +H                 EKE+CPF LPPP   + + L ++II  F  + D
Sbjct: 493 QTRGQSHPMH--MTTNGNHSAMHIKATEKEKCPFHLPPPPFKDNQMLFQQIISSFNVDYD 550

Query: 555 EYQINSLIKKSLNHKG-TSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQ 613
           + Q+N ++  +L  K  TSD  N+GPLP PL  REFD P+LRE+RK+IDSN+ + +EIEQ
Sbjct: 551 QVQVNHILMNALESKTRTSDPNNYGPLPTPLLNREFDTPRLREIRKNIDSNSLTTIEIEQ 610

Query: 614 LAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQK 673
           LAI MLDE+PELSSDYLGNTI+QKL+++SSDII++I+L+KT+KYL S+GVHKNGTW CQK
Sbjct: 611 LAITMLDEIPELSSDYLGNTIIQKLYDNSSDIIREIILQKTAKYLCSIGVHKNGTWVCQK 670

Query: 674 MITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESIIANFWVI 733
           MI MA TPR++  +T G++DYCTPL NDQFGNYVIQCVLKFGFPWN FIFE+II NFW I
Sbjct: 671 MIKMAQTPRKMQIITDGIQDYCTPLFNDQFGNYVIQCVLKFGFPWNTFIFENIIDNFWTI 730

Query: 734 VQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPN 793
            QNRYGARA+RACLE  D++T EQS+V+S MI+ Y EYL+ + NG LL++W LDTS LPN
Sbjct: 731 AQNRYGARAIRACLETQDVITQEQSLVISTMIILYGEYLAVDDNGTLLISWLLDTSPLPN 790

Query: 794 RHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLFGNVN---AHDSSP 850
           +H IL  +L   +  LC H+L SLT+LK+LNYRG D+A+ +IL+++FG V+    H+S  
Sbjct: 791 KHVILTQKLIPHLKSLCCHKLGSLTVLKLLNYRGSDSAKNLILETVFGKVDNNGIHES-- 848

Query: 851 PKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQVRKVLTDSTQIQPSRRLLEEVG 910
           P  L +LL ++NYGP FV+K L   + + + + HII+QV  +L +       RRL+EEVG
Sbjct: 849 PSILIELLNDSNYGPNFVYKTLISRVFDGNAKHHIIRQVHDLLLEINPTHQHRRLMEEVG 908

Query: 911 L 911
           L
Sbjct: 909 L 909

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%)

Query: 43 QQQPQKLGSYRSRAGKFSNTLSNLLPSISAKLHHSKKNSHGK 84
          Q+  QKLGSYR++AGKFS T+ N+LPS+SAKLHHSKKN   K
Sbjct: 46 QRSTQKLGSYRTKAGKFSTTIGNILPSLSAKLHHSKKNEKSK 87

>YPR042C (PUF2) [5475] chr16 complement(650430..653657) Protein that
           binds mRNA, has similarity to Jsn1p [3228 bp, 1075 aa]
          Length = 1075

 Score =  444 bits (1142), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 215/387 (55%), Positives = 286/387 (73%), Gaps = 14/387 (3%)

Query: 536 NEKEDLLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGPLPE-----PLSGREFD 590
           + K+D+L   I  F+   D  ++N L++ +L +KG SDT  FGPLPE     P     FD
Sbjct: 491 DSKKDIL-HTISSFKLEYDHLELNHLLQNALKNKGVSDTNYFGPLPEHNSKVPKRKDTFD 549

Query: 591 PPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIM 650
            PKLRELRK  DSN+ S +E+EQLAI MLD+LPELSSDYLGNT++QKLFE+SS+II+DIM
Sbjct: 550 APKLRELRKQFDSNSLSTIEMEQLAIVMLDQLPELSSDYLGNTVIQKLFENSSNIIRDIM 609

Query: 651 LRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQC 710
           LRK +KYLTSMGVHKNGTW CQK+I MA+TPRQI  VT GV DYCTPL NDQFGNYVIQ 
Sbjct: 610 LRKCNKYLTSMGVHKNGTWVCQKIIKMANTPRQINLVTSGVSDYCTPLFNDQFGNYVIQG 669

Query: 711 VLKFGFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAE 770
           +LKFGFPWN FIFES++++FW IVQNRYG+RAVRACLEA  I+T  Q + ++++I+  + 
Sbjct: 670 ILKFGFPWNSFIFESVLSHFWTIVQNRYGSRAVRACLEADSIITQCQLLTITSLIIVLSP 729

Query: 771 YLSTNSNGALLVTWFLDTSVLPNRHSILAPRLT-KRIVELCGHRLASLTILKVLNYRGDD 829
           YL+T++NG LL+TW LDT  LPN++ IL  +L  K +V+LC H+L SLT+LK+LN RG +
Sbjct: 730 YLATDTNGTLLITWLLDTCTLPNKNLILCDKLVNKNLVKLCCHKLGSLTVLKILNLRGGE 789

Query: 830 N---ARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHII 886
               ++  I+ ++F    + DS     L ++L E NYGPTF++KVL   +L++ +R   I
Sbjct: 790 EEALSKNKIIHAIFDGPISSDSI----LFQILDEGNYGPTFIYKVLTSRILDNSVRDEAI 845

Query: 887 KQVRKVLTDSTQIQPSRRLLEEVGLAS 913
            ++R+++ +S     SR+LLEEVGL+S
Sbjct: 846 TKIRQLILNSNINLQSRQLLEEVGLSS 872

 Score =  271 bits (693), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 186/463 (40%), Positives = 242/463 (52%), Gaps = 84/463 (18%)

Query: 1   MDKSKQMNINNLSNIPEVIDPGITIPIXXXXXXXXXXXXXQLQQ-------------QPQ 47
           MD  +  N  NLSNIPEVIDPGITIPI               +               PQ
Sbjct: 1   MDNKRLYN-GNLSNIPEVIDPGITIPIYEEDIRNDTRMNTNARSVRVSDKRGRSSSTSPQ 59

Query: 48  KLGSYRSRAGKFSNTLSNLLPSISAKLHHSKKNSHGKNGAEFXXXXXXXXXTVASKTPRA 107
           K+GSYR+RAG+FS+TL+NLLPSISAKLHHSKK++                          
Sbjct: 60  KIGSYRTRAGRFSDTLTNLLPSISAKLHHSKKST-------------------------- 93

Query: 108 SPSRSKMMESSIDGVTMDRPGSLTPPQDMEKLVHFPDSSNNFLIPAPRGSSDSFNLPHQI 167
                              P  + PP         PDS N+    APR SSDSF +   +
Sbjct: 94  -------------------PVVVVPPTSST-----PDSLNSTTY-APRVSSDSFTVATPL 128

Query: 168 SRTRNNTMXXXXXXXXXXAPKPR----------TSSGIWSSNASANDPMXXXXXXXXXXX 217
           S     T                          TS+ IWS+NA +N              
Sbjct: 129 SLQSTTTRTRTRNNTVSSQITASSSLTTDVGNATSANIWSANAESNTSSSPLFDYPLATS 188

Query: 218 XXXXXXXXXXXXDYST-KTAYFDNMVSTSGS---QMADNKMNTNNLAIPNSVWSNTRQRS 273
                       +Y+  +TA  ++ +  +G+     +    NT++L  P  + +  R +S
Sbjct: 189 YFEPLTRFKSTDNYTLPQTAQLNSFLEKNGNPNIWSSAGNSNTDHLNTP--IVNRQRSQS 246

Query: 274 QSNASSIYTDAPLYEQPAR---ASISSHYTIPTQESPLIADEIDPQSINWVTMDPTVPSI 330
           QS  + +YTDAP Y+QPA+     +       T  SP+I D++DP SINW+T +  VP +
Sbjct: 247 QSTTNRVYTDAPYYQQPAQNYQVQVPPRVPKSTSISPVILDDVDPASINWITANQKVPLV 306

Query: 331 NQISNLLPTNTISISNVFPLQHQQPQLNNAINLTSTSLATLCSKYGEVISARTLRNLNMA 390
           NQIS LLPTNTISISNVFPLQ  Q    NA+NLTSTSLATLCS+YG+V+SARTLR LNMA
Sbjct: 307 NQISALLPTNTISISNVFPLQPTQQHQQNAVNLTSTSLATLCSQYGKVLSARTLRGLNMA 366

Query: 391 LVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKILPMHQQP 433
           LVEFS+VESA+ AL++LQGKE+S +GAPS +SFA++LPM++QP
Sbjct: 367 LVEFSTVESAICALEALQGKELSKVGAPSTVSFARVLPMYEQP 409

>CAGL0H08778g 854147..857344 some similarities with tr|Q12221
           Saccharomyces cerevisiae YPR042c PUF2 or sp|P47135
           Saccharomyces cerevisiae YJR091c JSN1, hypothetical
           start
          Length = 1065

 Score =  428 bits (1100), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 285/394 (72%), Gaps = 5/394 (1%)

Query: 522 EKEQCPFPLPPPNVNEKEDLLREIIELFEANSDEYQINSLIKKSLNHKG--TSDTQNFGP 579
           + + CPF LPP  + +K D  ++II+ F    D   +N ++  SL  KG    D  NFGP
Sbjct: 523 DNDPCPFKLPPAILADKLDDFQDIIKKFNIKYDVDIVNHMLNNSL-QKGPNACDVNNFGP 581

