Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR025C (BNA1)1771759441e-132
Sklu_1420.31761777046e-96
Kwal_33.155221761766846e-93
ACL127W1801766449e-87
KLLA0E20119g21479650.91
KLLA0E07898g89572623.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR025C
         (175 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR025C (BNA1) [2925] chr10 complement(471052..471585) 3-hydroxy...   368   e-132
Sklu_1420.3 YJR025C, Contig c1420 1151-1681                           275   6e-96
Kwal_33.15522                                                         268   6e-93
ACL127W [922] [Homologous to ScYJR025C (BNA1) - SH] complement(1...   252   9e-87
KLLA0E20119g 1783264..1783908 similar to sp|P34222 Saccharomyces...    30   0.91 
KLLA0E07898g 712370..715057 similar to sp|P40462 Saccharomyces c...    28   3.8  

>YJR025C (BNA1) [2925] chr10 complement(471052..471585)
           3-hydroxyanthranilate 3,4-dioxygenase, involved in
           biosynthesis of nicotinic acid from tryptophan [534 bp,
           177 aa]
          Length = 177

 Score =  368 bits (944), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%)

Query: 1   MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK 60
           MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK
Sbjct: 1   MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK 60

Query: 61  KGSMLLKVVDETDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGEND 120
           KGSMLLKVVDETDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGEND
Sbjct: 61  KGSMLLKVVDETDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGEND 120

Query: 121 KIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ 175
           KIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ
Sbjct: 121 KIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ 175

>Sklu_1420.3 YJR025C, Contig c1420 1151-1681
          Length = 176

 Score =  275 bits (704), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 3/177 (1%)

Query: 1   MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK 60
           M NTTPINI KWL+EN  LL+PPVNNYCLH+GGFTVMI+GGPNERT YH+NPTPEWF+Q+
Sbjct: 1   MLNTTPINIPKWLEENSHLLQPPVNNYCLHRGGFTVMIIGGPNERTDYHVNPTPEWFHQR 60

Query: 61  KGSMLLKVVDE--TDAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGE 118
           KGSM L+VVDE  TDA  KF D+IINEGDSYLLP NVPH+PVR+ +TVGIVVEQDRP G 
Sbjct: 61  KGSMTLRVVDESLTDAS-KFKDVIINEGDSYLLPANVPHNPVRYENTVGIVVEQDRPDGA 119

Query: 119 NDKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ 175
           +DK+RWYC  C++VV E + QM+DLGTQVKE I+ FEND+EKRTC +C TLNY++PQ
Sbjct: 120 HDKLRWYCFKCKEVVCELDFQMVDLGTQVKEGIMLFENDMEKRTCKNCGTLNYSKPQ 176

>Kwal_33.15522
          Length = 176

 Score =  268 bits (684), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 128/176 (72%), Positives = 145/176 (82%), Gaps = 1/176 (0%)

Query: 1   MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK 60
           M NTTPINI+KWL+EN  LL+PPVNN+CLH+GGFTVMIVGGPNERT YH+NPTPEWFYQK
Sbjct: 1   MLNTTPINIEKWLQENGHLLQPPVNNFCLHRGGFTVMIVGGPNERTDYHVNPTPEWFYQK 60

Query: 61  KGSMLLKVVDET-DAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGEN 119
           KG M LKVVDET   E KF D+ I EGDS+LLP NVPH+PVR+ADTVGIVVEQDRP G++
Sbjct: 61  KGYMTLKVVDETLQGELKFKDVTIEEGDSFLLPANVPHNPVRYADTVGIVVEQDRPEGQH 120

Query: 120 DKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ 175
           DK RWYCS CR+VV E E QMLDLGTQVKE I  F++D   R C HC T N++ PQ
Sbjct: 121 DKQRWYCSKCREVVCEFEFQMLDLGTQVKEGIQKFDSDKNFRICKHCGTENFSSPQ 176

>ACL127W [922] [Homologous to ScYJR025C (BNA1) - SH]
           complement(127228..127770) [543 bp, 180 aa]
          Length = 180

 Score =  252 bits (644), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 114/176 (64%), Positives = 134/176 (76%), Gaps = 1/176 (0%)

Query: 1   MFNTTPINIDKWLKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQK 60
           M NTTPINID WL EN  LL+PPVNN+CLH+GGFTVM+VGGPNERT YH+NPTPEWFYQK
Sbjct: 1   MLNTTPINIDAWLAENSHLLQPPVNNFCLHRGGFTVMLVGGPNERTDYHVNPTPEWFYQK 60

Query: 61  KGSMLLKVVDET-DAEPKFIDIIINEGDSYLLPGNVPHSPVRFADTVGIVVEQDRPGGEN 119
            G+M L++VDE      +F D+ I EGDS+LLP NVPH+PVR+ADTVGIVVEQDRP G  
Sbjct: 61  TGAMTLRIVDEQLSGAARFRDVTIREGDSFLLPANVPHNPVRYADTVGIVVEQDRPAGHF 120

Query: 120 DKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARPQ 175
           D++RWYC  CR++V + E  M DL +QV+E I  F    E R C HC TLNY  PQ
Sbjct: 121 DQLRWYCRGCRELVCKYEFYMSDLSSQVREGIERFAASAEDRVCKHCGTLNYPTPQ 176

>KLLA0E20119g 1783264..1783908 similar to sp|P34222 Saccharomyces
           cerevisiae YBL057c singleton, start by similarity
          Length = 214

 Score = 29.6 bits (65), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/79 (20%), Positives = 33/79 (41%)

Query: 13  LKENEGLLKPPVNNYCLHKGGFTVMIVGGPNERTGYHINPTPEWFYQKKGSMLLKVVDET 72
           ++++ G+ K  +   C H       ++     RT Y+   T  W  + +  + LK  D+ 
Sbjct: 100 IRQDLGMTKGKIAAQCCHAALACFRLIACDPSRTSYNPEMTHRWLARGQAKITLKCPDKE 159

Query: 73  DAEPKFIDIIINEGDSYLL 91
             +  F   I    +SY++
Sbjct: 160 TMDELFAKAIALGVNSYVV 178

>KLLA0E07898g 712370..715057 similar to sp|P40462 Saccharomyces
           cerevisiae YIL137c, start by similarity
          Length = 895

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 6/72 (8%)

Query: 89  YLLPGNVPHSPVRFADTVGIVVEQDRPGGENDKIRWYCSHCRQVVHESEL---QMLDLGT 145
           Y L  NV H    F   + + ++Q +PG   +K ++   HC+Q++    L   + L +  
Sbjct: 14  YTLDLNVDHKQPNFKGQLTVQLKQRQPGQSFNKFKF---HCKQLIVTKVLLSDKPLSISY 70

Query: 146 QVKEAILDFEND 157
              E  + F +D
Sbjct: 71  DANEQTVSFSSD 82

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.139    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,781,137
Number of extensions: 308314
Number of successful extensions: 633
Number of sequences better than 10.0: 7
Number of HSP's gapped: 630
Number of HSP's successfully gapped: 7
Length of query: 175
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 80
Effective length of database: 13,307,399
Effective search space: 1064591920
Effective search space used: 1064591920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)