Query: 580 LPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLF 639
           +P+    R+FD PKLRELRK+ DSN+ S +E+EQLAIAMLDELPEL  DY GNTI+QKL+
Sbjct: 582 IPQQSVHRQFDAPKLRELRKAFDSNSLSQVEMEQLAIAMLDELPELCLDYSGNTIIQKLY 641

Query: 640 EHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLI 699
           ++ S II D+MLR++ KYLTSMG+HKNGTW  QK+I +  TPRQ+  +T+G++DYCT L 
Sbjct: 642 DNCSPIIVDLMLRESHKYLTSMGIHKNGTWVSQKIIKVVKTPRQMDFITKGIQDYCTALF 701

Query: 700 NDQFGNYVIQCVLKFGFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSI 759
           NDQ+GNYVIQ VL FGFPWN FIFE+I++NFWVIV N++G RAVRACLEA+  ++ EQ +
Sbjct: 702 NDQYGNYVIQGVLTFGFPWNSFIFENIMSNFWVIVDNKFGVRAVRACLEANGHMSKEQEL 761

Query: 760 VLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTI 819
           +L +MI+ Y+EYLST++ G LLVTW+LD+     +++++   L   IVELC HRL SLT+
Sbjct: 762 LLCSMIILYSEYLSTSNTGTLLVTWYLDSCTFEEKYAMIISSLIPHIVELCSHRLGSLTV 821

Query: 820 LKVLNYRGDDNARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLED 879
           LK+LN R D   +  IL ++FG++N  D+ P + L ++L + + G +F++K+++   LE 
Sbjct: 822 LKLLNLRIDQCVKDSILTAIFGDLN--DNKPSENLIEILKDNHNGGSFLYKIISSRFLES 879

Query: 880 DLRAHIIKQVRKVLTDSTQIQPSRRLLEEVGLAS 913
           + ++H++++++ VL +S     ++RL+EEVGL S
Sbjct: 880 ERKSHLVEKIKIVLLNSNLAHQNKRLIEEVGLTS 913

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 101/128 (78%), Gaps = 4/128 (3%)

Query: 304 QESPLIADEIDPQSINWVTMDPTVPSINQISNLLPTNTISISNVFPLQ----HQQPQLNN 359
           Q +P++AD++DP  I+WV+ +  +P+ NQ   LLPTNT+ ISNVFPLQ    +    L++
Sbjct: 320 QLTPVVADDVDPALISWVSTNINIPASNQTGFLLPTNTLCISNVFPLQTPGEYGNNNLSH 379

Query: 360 AINLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPS 419
            INLTST LA+LCS+YG+V+S+RTLR+LN+ALVEF +V+SA+ AL+SLQGKE+S++G P 
Sbjct: 380 PINLTSTLLASLCSQYGKVLSSRTLRHLNIALVEFETVDSAITALESLQGKELSLLGFPC 439

Query: 420 KISFAKIL 427
             +FAKIL
Sbjct: 440 SAAFAKIL 447

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (86%), Gaps = 1/30 (3%)

Query: 51 SYRSRAGKFSNTLSNLLPSISAKLHHSKKN 80
          SYRS+  +F++TL+++LPSISAK  HS+KN
Sbjct: 40 SYRSKKERFASTLNSILPSISAKF-HSRKN 68

>Scas_7.1
          Length = 247

 Score =  268 bits (685), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 162/233 (69%), Gaps = 3/233 (1%)

Query: 463 FNGAVTFQQQGNVSIPVFXXXXXXXXXXXXXXGSAGF---SNVLHGYXXXXXXXXXXXXX 519
           +NGAVTFQQQGNVSIPVF              GS      S   +               
Sbjct: 14  YNGAVTFQQQGNVSIPVFNQHTTSSHGNGNSTGSNNNTITSTSGNNNGNNNGNNNHSTTH 73

Query: 520 XXEKEQCPFPLPPPNVNEKEDLLREIIELFEANSDEYQINSLIKKSLNHKGTSDTQNFGP 579
             EKE CPFPLPPP+V +    L++II  F+   +  QIN ++  +LN++GT+DT  FGP
Sbjct: 74  LPEKEHCPFPLPPPSVADNTLTLKDIISSFKTAYNPAQINHIVSNALNYEGTNDTSEFGP 133

Query: 580 LPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLF 639
           LP+PL+ REFD PKLRELRK ID+N+ SDLEIEQLA+AMLDELPELSSDYLGNTIVQKLF
Sbjct: 134 LPDPLATREFDAPKLRELRKMIDANSMSDLEIEQLAVAMLDELPELSSDYLGNTIVQKLF 193

Query: 640 EHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVK 692
           EHSS I+KD MLR+T++YLTSMGVHKNGTWACQKMITM+ TPRQ +    G +
Sbjct: 194 EHSSTIVKDTMLRQTNRYLTSMGVHKNGTWACQKMITMSDTPRQKVNPPHGAQ 246

>YGL014W (PUF4) [1959] chr7 (466144..468810) Protein with pumilio
           repeats that is involved with Mpt5p in relocalization of
           Sir3p and Sir4p from telomeres to the nucleolus [2667
           bp, 888 aa]
          Length = 888

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 98/204 (48%), Gaps = 7/204 (3%)

Query: 624 ELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQ 683
           EL +D  GN ++QKL E  +   + ++ + +S +   + ++ +GT A QK+I    T  +
Sbjct: 606 ELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQKLIECIKTDEE 665

Query: 684 IMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWN-QFIFESIIANFWVIVQNRYGARA 742
              V   ++ Y   L  D  GN+VIQ  L+   P N QFIF++I  +   I  +R+G   
Sbjct: 666 AQIVVDSLRPYTVQLSKDLNGNHVIQKCLQRLKPENFQFIFDAISDSCIDIATHRHGCCV 725

Query: 743 VRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSI---LA 799
           ++ CL   D  T EQ   L   ++   + L+ +  G  +V + +      N++     + 
Sbjct: 726 LQRCL---DHGTTEQCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIV 782

Query: 800 PRLTKRIVELCGHRLASLTILKVL 823
             L  R +EL  H+  S  I K+L
Sbjct: 783 HLLKPRAIELSIHKFGSNVIEKIL 806

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 87/191 (45%), Gaps = 6/191 (3%)

Query: 636 QKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYC 695
           Q+  E SS    D +L +    + S+   ++G    QK + +  + +    + +  KDY 
Sbjct: 547 QRKIEESSRF-ADAVLDQYIGSIHSLCKDQHGCRFLQKQLDILGS-KAADAIFEETKDYT 604

Query: 696 TPLINDQFGNYVIQCVLKFGFPWNQFIFESIIA-NFWVIVQNRYGARAVRACLEAHDIVT 754
             L+ D FGNY+IQ +L+      + +   I + +F  I  N +G RA++  +E   I T
Sbjct: 605 VELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQKLIEC--IKT 662

Query: 755 PEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRL 814
            E++ ++   +  Y   LS + NG  ++   L   + P     +   ++   +++  HR 
Sbjct: 663 DEEAQIVVDSLRPYTVQLSKDLNGNHVIQKCLQ-RLKPENFQFIFDAISDSCIDIATHRH 721

Query: 815 ASLTILKVLNY 825
               + + L++
Sbjct: 722 GCCVLQRCLDH 732

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 11/145 (7%)

Query: 610 EIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLT----SMGVHK 665
           + + L   +L  + +L+ D  GN +VQ +    ++  K     K    L      + +HK
Sbjct: 737 QCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHK 796

Query: 666 NGTWACQKMITMA--HTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIF 723
            G+   +K++  A    P  +  +  G +     L+ND +GNYV+Q  L      N +++
Sbjct: 797 FGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQTALDISHKQNDYLY 856

Query: 724 E---SIIANFWV--IVQNRYGARAV 743
           +    I+A   V  I    +G R +
Sbjct: 857 KRLSEIVAPLLVGPIRNTPHGKRII 881

>AGL086C [4225] [Homologous to ScYGL014W (PUF4) - SH]
           (543176..545383) [2208 bp, 735 aa]
          Length = 735

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 103/204 (50%), Gaps = 7/204 (3%)

Query: 624 ELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQ 683
           EL +D  GN ++QKL E  S   +  +++ ++    S+ +  +GT A QK++    T  +
Sbjct: 454 ELMTDSFGNYLIQKLVERVSAEQRITLVKSSADQFVSIALDPHGTRALQKLVECISTEEE 513

Query: 684 IMQVTQGVKDYCTPLINDQFGNYVIQ-CVLKFGFPWNQFIFESIIANFWVIVQNRYGARA 742
              +   +K+    L  D  GN+V+Q C+ KF    +QFIF++  A+   I  +R+G   
Sbjct: 514 SRIIIASLKNSVVQLSKDLNGNHVVQKCLQKFSSADSQFIFDAACADCVKIATHRHGCCV 573

Query: 743 VRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFL--DTSVLPNRHSI-LA 799
           ++ CL   D  + +Q   L A ++   + L+ +  G  +V + L  +  + P+ ++  + 
Sbjct: 574 LQRCL---DYGSDQQRDQLCAQVLGNVDALTLDPFGNYVVQYILTKEAELPPSTYTTKIV 630

Query: 800 PRLTKRIVELCGHRLASLTILKVL 823
             L  R++EL  H+  S  + K+L
Sbjct: 631 DTLKPRVIELSLHKFGSNVVEKIL 654

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 81/189 (42%), Gaps = 6/189 (3%)

Query: 658 LTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQ-CVLKFGF 716
           L S+   ++G    Q+ + +A  P     + +  K Y   L+ D FGNY+IQ  V +   
Sbjct: 416 LYSLCKDQHGCRFLQRQLDVA-GPDAATSIFEETKPYVVELMTDSFGNYLIQKLVERVSA 474

Query: 717 PWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNS 776
                + +S    F  I  + +G RA++  +E   I T E+S ++ A +      LS + 
Sbjct: 475 EQRITLVKSSADQFVSIALDPHGTRALQKLVEC--ISTEEESRIIIASLKNSVVQLSKDL 532

Query: 777 NGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIIL 836
           NG  +V   L      +   I         V++  HR     + + L+Y G D  R  + 
Sbjct: 533 NGNHVVQKCLQKFSSADSQFIFDAACAD-CVKIATHRHGCCVLQRCLDY-GSDQQRDQLC 590

Query: 837 DSLFGNVNA 845
             + GNV+A
Sbjct: 591 AQVLGNVDA 599

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 91/221 (41%), Gaps = 11/221 (4%)

Query: 589 FDPPKLRELRKSIDSNAFSDLEIEQLAIAML-DELPELSSDYLGNTIVQKLFEHSSDIIK 647
            DP   R L+K ++    S  E  ++ IA L + + +LS D  GN +VQK  +  S    
Sbjct: 493 LDPHGTRALQKLVE--CISTEEESRIIIASLKNSVVQLSKDLNGNHVVQKCLQKFSSADS 550

Query: 648 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYV 707
             +          +  H++G    Q+ +    + +Q  Q+   V      L  D FGNYV
Sbjct: 551 QFIFDAACADCVKIATHRHGCCVLQRCLDYG-SDQQRDQLCAQVLGNVDALTLDPFGNYV 609

Query: 708 IQCVL--KFGFPWNQF---IFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLS 762
           +Q +L  +   P + +   I +++      +  +++G+  V   L    +     S +L+
Sbjct: 610 VQYILTKEAELPPSTYTTKIVDTLKPRVIELSLHKFGSNVVEKILRTSAVAELMISELLA 669

Query: 763 AMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLT 803
                  E L  +  G  ++   LD S   N  S L  RLT
Sbjct: 670 TGRQPGVEQLLHDGFGNYVLQTALDVSKAAN--SFLYTRLT 708

>Kwal_47.17511
          Length = 707

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 110/242 (45%), Gaps = 24/242 (9%)

Query: 620 DELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAH 679
           D + EL +D  GN ++QKL E   D  +  +++ +S+    + +  +GT A QK++    
Sbjct: 422 DYVVELMTDSFGNYLIQKLLERVDDNQRLELIKSSSQSFVLISLDPHGTRALQKLVECTS 481

Query: 680 TPRQIMQVTQGVKDYCTPLINDQFGNYVIQ-CVLKFGFPWNQFIFESIIANFWVIVQNRY 738
           T  +   + + ++     L  D  GN+V+Q C+ K     +QFIF++  +    I  +R+
Sbjct: 482 TEEEANIIVESLRGSIVELSRDLNGNHVVQKCLQKLKPEDSQFIFDAATSECVKIATHRH 541

Query: 739 GARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSIL 798
           G   ++ CL   D    +Q   L   I+ + + L+T+  G  +V + L T       S  
Sbjct: 542 GCCVLQRCL---DHGNKDQFQQLCEEIIAHVDELATDPFGNYVVQYIL-TKQTERSESDY 597

Query: 799 APR----LTKRIVELCGHRLAS--------------LTILKVLNYRGDDNARKIILDSLF 840
             R    L  +IVEL  H+  S              L I ++LN  GD    +++ D  +
Sbjct: 598 TNRVVNLLRSKIVELSLHKFGSNVVEKVLRTPVVSDLMISELLNQSGDSKIEQLLHDG-Y 656

Query: 841 GN 842
           GN
Sbjct: 657 GN 658

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 82/180 (45%), Gaps = 7/180 (3%)

Query: 658 LTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFP 717
           + S+   ++G    Q+ + +   P     + Q  KDY   L+ D FGNY+IQ +L+    
Sbjct: 388 ILSLCKDQHGCRFLQRQLDVG-GPEAANSIFQETKDYVVELMTDSFGNYLIQKLLER-VD 445

Query: 718 WNQF--IFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTN 775
            NQ   + +S   +F +I  + +G RA++  +E       E +I++ ++  +  E LS +
Sbjct: 446 DNQRLELIKSSSQSFVLISLDPHGTRALQKLVECTS-TEEEANIIVESLRGSIVE-LSRD 503

Query: 776 SNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKII 835
            NG  +V   L   + P     +    T   V++  HR     + + L++   D  +++ 
Sbjct: 504 LNGNHVVQKCLQ-KLKPEDSQFIFDAATSECVKIATHRHGCCVLQRCLDHGNKDQFQQLC 562

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 610 EIEQLAIAMLDELPELSSDYLGNTIVQKLF----EHSSDIIKDIMLRKTSKYLTSMGVHK 665
           + +QL   ++  + EL++D  GN +VQ +     E S     + ++      +  + +HK
Sbjct: 557 QFQQLCEEIIAHVDELATDPFGNYVVQYILTKQTERSESDYTNRVVNLLRSKIVELSLHK 616

Query: 666 NGTWACQKMITMAHTPRQIMQ--VTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIF 723
            G+   +K++        ++   + Q        L++D +GNYV+Q  L      N++++
Sbjct: 617 FGSNVVEKVLRTPVVSDLMISELLNQSGDSKIEQLLHDGYGNYVLQTALDIARENNRYLY 676

Query: 724 ESI 726
           + +
Sbjct: 677 QRL 679

>Scas_688.2
          Length = 828

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 111/236 (47%), Gaps = 15/236 (6%)

Query: 595 RELRKSID--SNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLR 652
           R L+K +D   +  +DL  E+     +    EL +D  GN ++QKL E  +   +  + +
Sbjct: 521 RFLQKQLDVLGSKAADLIFEETKFHTI----ELMTDSFGNYLMQKLIERVTTEQRIELAK 576

Query: 653 KTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVL 712
             S     + ++ +GT A QK+I   +T  +   + + ++D    L  D  GN+V+Q  L
Sbjct: 577 IASPQFVEIALNPHGTRALQKLIECINTEEEAKIIVESLRDSIVQLSKDLNGNHVVQKCL 636

Query: 713 KFGFPWN-QFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEY 771
           +   P + QFIF++   N   I  +R+G   ++ CL   D  T EQ   L   ++++ + 
Sbjct: 637 QKLHPTDFQFIFDATCDNCVDIATHRHGCCVLQRCL---DHGTKEQCEKLCDKLLSHVDK 693

Query: 772 LSTNSNGALLVTWFLDTSVLPNR----HSILAPRLTKRIVELCGHRLASLTILKVL 823
           L+ +  G  +V + +      +     H I+   L  ++ EL  H+  S  I K+L
Sbjct: 694 LTLDPFGNYVVQYVITKETERDEFDYTHKIVH-LLKPKVAELSVHKFGSNVIEKIL 748

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 63/129 (48%), Gaps = 16/129 (12%)

Query: 610 EIEQLAIAMLDELPELSSDYLGNTIVQKL---------FEHSSDIIKDIMLRKTSKYLTS 660
           + E+L   +L  + +L+ D  GN +VQ +         F+++  I+  +  +     +  
Sbjct: 679 QCEKLCDKLLSHVDKLTLDPFGNYVVQYVITKETERDEFDYTHKIVHLLKPK-----VAE 733

Query: 661 MGVHKNGTWACQKMI-TMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWN 719
           + VHK G+   +K++ T   T   I+++     +    L+ND +GNYV+Q  L      N
Sbjct: 734 LSVHKFGSNVIEKILRTPVVTETMILELLNHESEIQN-LLNDSYGNYVLQTALDISHEHN 792

Query: 720 QFIFESIIA 728
           +++++ + A
Sbjct: 793 KYLYDRLSA 801

>Scas_688.28
          Length = 831

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 113/249 (45%), Gaps = 20/249 (8%)

Query: 610 EIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTW 669
           E E +   + DE   LS+D  GN ++QK FE  S   +DI++ +    + ++ +      
Sbjct: 515 EREVIFNELRDEAISLSNDVFGNYVIQKFFEFGSVTQRDILVDQFKGKMQNLSLQMYACR 574

Query: 670 ACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQ----CVLKFGFPWNQFIFES 725
             QK +     P Q +++   +      +I DQ GN+VIQ    C+     P   FI +S
Sbjct: 575 VIQKALEFI-KPDQRLELVSELSQCVLQMIKDQNGNHVIQKAIECIPMKDLP---FILDS 630

Query: 726 IIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWF 785
           +  + + +  + YG R ++  LE   +   +Q+++LS +   +  YL  +  G  ++   
Sbjct: 631 LHGHIYHLSTHSYGCRVIQRLLEFGSL--EDQTLILSEL-KDFIPYLIQDQYGNYVIQHI 687

Query: 786 LD--------TSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILD 837
           L+        +  + N    +   +++ +VE   H+ AS  + + + Y G++  R +I+ 
Sbjct: 688 LEQQDNNPNVSQEMMNTKQEIVNIVSQNVVEFSKHKFASNVVERAILY-GNEKQRNLIIR 746

Query: 838 SLFGNVNAH 846
            +     AH
Sbjct: 747 QILPRDKAH 755

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 83/210 (39%), Gaps = 24/210 (11%)

Query: 667 GTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESI 726
           G+   Q  ++   +P +   +   ++D    L ND FGNYVIQ   +FG    + I   +
Sbjct: 499 GSRFIQHELSTTSSPSEREVIFNELRDEAISLSNDVFGNYVIQKFFEFGSVTQRDI---L 555

Query: 727 IANFWVIVQN----RYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLV 782
           +  F   +QN     Y  R ++  LE    + P+Q + L + +      +  + NG  ++
Sbjct: 556 VDQFKGKMQNLSLQMYACRVIQKALE---FIKPDQRLELVSELSQCVLQMIKDQNGNHVI 612

Query: 783 TWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLFGN 842
              ++   + +   IL   L   I  L  H      I ++L + G    + +IL  L   
Sbjct: 613 QKAIECIPMKDLPFILD-SLHGHIYHLSTHSYGCRVIQRLLEF-GSLEDQTLILSEL--- 667

Query: 843 VNAHDSSPPKELTKLLCETNYGPTFVHKVL 872
                    K+    L +  YG   +  +L
Sbjct: 668 ---------KDFIPYLIQDQYGNYVIQHIL 688

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 22/129 (17%)

Query: 606 FSDLEIEQLAIAML-DELPELSSDYLGNTIVQKLFEHSSD---IIKDIMLRK------TS 655
           F  LE + L ++ L D +P L  D  GN ++Q + E   +   + +++M  K       S
Sbjct: 654 FGSLEDQTLILSELKDFIPYLIQDQYGNYVIQHILEQQDNNPNVSQEMMNTKQEIVNIVS 713

Query: 656 KYLTSMGVHKNGTWACQKMITMAHTPRQ---IMQVTQGVKDYC------TPLI---NDQF 703
           + +     HK  +   ++ I   +  ++   I Q+    K +        P+I    DQF
Sbjct: 714 QNVVEFSKHKFASNVVERAILYGNEKQRNLIIRQILPRDKAHAENLEDNAPMILMMRDQF 773

Query: 704 GNYVIQCVL 712
            NYV+Q ++
Sbjct: 774 ANYVVQKLV 782

>YLL013C (PUF3) [3406] chr12 complement(122074..124713) Protein
           involved in metabolism of COX17 mRNA, has eight
           Pumilio-homology domains [2640 bp, 879 aa]
          Length = 879

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 113/253 (44%), Gaps = 18/253 (7%)

Query: 610 EIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTW 669
           E E +   + D+  ELS+D  GN ++QK FE  S I K+ ++ +    +  + +      
Sbjct: 567 EKEVIFNEIRDDAIELSNDVFGNYVIQKFFEFGSKIQKNTLVDQFKGNMKQLSLQMYACR 626

Query: 670 ACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQ--FIFESII 727
             QK +    + ++I  V + + D    +I DQ GN+VIQ  ++   P  +  FI  S+ 
Sbjct: 627 VIQKALEYIDSNQRIELVLE-LSDSVLQMIKDQNGNHVIQKAIE-TIPIEKLPFILSSLT 684

Query: 728 ANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLD 787
            + + +  + YG R ++  LE     + +Q  +L+ +   +  YL  +  G  ++ + L 
Sbjct: 685 GHIYHLSTHSYGCRVIQRLLEFGS--SEDQESILNEL-KDFIPYLIQDQYGNYVIQYVLQ 741

Query: 788 TSVLPNRHSI-----LAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKIILDSLF-- 840
                N+  +     +   +   +VE   H+ AS  + K + Y G  N + +I+  +   
Sbjct: 742 QDQFTNKEMVDIKQEIIETVANNVVEYSKHKFASNVVEKSILY-GSKNQKDLIISKILPR 800

Query: 841 ---GNVNAHDSSP 850
                +N  D SP
Sbjct: 801 DKNHALNLEDDSP 813

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 89/223 (39%), Gaps = 22/223 (9%)

Query: 691 VKDYCTPLINDQFGNYVIQCVLKFGFPWNQ-FIFESIIANFWVIVQNRYGARAVRACLEA 749
           ++D    L ND FGNYVIQ   +FG    +  + +    N   +    Y  R ++  LE 
Sbjct: 575 IRDDAIELSNDVFGNYVIQKFFEFGSKIQKNTLVDQFKGNMKQLSLQMYACRVIQKALE- 633

Query: 750 HDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVEL 809
              +   Q I L   +      +  + NG  ++   ++T  +     IL+  LT  I  L
Sbjct: 634 --YIDSNQRIELVLELSDSVLQMIKDQNGNHVIQKAIETIPIEKLPFILS-SLTGHIYHL 690

Query: 810 CGHRLASLTILKVLNYRGDDNARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVH 869
             H      I ++L + G    ++ IL+ L            K+    L +  YG   + 
Sbjct: 691 STHSYGCRVIQRLLEF-GSSEDQESILNEL------------KDFIPYLIQDQYGNYVIQ 737

Query: 870 KVLAMPLLED----DLRAHIIKQVRKVLTDSTQIQPSRRLLEE 908
            VL      +    D++  II+ V   + + ++ + +  ++E+
Sbjct: 738 YVLQQDQFTNKEMVDIKQEIIETVANNVVEYSKHKFASNVVEK 780

>Scas_707.37
          Length = 813

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 122/265 (46%), Gaps = 32/265 (12%)

Query: 595 RELRKSIDSNAFS----DLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIM 650
           R L+K ++SNA S    DL  EQ+   +LD    L  D  GN ++QKL ++ +   +  M
Sbjct: 187 RFLQKKLESNAESDIVRDLMYEQIKPYILD----LILDPFGNYLIQKLCDYLTTAQRTDM 242

Query: 651 LRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGV-KDY-----CTPLINDQFG 704
           ++     +  + +++ GT + QK+I    +  QI  + +G  ++Y        LIND  G
Sbjct: 243 IQSIFPQVFQISINQYGTRSLQKIIDTVDSDVQIETIIKGFSQEYTSIQQVVTLINDLNG 302

Query: 705 NYVIQ-CVLKFGFPWNQFIFESIIA--NFWVIVQNRYGARAVRACLEAHDIVTPEQSIVL 761
           N+VIQ C+ KF      F+ ++I+   N   I  +++G   ++  L    + T +Q   +
Sbjct: 303 NHVIQKCIFKFPPSTFGFVIDAIVEKNNIITISTHKHGCCVLQKLLS---VCTLQQIFTI 359

Query: 762 SAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILK 821
           S  I+ +   L  +  G  ++ + LD   L      L P + KR+     + L  L+ LK
Sbjct: 360 SVKIIQFLPGLINDQFGNYIIQFLLDIDDL---DYYLLPEIFKRL----SNELCQLSCLK 412

Query: 822 VLNYRGDDNARKIILDSLFGNVNAH 846
                   N  +  +  LF NV  +
Sbjct: 413 F-----SSNVVEKFIKKLFRNVKKY 432

>CAGL0A00473g complement(51137..53497) similar to sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 786

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 92/204 (45%), Gaps = 7/204 (3%)

Query: 624 ELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQ 683
           EL +D  GN ++QKL E  +D  +  + +  +  +  +    +GT A QK+I    T  +
Sbjct: 506 ELMTDSFGNYLIQKLLERVTDDQRVELAKIAAPKMVEISKDPHGTRALQKLIECISTKEE 565

Query: 684 IMQVTQGVKDYCTPLINDQFGNYVIQ-CVLKFGFPWNQFIFESIIANFWVIVQNRYGARA 742
              V + ++     L  D  GN+VIQ C+ K     +QFIF++       I  +R+G   
Sbjct: 566 AEIVVKSLQPDTVILSKDLNGNHVIQKCLQKLNPEDSQFIFDAAGNECGEIATHRHGCCV 625

Query: 743 VRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSI---LA 799
           ++ CL   D  T  Q   L   ++ Y + L+ +  G  +V + +      N +     + 
Sbjct: 626 LQRCL---DHGTKTQFKDLCEKLLKYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKIV 682

Query: 800 PRLTKRIVELCGHRLASLTILKVL 823
            +L  R  EL  H+  S  + KVL
Sbjct: 683 NQLKPRFTELSVHKFGSNVVEKVL 706

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 65/142 (45%), Gaps = 19/142 (13%)

Query: 597 LRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKL---------FEHSSDIIK 647
           L++ +D    +  + + L   +L  +  L+ D  GN +VQ +         ++++  I+ 
Sbjct: 626 LQRCLDHG--TKTQFKDLCEKLLKYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKIVN 683

Query: 648 DIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQ--VTQGVKDYCTPLINDQFGN 705
            +  R      T + VHK G+   +K++        I+   + +G  +    L+ND FGN
Sbjct: 684 QLKPR-----FTELSVHKFGSNVVEKVLRTPVVSETIINELINEGSAE-VQALLNDSFGN 737

Query: 706 YVIQCVLKFGFPWNQFIFESII 727
           YV+Q  L      N ++++ ++
Sbjct: 738 YVLQTALDISRDTNPYMYKKLV 759

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 61/140 (43%), Gaps = 4/140 (2%)

Query: 687 VTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESIIANFWV-IVQNRYGARAVRA 745
           + +  K+Y   L+ D FGNY+IQ +L+      +     I A   V I ++ +G RA++ 
Sbjct: 496 IFEETKEYTVELMTDSFGNYLIQKLLERVTDDQRVELAKIAAPKMVEISKDPHGTRALQK 555

Query: 746 CLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKR 805
            +E   I T E++ ++   +      LS + NG  ++   L   + P     +       
Sbjct: 556 LIEC--ISTKEEAEIVVKSLQPDTVILSKDLNGNHVIQKCLQ-KLNPEDSQFIFDAAGNE 612

Query: 806 IVELCGHRLASLTILKVLNY 825
             E+  HR     + + L++
Sbjct: 613 CGEIATHRHGCCVLQRCLDH 632

>Sklu_2097.2 YLL013C, Contig c2097 4468-6831
          Length = 787

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 138/304 (45%), Gaps = 33/304 (10%)

Query: 607 SDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKN 666
           SD E E +   + DE   L+ D  GN ++QK FEH +   KD+++ + +  +  + +   
Sbjct: 471 SDAEKEVIFNEIRDEAIALADDVFGNYVIQKFFEHGTKTQKDVLVEQFTGKMEQLSLE-- 528

Query: 667 GTWACQKMITMAH---TPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQ--F 721
             +AC ++I  A      +Q + + Q +      +I DQ GN+VIQ  ++   P ++  F
Sbjct: 529 -MYAC-RVIQRAFECIEEQQKVALVQELSHCVLHMIKDQNGNHVIQKAIE-RIPIDKLPF 585

Query: 722 IFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALL 781
           I  S+    + +  + YG R ++  LE   +   +Q  +L  +   +  YL  +  G  +
Sbjct: 586 ILGSLNEQIYHLSTHSYGCRVIQRLLEYGSL--KDQDQILDELD-QFIPYLIQDQYGNYV 642

Query: 782 VTWFL-------DTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKI 834
           +   L       +  +   + +I+   ++K +VE   H+ AS  + K + + G D+ ++ 
Sbjct: 643 IQHILQHGGEHTNIHIGSTKQNIVDI-VSKSVVEYSKHKFASNVVEKTMLF-GSDSQKRQ 700

Query: 835 ILD-----SLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQV 889
           I+D     SL    +  D++P      L+    Y    V K++ +   ED  +  I+  +
Sbjct: 701 IMDRILPKSLDHAAHLEDNAP----LILMMRDQYANYVVQKLVGVAQGED--KKLIVVAI 754

Query: 890 RKVL 893
           R  L
Sbjct: 755 RSYL 758

>ADL056W [1685] [Homologous to ScYGL178W (MPT5) - SH]
           complement(580439..582862) [2424 bp, 807 aa]
          Length = 807

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 114/269 (42%), Gaps = 31/269 (11%)

Query: 595 RELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKT 654
           R+L    +SN   DL   Q+   +LD    L  D  GN ++QKL E+ +   K  M++  
Sbjct: 181 RKLENPAESNQVRDLMYSQIKPYLLD----LILDPFGNYLIQKLCEYLTLDQKTSMIQDI 236

Query: 655 SKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTP------LINDQFGNYVI 708
             ++  + +++ GT + QK+I    T + I  +  G     T       LIND  GN+VI
Sbjct: 237 YTHVFEISINQYGTRSLQKIIDTTETEQHIDMIVSGFSQQFTSINQVVTLINDLNGNHVI 296

Query: 709 Q-CVLKFGFPWNQFIFESIIA--NFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMI 765
           Q C+ KF      FI ++I+   N   I  +++G   ++  L    + T +Q   +S  I
Sbjct: 297 QKCIFKFQPTKFDFIIDAIVEKDNIIKISTHKHGCCVLQKLLS---VCTLQQIFKISVKI 353

Query: 766 VTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNY 825
           + Y   L  +  G  ++ +  D   L          L   I     H L  L+ LK    
Sbjct: 354 IQYLPGLINDQFGNYIIQFLFDIKELDF-------YLLGEIFSKLSHELCQLSCLKF--- 403

Query: 826 RGDDNARKIILDSLFGNVNAHDSSPPKEL 854
               N  +  +  LF  V  HD SP K L
Sbjct: 404 --SSNVVEKFIKKLFQIV--HD-SPHKPL 427

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 14/100 (14%)

Query: 621 ELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHT 680
           EL +LS     + +V+K  +    I+ D   +      TS  V  NG+ + Q      H 
Sbjct: 394 ELCQLSCLKFSSNVVEKFIKKLFQIVHDSPHKPLQFSFTSFKVVSNGSHSYQ------HQ 447

Query: 681 PRQIMQVTQGV----KDYCTP----LINDQFGNYVIQCVL 712
              ++ V  G+     D  T     LI D FGNY +Q +L
Sbjct: 448 ADDVVNVAMGILLTITDIFTANLNVLIRDNFGNYALQTLL 487

>KLLA0F15477g complement(1429123..1431915) some similarities with
           sgd|S0003936 Saccharomyces cerevisiae YLL013c
           transcript-specific regulator of mRNA degradation,
           hypothetical start
          Length = 930

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 137/309 (44%), Gaps = 33/309 (10%)

Query: 607 SDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKN 666
           SD + E +   + D+   LS D  GN ++QK FEH +   +++++ +    + ++ +   
Sbjct: 614 SDADKEVIFNEIRDQCIPLSHDVFGNYVIQKFFEHGTKTQREVLVDQFRGKMENLSLEMY 673

Query: 667 GTWACQKMITMAHTPRQIMQVTQGVKDYCT-PLINDQFGNYVIQ----CVLKFGFPWNQF 721
                QK     +  +++  V++    +C   +I DQ GN+VIQ    C+     P   F
Sbjct: 674 ACRVIQKAFEFLNEDQKVDLVSE--LSHCVLAMIKDQNGNHVIQKAIECIPIEKLP---F 728

Query: 722 IFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALL 781
           I +S+    + +  + YG R V+  LE   +   +Q  +L+ +   +  +L  +  G  +
Sbjct: 729 ILQSLRGQIYHLSTHSYGCRVVQRLLEFGTL--KDQDDILNDLD-EFIPFLIQDQYGNYV 785

Query: 782 VTWFL-----DTS--VLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKI 834
           +   L     DTS  +  ++ +I+   + K +VE   H+ AS  + K + Y G  N  + 
Sbjct: 786 IQHILQHGTEDTSSHIGMSKQNIIDI-IRKNVVEYSKHKFASNVVEKSVVY-GSKNQIRQ 843

Query: 835 ILDSLFGNVNAH-----DSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQV 889
           ILD +      H     D++P      L+    Y    V K++ +   ED+    I+  +
Sbjct: 844 ILDQILPRDEEHAADLEDNAP----LILMMRDQYANYVVQKLVGVATGEDERL--IVISI 897

Query: 890 RKVLTDSTQ 898
           R  L  S +
Sbjct: 898 RSYLDKSNK 906

>AAL152W [35] [Homologous to ScYLL013C (PUF3) - SH]
           complement(77508..79871) [2364 bp, 787 aa]
          Length = 787

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 129/304 (42%), Gaps = 32/304 (10%)

Query: 607 SDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKN 666
           S++E E +   + D   +LS D  GN ++QK FE  +   KDI++ +    L ++ +   
Sbjct: 470 SNIEKEVIFNEIRDHAIQLSHDVFGNYVIQKFFEFGTKTQKDILVEQFRGKLEALSLEMY 529

Query: 667 GTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQ----CVLKFGFPWNQFI 722
                Q+        ++I  V +      T +I DQ GN+VIQ    C+     P   FI
Sbjct: 530 ACRVIQRAFEFIDEDQKIDLVMELSSSVLT-MIKDQNGNHVIQKTIECIPMSKLP---FI 585

Query: 723 FESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLV 782
            ES+    + +  + YG R V+  LE       E+  +L+ +   +  YL  +  G  ++
Sbjct: 586 LESLRGQIYHLSTHFYGCRVVQRLLEYGSKADQEE--ILNELD-QFIPYLVQDQYGNYVI 642

Query: 783 TWFL--------DTSVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNARKI 834
              L        +  +  ++  I+   ++K +VE   H+ AS  + K + Y G  + ++ 
Sbjct: 643 QHILQHGGDNPAENHIDKSKQDIV-DTISKTVVEFSKHKFASNVVEKTILY-GSASQKRQ 700

Query: 835 ILDSLFGNVNAH-----DSSPPKELTKLLCETNYGPTFVHKVLAMPLLEDDLRAHIIKQV 889
           +LD +      H     D+SP      L+    Y    V K++ +    D  +  I+  +
Sbjct: 701 VLDKILPKDEEHAATLEDTSP----LILMMRDQYANYVVQKLVGVGTGND--KKLIVIAI 754

Query: 890 RKVL 893
           R  L
Sbjct: 755 RSYL 758

>CAGL0L05962g complement(662298..664991) similar to sp|P39016
           Saccharomyces cerevisiae YGL178w MPT5 multicopy
           suppressor of POP2, hypothetical start
          Length = 897

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 109/241 (45%), Gaps = 21/241 (8%)

Query: 595 RELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKT 654
           ++L    +SN   DL  +Q+    L    EL  D  GN ++QKL +  +   +  ++   
Sbjct: 251 KKLETPSESNLVRDLMYDQIKPYFL----ELILDPFGNYLIQKLCDFLTPDQRTALIEAI 306

Query: 655 SKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTP------LINDQFGNYVI 708
              +  + +++ GT + QK+I      +QI  + +G  +  T       LIND  GN+VI
Sbjct: 307 YPNVFQISINQYGTRSLQKIIDTVDDEQQINLIVKGFSNEYTSIRQVVTLINDLNGNHVI 366

Query: 709 Q-CVLKFGFPWNQFIFESIIA--NFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMI 765
           Q C+ KF      FI  +II   N   I  +++G   ++  L    + T +Q+  +S  I
Sbjct: 367 QKCIFKFPASKFDFIIAAIIDQNNIIAISTHKHGCCVLQKLLS---VCTLQQTFKISVKI 423

Query: 766 VTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAP---RLTKRIVELCGHRLASLTILKV 822
           V +   L  +  G  ++ + LD   L     +LA    RL+  I +L   + +S  + K 
Sbjct: 424 VQFLPNLINDQFGNYIIQFLLDIEEL--DFYMLAEFYNRLSGEICQLSCLKFSSNVVEKF 481

Query: 823 L 823
           +
Sbjct: 482 M 482

>KLLA0A09097g 794827..797244 some similarities with sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 805

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 103/235 (43%), Gaps = 21/235 (8%)

Query: 594 LRELRKSIDSNAFSDLEIEQLAIAML----DELPELSSDYLGNTIVQKLFEHSSDIIKDI 649
            R L++ +D N       E++A  +     D + EL +D  GN ++QKLFE  +   +  
Sbjct: 494 CRFLQRQLDENG------EEVASTIYSEIKDHICELMNDPFGNYLMQKLFERINQRDRVE 547

Query: 650 MLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQ 709
           +++  S     + +  +GT A QK++    T  +   +   ++     L  D   N+V+Q
Sbjct: 548 IVKNCSPQFMDIALDAHGTRALQKLVECTDTEEETQILVASLQPSILSLSRDFKSNHVVQ 607

Query: 710 CVLK-FGFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTY 768
            +L+ F     QFI+++   +   I  +R G   V+ CL   D    EQ   L   IV  
Sbjct: 608 KMLENFSNKDTQFIYDAACDDIIKISNHRNGCCVVQRCL---DFGNTEQLDALCGKIVEK 664

Query: 769 AEYLSTNSNGALLVTWFLDTSVLPNRHSILAP--RLTKRIVELCGHRLASLTILK 821
           +  L+ N  G  ++ +     +L        P  + TK+IV++       L++ K
Sbjct: 665 SFELTMNPYGNYVIQY-----ILTKEKDQATPDFKYTKKIVDVLKFNAIDLSLNK 714

>Kwal_33.15113
          Length = 758

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 119/279 (42%), Gaps = 19/279 (6%)

Query: 607 SDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKN 666
           SD E E +   + +E+  L+ D  GN ++QK FE+     +DI+       +  + +   
Sbjct: 442 SDAEKEVIFNEIKEEIITLADDVFGNYVIQKYFEYGLKTHRDILFEHFKGKMEKLSLQMY 501

Query: 667 GTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQ-CVLKFGFPWNQFIFES 725
                Q+ +      ++++ V + +      +I DQ GN+VIQ  + +       FI +S
Sbjct: 502 ACRVIQRALECIDEEQKVILVEE-LSGCVLQMIKDQNGNHVIQKAIERIPIARLPFILKS 560

Query: 726 IIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWF 785
           +    + +  + YG R V+  LE     T +Q+I+L+ +   +  +L  +  G  ++   
Sbjct: 561 LEGQTYHLSTHSYGCRVVQRLLEYGS--TDDQNIILNDLD-QFIPFLIQDQYGNYVIQHI 617

Query: 786 L----DT--SVLPNRHSILAPRLTKRIVELCGHRLASLTILKVLNYRGDDNAR----KII 835
           L    DT  S +      +   + K IVE   H+ AS  + K + +      R    K++
Sbjct: 618 LKQGPDTSDSHMGRTKQAIVDAVCKSIVEYSKHKFASNVVEKTMVFGSPAQKRQFMEKVL 677

Query: 836 LDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVHKVLAM 874
              +   VN  D++P      L+    Y    V K++ +
Sbjct: 678 PRDVNHAVNLEDNAP----LILMMRDQYANYVVQKLVGV 712

>CAGL0D05544g complement(527482..530217) similar to tr|Q07807
           Saccharomyces cerevisiae YLL013c transcript-specific
           regulator of mRNA degradation, hypothetical start
          Length = 911

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 96/229 (41%), Gaps = 21/229 (9%)

Query: 620 DELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAH 679
           D    L++D  GN ++QK FE+ S   KDI++ +    +  + +        Q+ +    
Sbjct: 606 DHALSLANDVFGNYVIQKFFEYGSKTQKDILVEQFRGKMEELSLQMYACRVIQRALEFID 665

Query: 680 TPRQIMQVTQGVKDYCT-PLINDQFGNYVIQ----CVLKFGFPWNQFIFESIIANFWVIV 734
             ++I  V +    +C   +I DQ GN+VIQ    C+     P   FI  S+  + + + 
Sbjct: 666 AQQRIDLVRE--LSHCVLQMIKDQNGNHVIQKAIECIPIDLLP---FILNSLEGHIYHLS 720

Query: 735 QNRYGARAVRACLEAHDIVTPEQSIVLSAMIVTYAEYLSTNSNGALLVTWFL----DTSV 790
            + YG R V+  LE     T E    +   +  +  YL  +  G  ++   L    D ++
Sbjct: 721 THSYGCRVVQRLLE---FGTLEDQKRILEELKDFIPYLIQDQYGNYVIQHILQHGSDVNL 777

Query: 791 LPNRHSILAPRL----TKRIVELCGHRLASLTILKVLNYRGDDNARKII 835
                 ++   +       IVE   H+ AS  + K + Y  DD   +++
Sbjct: 778 ASEHMRVIKQEIINNVADNIVEFSKHKFASNVVEKAIIYGTDDQKIQLM 826

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 108/250 (43%), Gaps = 26/250 (10%)

Query: 531 PPPNVNEKEDLLREIIELFEANSDEYQINSLIKKSLNHKGTSD----TQNFGPLPEPLSG 586
           PPP   E+E +  EI +   + +++   N +I+K   +   +      + F    E LS 
Sbjct: 593 PPP---ERELVFNEIRDHALSLANDVFGNYVIQKFFEYGSKTQKDILVEQFRGKMEELSL 649

Query: 587 REFDPPKLRELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDII 646
           + +    ++   + ID+    DL + +L+  +L    ++  D  GN ++QK  E     +
Sbjct: 650 QMYACRVIQRALEFIDAQQRIDL-VRELSHCVL----QMIKDQNGNHVIQKAIECIPIDL 704

Query: 647 KDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNY 706
              +L     ++  +  H  G    Q+++       Q  ++ + +KD+   LI DQ+GNY
Sbjct: 705 LPFILNSLEGHIYHLSTHSYGCRVVQRLLEFGTLEDQ-KRILEELKDFIPYLIQDQYGNY 763

Query: 707 VIQCVLKFGFPWN----------QFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPE 756
           VIQ +L+ G   N          Q I  ++  N     ++++ +  V   +      T +
Sbjct: 764 VIQHILQHGSDVNLASEHMRVIKQEIINNVADNIVEFSKHKFASNVVEKAI---IYGTDD 820

Query: 757 QSIVLSAMIV 766
           Q I L  MI+
Sbjct: 821 QKIQLMKMIL 830

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 24/130 (18%)

Query: 606 FSDLEIEQLAIAML-DELPELSSDYLGNTIVQKLFEHSSDI---------IKDIMLRKTS 655
           F  LE ++  +  L D +P L  D  GN ++Q + +H SD+         IK  ++   +
Sbjct: 735 FGTLEDQKRILEELKDFIPYLIQDQYGNYVIQHILQHGSDVNLASEHMRVIKQEIINNVA 794

Query: 656 KYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGV----KDYC------TPLI---NDQ 702
             +     HK  +   +K I    T  Q +Q+ + +    K++       +PLI    DQ
Sbjct: 795 DNIVEFSKHKFASNVVEKAIIYG-TDDQKIQLMKMILPRDKEHAANLEEDSPLILMMRDQ 853

Query: 703 FGNYVIQCVL 712
           F NYV+Q ++
Sbjct: 854 FANYVVQKLV 863

>Kwal_20.2729
          Length = 389

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 87/174 (50%), Gaps = 14/174 (8%)

Query: 556 YQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQL- 614
           Y I  L +     + T   ++  P    +S  ++    L+++  ++D+ A  DL I    
Sbjct: 217 YLIQKLCEYLTTDQKTKLVESIYPHVFQISINQYGTRSLQKVIDTVDTEAQIDLIISGFG 276

Query: 615 -AIAMLDELPELSSDYLGNTIVQK-LFEH---SSDIIKDIMLRKTSKYLTSMGVHKNGTW 669
            A   ++++  L +D  GN +VQK +F+      D I + ++ K +  +  +  HK+G  
Sbjct: 277 QAFTSIEQVVVLINDLNGNHVVQKCIFKFPPTKFDFIINAIVDKNN--IVKISTHKHGCC 334

Query: 670 ACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCV-----LKFGFPW 718
             QK++++  T +QI +++  +  +   LINDQFGNY+IQ +     L F  PW
Sbjct: 335 VLQKLLSVC-TLQQIFKISVKIVQFLRNLINDQFGNYIIQFLLDIKELDFYLPW 387

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 91/206 (44%), Gaps = 16/206 (7%)

Query: 595 RELRKSIDSNAFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKT 654
           ++L    +     DL  +Q+    LD    L  D  GN ++QKL E+ +   K  ++   
Sbjct: 183 KKLETPQECCTVRDLMYQQIQPFFLD----LILDPFGNYLIQKLCEYLTTDQKTKLVESI 238

Query: 655 SKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTP------LINDQFGNYVI 708
             ++  + +++ GT + QK+I    T  QI  +  G     T       LIND  GN+V+
Sbjct: 239 YPHVFQISINQYGTRSLQKVIDTVDTEAQIDLIISGFGQAFTSIEQVVVLINDLNGNHVV 298

Query: 709 Q-CVLKFGFPWNQFIFESIIA--NFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMI 765
           Q C+ KF      FI  +I+   N   I  +++G   ++  L    + T +Q   +S  I
Sbjct: 299 QKCIFKFPPTKFDFIINAIVDKNNIVKISTHKHGCCVLQKLLS---VCTLQQIFKISVKI 355

Query: 766 VTYAEYLSTNSNGALLVTWFLDTSVL 791
           V +   L  +  G  ++ + LD   L
Sbjct: 356 VQFLRNLINDQFGNYIIQFLLDIKEL 381

>Sklu_2033.2 YGL178W, Contig c2033 2461-4695
          Length = 744

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 103/229 (44%), Gaps = 22/229 (9%)

Query: 595 RELRKSIDSN----AFSDLEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIM 650
           R L+K +DS+    A  DL  + +    L    EL  D  GN ++QKL ++ +   K  +
Sbjct: 158 RFLQKKLDSSTKYEAVRDLMYQGIQPFFL----ELILDPFGNYLIQKLCDYLTLDQKTTL 213

Query: 651 LRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCT------PLINDQFG 704
           ++     +  + +++ GT + QK+I       QI  + +G     T       LIND  G
Sbjct: 214 IQDIYPNVFQISINQYGTRSLQKIIDTVDNESQIDMLIKGFSQQFTSIEQVVTLINDLNG 273

Query: 705 NYVIQ-CVLKFGFPWNQFIFESIIA--NFWVIVQNRYGARAVRACLEAHDIVTPEQSIVL 761
           N+VIQ C+ KF      FI ++I+   N   I  +++G   ++  L    + T +Q   +
Sbjct: 274 NHVIQKCIFKFPPTKFDFIIDAIVEQDNIIKISTHKHGCCVLQKLLS---VCTLQQIFKI 330

Query: 762 SAMIVTYAEYLSTNSNGALLVTWFLDTSVLPNRHSILAPRLTKRIVELC 810
           S  IV +   L  +  G  ++ + LD   L     +L    +K   ELC
Sbjct: 331 SVKIVQFLPGLINDQFGNYIIQFLLDIKEL--DFYLLGEIFSKLSNELC 377

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 114/244 (46%), Gaps = 38/244 (15%)

Query: 559 NSLIKKSLNH----KGTSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQL 614
           N LI+K  ++    + T+  Q+  P    +S  ++    L+++  ++D+ +  D+ I+  
Sbjct: 195 NYLIQKLCDYLTLDQKTTLIQDIYPNVFQISINQYGTRSLQKIIDTVDNESQIDMLIKGF 254

Query: 615 A--IAMLDELPELSSDYLGNTIVQK-LFEH---SSDIIKDIMLRKTSKYLTSMGVHKNGT 668
           +     ++++  L +D  GN ++QK +F+      D I D ++ + +  +  +  HK+G 
Sbjct: 255 SQQFTSIEQVVTLINDLNGNHVIQKCIFKFPPTKFDFIIDAIVEQDN--IIKISTHKHGC 312

Query: 669 WACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKF-------------- 714
              QK++++  T +QI +++  +  +   LINDQFGNY+IQ +L                
Sbjct: 313 CVLQKLLSVC-TLQQIFKISVKIVQFLPGLINDQFGNYIIQFLLDIKELDFYLLGEIFSK 371

Query: 715 ---------GFPWNQFIFESIIANFWVIVQNRYGARAVRACLEAHDIVTPEQSIVLSAMI 765
                       ++  + E  +   + IV+N    ++     E  D+VT   +I+L+ + 
Sbjct: 372 LSNELCQLSCLKFSSNVVEKFVKKLFRIVENSLATQSNSG--EVDDVVTVAMNILLTIID 429

Query: 766 VTYA 769
           +  A
Sbjct: 430 IFTA 433

>YGL178W (MPT5) [1813] chr7 (167356..167358,167999..170575) Protein
           required for high temperature growth, recovery from
           alpha-factor arrest, post-transcriptional regulation of
           HO expression, and normal life span of yeast cells [2580
           bp, 859 aa]
          Length = 859

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 76/135 (56%), Gaps = 9/135 (6%)

Query: 584 LSGREFDPPKLRELRKSIDSNAFSDLEIEQLA--IAMLDELPELSSDYLGNTIVQK-LFE 640
           +S  ++    L+++  ++D+    DL I+  +     ++++  L +D  GN ++QK +F+
Sbjct: 292 ISINQYGTRSLQKIIDTVDNEVQIDLIIKGFSQEFTSIEQVVTLINDLNGNHVIQKCIFK 351

Query: 641 HSSD---IIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKDYCTP 697
            S      I D ++ + +  + ++  HK+G    QK++++  T +QI +++  +  +   
Sbjct: 352 FSPSKFGFIIDAIVEQNN--IITISTHKHGCCVLQKLLSVC-TLQQIFKISVKIVQFLPG 408

Query: 698 LINDQFGNYVIQCVL 712
           LINDQFGNY+IQ +L
Sbjct: 409 LINDQFGNYIIQFLL 423

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 60/146 (41%), Gaps = 41/146 (28%)

Query: 609 LEIEQLAIAMLDELPELSSDYLGNTIVQKLFE--HSSDIIKDIMLRKTSKYLTSMGVHKN 666
           +EI  L +  LD + +L++D  G   +QK  E    S++++D+M  +             
Sbjct: 203 VEISALPLRDLDYI-KLATDQFGCRFLQKKLETPSESNMVRDLMYEQ------------- 248

Query: 667 GTWACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKF-GFPWNQFIFES 725
                                   +K +   LI D FGNY++Q +  +        + ++
Sbjct: 249 ------------------------IKPFFLDLILDPFGNYLVQKLCDYLTAEQKTLLIQT 284

Query: 726 IIANFWVIVQNRYGARAVRACLEAHD 751
           I  N + I  N+YG R+++  ++  D
Sbjct: 285 IYPNVFQISINQYGTRSLQKIIDTVD 310

>KLLA0E13629g complement(1201715..1204183) some similarities with
           sp|P39016 Saccharomyces cerevisiae YGL178w MPT5
           multicopy suppressor of POP2, hypothetical start
          Length = 822

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 108/223 (48%), Gaps = 23/223 (10%)

Query: 556 YQINSLIKKSLNHKGTSDTQNFGPLPEPLSGREFDPPKLRELRKSIDSNAFSDLEIEQLA 615
           Y I  L       + T+  ++  P    +S  ++    L+++  ++++    D+ I   +
Sbjct: 230 YLIQKLCDYLTTDQKTAMIKDIYPSVFQISINQYGTRSLQKIIDTVETQEHIDMIIRGFS 289

Query: 616 I--AMLDELPELSSDYLGNTIVQK-LFEH---SSDIIKDIMLRKTSKYLTSMGVHKNGTW 669
                ++++  L +D  GN ++QK +F+    + D I D ++   +  + ++  HK+G  
Sbjct: 290 QEHTSIEQVVTLINDLNGNHVIQKCIFKFQPANFDFIIDAIVNNDN--IITISTHKHGCC 347

Query: 670 ACQKMITMAHTPRQIMQVTQGVKDYCTPLINDQFGNYVIQCVLKFGFPWNQFIFESIIAN 729
             QK++++  T +QI +++  +  Y   LINDQFGNY+I           QF+F+    +
Sbjct: 348 VLQKLLSVC-TLQQIFKISVKIIQYLPSLINDQFGNYII-----------QFLFDIKELD 395

Query: 730 FWVIVQ--NRYGARAVR-ACLEAHDIVTPEQSIVLSAMIVTYA 769
           F+++ +  N+   +  + +CL+    V  +    L A+++ Y 
Sbjct: 396 FYLLGETFNKLSQKLCQLSCLKFSSNVVEKYIKKLFAIVMNYV 438

>Scas_621.10
          Length = 415

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 6/61 (9%)

Query: 358 NNAINLTSTSLATLCSKYGEVISAR------TLRNLNMALVEFSSVESAVKALDSLQGKE 411
           N + N    +++ L SKYGE+IS R      T +      V++++VE A KAL+ LQG+ 
Sbjct: 268 NLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEY 327

Query: 412 V 412
           +
Sbjct: 328 I 328

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 358 NNAINLTSTSLATLCSKYGEVISAR------TLRNLNMALVEFSSVESAVKALDSLQGKE 411
           N + N    ++  L +K+GEV+S R      T +      V+FS++E A KALD+LQG+ 
Sbjct: 273 NLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEY 332

Query: 412 VSMIGAPSKISFAKILP 428
           +     P ++ F+   P
Sbjct: 333 ID--NRPVRLDFSSPRP 347

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 28/116 (24%)

Query: 312 EIDPQSINWVTMDPTVPSINQISNLL---------PTNTISISNVFPLQHQQPQLNNAIN 362
           EID + IN V M  + P++N   +           P++T+ + N+            + N
Sbjct: 241 EIDGRPIN-VDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNL------------SFN 287

Query: 363 LTSTSLATLCSKYGEVISAR------TLRNLNMALVEFSSVESAVKALDSLQGKEV 412
               ++  +  K+GE+IS R      T +      V+++S++ A KAL++LQG+ +
Sbjct: 288 ADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYI 343

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 358 NNAINLTSTSLATLCSKYGEVISAR------TLRNLNMALVEFSSVESAVKALDSLQGKE 411
           N + N    +L  L SK+G VIS R      + +      V++ SVE A  ALD+LQG+ 
Sbjct: 274 NLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEY 333

Query: 412 VSMIGAPSKISFAKILPMHQ 431
           +     P +I F+   P  Q
Sbjct: 334 ID--NRPVRIDFSSPRPPQQ 351

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 16/100 (16%)

Query: 327 VPSINQISNLLPTNTISISNVFPLQHQQPQLNNAINLTSTSLATLCSKYGEVISARTLRN 386
           VP+ +Q    L +NT      FPL  Q+ +LN            +   +G +   + L  
Sbjct: 92  VPTFHQQEGEL-SNTRLFVRPFPLDVQESELNE-----------IFGPFGAMKEVKILNG 139

Query: 387 LNMALVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKI 426
              A VEF   ESA KA++ + GK  +    P ++ F+K+
Sbjct: 140 F--AFVEFEEAESASKAIEEVNGK--TFANQPLEVMFSKM 175

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 368 LATLCSKYGEVISAR------TLRNLNMALVEFSSVESAVKALDSLQGKEV 412
           L  +  KYGE++S R      T +      V++ S+E A KA + LQG+ +
Sbjct: 313 LYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYI 363

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 361 INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKE 411
           ++LT+ +      KYG+++S +  R  N+  + F    SA  A+D   GKE
Sbjct: 202 LSLTTRAFYDTFKKYGKILSCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKE 252

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 361 INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSK 420
            ++  + L  + S +G +   + L     A VEF   ESA KA+D + GK  +    P +
Sbjct: 84  FDVQESELNEIFSPFGPMKEVKILNGF--AFVEFEESESAAKAIDEVNGK--TFANQPLE 139

Query: 421 ISFAKILPMH 430
           + ++K+ P  
Sbjct: 140 VVYSKLPPQR 149

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 6/61 (9%)

Query: 358 NNAINLTSTSLATLCSKYGEVISAR------TLRNLNMALVEFSSVESAVKALDSLQGKE 411
           N + N    +L  + S++GEVIS R      T +      V++ S++ A KA ++LQG+ 
Sbjct: 280 NLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEY 339

Query: 412 V 412
           +
Sbjct: 340 I 340

>Scas_611.12
          Length = 102

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 363 LTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQ 408
            T  SL  L  +YGEV     L   N   + F+++ +A+ ALD ++
Sbjct: 32  FTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIK 77

>KLLA0C12331g 1049113..1051101 similar to sgd|S0002904 Saccharomyces
           cerevisiae YDR496c, start by similarity
          Length = 662

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 52/111 (46%), Gaps = 14/111 (12%)

Query: 634 IVQKLFEHSSDIIKDIMLRKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGVKD 693
           +  +++E S+D I+D++L+             + +   Q ++  +   R+  Q+T  +KD
Sbjct: 154 LCNEIWELSNDCIEDLVLKH------------DASRIVQTLVKYSSKERR-EQITLALKD 200

Query: 694 YCTPLINDQFGNYVIQCVLKFG-FPWNQFIFESIIANFWVIVQNRYGARAV 743
               L    +G Y++  +L +G     Q I + +  N   ++++R GA  V
Sbjct: 201 KIYVLATSSYGKYLLVKLLHYGSRKSRQIIIDQLHGNLRKLMRHREGAYVV 251

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 361 INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSK 420
           +++  + L  +   +G +   + L     A VEF   ESA KA++ + GK  S    P +
Sbjct: 134 LDVQESELNEIFGPFGPMKEVKILNGF--AFVEFEEAESAAKAIEEVHGK--SFANQPLE 189

Query: 421 ISFAKI 426
           + ++K+
Sbjct: 190 VVYSKL 195

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 361 INLTSTSLATLCSKYGEVISA------RTLRNLNMALVEFSSVESAVKALDSLQGKEVSM 414
           +++   +LA    ++   I A      +T R+     V FS+ E A KA+D++QGK++S 
Sbjct: 155 VDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLS- 213

Query: 415 IGAPSKISFA 424
            G   +I++A
Sbjct: 214 -GRQIRINWA 222

>CAGL0C01419g complement(153063..154982) similar to sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 639

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 363 LTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGK 410
           LT   L     +YGE+ S + +   ++A V FSS+ +A+K + +L  K
Sbjct: 335 LTEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQK 382

>Kwal_47.18572
          Length = 363

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 361 INLTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSK 420
            ++  + L  +   +G +   + L     A VEF   +SA +A++ + GK  +    P +
Sbjct: 91  FDVQDSELNEIFGPFGPMKEVKILNGF--AFVEFEEADSAARAIEEVNGK--TFANQPLE 146

Query: 421 ISFAKILPMHQQPPQFLL 438
           + ++K+     QPP++ +
Sbjct: 147 VVYSKV-----QPPRYRM 159

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 15/97 (15%)

Query: 320 WVTMDPTVPSINQISNLLPTNTISISNVFPLQHQQPQLNNAINLTSTSLATLCSKYGEVI 379
           +V M   VP  ++IS L      + +N++         N  +  T      L S+YGE++
Sbjct: 209 YVAM--HVPKKDRISKLEEAKA-NFTNIYVK-------NIDVETTDEEFEQLFSQYGEIV 258

Query: 380 SARTLRNL-----NMALVEFSSVESAVKALDSLQGKE 411
           SA   ++          V F    +A KA++ L GKE
Sbjct: 259 SAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKE 295

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 385 RNLNMALVEFSSVESAVKALDSLQGKE 411
           R+  +A V+F+S E AV+A++ L GKE
Sbjct: 48  RSFGIAYVDFTSSEEAVRAVEELNGKE 74

>Kwal_27.11158
          Length = 567

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 363 LTSTSLATLCSKYGEVISARTLRNLNMALVEFSSVESAVKALDSLQGKEVSMIGAPSKIS 422
           +T   L    S YGE+ S + +    +A V F S+ SA+K + SL    V+   A  KI 
Sbjct: 263 VTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAA--VNPYYANKKIF 320

Query: 423 FAK 425
           + K
Sbjct: 321 YGK 323

>Scas_700.5
          Length = 450

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 830 NARKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPT 866
           N  KI+ D LF +   H++  PK +T L CE +  PT
Sbjct: 204 NGLKILTDPLFSDFLIHETFGPKRITSLPCEISDVPT 240

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 389 MALVEFSSVESAVKALDSLQGKEVSMIGAPSKISFAKILP 428
           +A   F++ E   + + SL GKE+S  G   K+ + K+LP
Sbjct: 128 LAFANFTTPEETTQVITSLNGKEIS--GRKLKVEYKKMLP 165

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 832 RKIILDSLFGNVNAHDSSPPKELTKLLCETNYGPTFVH-----KVLAMPLLEDDLRAHII 886
           R +IL S+   +N     P +EL K+L  +NYG TF +     K      LE   R  + 
Sbjct: 341 RAVILHSIGAGMNKGTQIPEEELEKMLMTSNYG-TFTYNDYEKKEKTRTSLES--RKSVK 397

Query: 887 KQVRKVLTD 895
           K + KV+TD
Sbjct: 398 KLLEKVITD 406

>Sklu_2238.3 YKR016W, Contig c2238 5850-7409
          Length = 519

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 11/92 (11%)

Query: 322 TMDPTVPSINQISNLLPTNTI-SISNVF-PLQHQQPQLNNAIN---------LTSTSLAT 370
           +++ T+ SIN  S LLP   I SI+  +  L     QLN ++N          TS  L +
Sbjct: 162 SLNATIESINSQSLLLPEEIINSITTTYNKLYSTVAQLNESLNDILSAEINKKTSEQLTS 221

Query: 371 LCSKYGEVISARTLRNLNMALVEFSSVESAVK 402
           L  KYG++  ++ L      L EF+  ++ ++
Sbjct: 222 LEEKYGQLAKSKELELTEKFLNEFNGFKAQLE 253

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 30,795,578
Number of extensions: 1268174
Number of successful extensions: 4518
Number of sequences better than 10.0: 76
Number of HSP's gapped: 4510
Number of HSP's successfully gapped: 118
Length of query: 1072
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 960
Effective length of database: 12,718,893
Effective search space: 12210137280
Effective search space used: 12210137280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)