Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR024C24424112960.0
Kwal_33.155192572359401e-129
Sklu_1420.42612409351e-128
ACL126W2422398461e-115
Scas_647.172952368441e-114
CAGL0M07876g2082147345e-99
KLLA0E16489g2052095122e-65
YGR165W (MRPS35)34541671.4
KLLA0F01144g60453661.9
Sklu_2297.341950633.7
CAGL0B00330g113654644.0
Kwal_34.1597759793617.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR024C
         (241 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR024C (YJR024C) [2924] chr10 complement(470144..470878) Protei...   503   0.0  
Kwal_33.15519                                                         366   e-129
Sklu_1420.4 YJR024C, Contig c1420 2487-3272                           364   e-128
ACL126W [923] [Homologous to ScYJR024C - SH] complement(127882.....   330   e-115
Scas_647.17                                                           329   e-114
CAGL0M07876g complement(785578..786204) highly similar to sp|P47...   287   5e-99
KLLA0E16489g 1467102..1467719 similar to sp|P47095 Saccharomyces...   201   2e-65
YGR165W (MRPS35) [2117] chr7 (829119..830156) Protein of the mit...    30   1.4  
KLLA0F01144g 105169..106983 weakly similar to sp|Q08622 Saccharo...    30   1.9  
Sklu_2297.3 YDR125C, Contig c2297 3633-4892                            29   3.7  
CAGL0B00330g complement(18031..21441) similar to sp|P25588 Sacch...    29   4.0  
Kwal_34.15977                                                          28   7.8  

>YJR024C (YJR024C) [2924] chr10 complement(470144..470878) Protein
           with a possible role in carbohydrate metabolism, has
           similarity to enterobacterial L-ribose-5-phosphate
           4-epimerases [735 bp, 244 aa]
          Length = 244

 Score =  503 bits (1296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/241 (100%), Positives = 241/241 (100%)

Query: 1   MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKE 60
           MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKE
Sbjct: 1   MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKE 60

Query: 61  KMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLF 120
           KMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLF
Sbjct: 61  KMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLF 120

Query: 121 GDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKD 180
           GDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKD
Sbjct: 121 GDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKD 180

Query: 181 YPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK 240
           YPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK
Sbjct: 181 YPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK 240

Query: 241 M 241
           M
Sbjct: 241 M 241

>Kwal_33.15519
          Length = 257

 Score =  366 bits (940), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 171/235 (72%), Positives = 199/235 (84%)

Query: 5   DVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEKMIP 64
           DVLIHS+DP HPANLICTLCK F+ NNW TGTGGGISIK P T + Y+APSGVQKE++ P
Sbjct: 23  DVLIHSEDPHHPANLICTLCKLFYFNNWVTGTGGGISIKHPETGHIYIAPSGVQKEQLKP 82

Query: 65  EDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLFGDEF 124
           E +FVMD    EYLR P +YKPSACTPLF++CYQK+ AGA+IHTHSQ+AV+CSL+F  EF
Sbjct: 83  EHMFVMDPANGEYLRVPAIYKPSACTPLFMSCYQKRAAGAVIHTHSQHAVMCSLIFDKEF 142

Query: 125 RIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYPDT 184
           RIANIEQIKAIPSGK DP T K + LSFFDTL IPII+N AHE++L D L +  + YP+ 
Sbjct: 143 RIANIEQIKAIPSGKKDPATNKDINLSFFDTLVIPIIDNTAHEEDLTDGLQEAIQAYPNA 202

Query: 185 CAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHL 239
            AVIVRRHGI+VWGPT+DKAK++NEAIDYLMELA KM+QMGIP DCGIGEEKK+L
Sbjct: 203 TAVIVRRHGIYVWGPTVDKAKVYNEAIDYLMELACKMHQMGIPSDCGIGEEKKYL 257

>Sklu_1420.4 YJR024C, Contig c1420 2487-3272
          Length = 261

 Score =  364 bits (935), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 165/240 (68%), Positives = 206/240 (85%)

Query: 1   MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKE 60
           +SSQ+ L+ S+DP HPANLIC+LCK F++NNW TGTGGGISIK  +T + Y+APSGVQKE
Sbjct: 21  LSSQNSLLISNDPKHPANLICSLCKLFYYNNWVTGTGGGISIKHHDTGHIYIAPSGVQKE 80

Query: 61  KMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLF 120
           ++ PED+FVMD++T EY+ +P  YKPSACTPLF++CY+++NAGA+IHTHSQ+AVICSL+F
Sbjct: 81  QLQPEDMFVMDSKTGEYISTPTKYKPSACTPLFMSCYKQRNAGAVIHTHSQHAVICSLIF 140

Query: 121 GDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKD 180
             EF+IANIEQIKAIPSG+ DP T K + LSFFDTL IPIIEN AHE++L D L +    
Sbjct: 141 EKEFKIANIEQIKAIPSGEKDPATGKDINLSFFDTLSIPIIENTAHEEDLTDGLQEALAR 200

Query: 181 YPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK 240
           YP+  AVIVRRHGI+VWGP+++KAK++NEAIDYLMELA+KMY +GIP DCGIGEEKK+LK
Sbjct: 201 YPNATAVIVRRHGIYVWGPSVEKAKVYNEAIDYLMELAVKMYFLGIPTDCGIGEEKKYLK 260

>ACL126W [923] [Homologous to ScYJR024C - SH]
           complement(127882..128610) [729 bp, 242 aa]
          Length = 242

 Score =  330 bits (846), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 192/239 (80%), Gaps = 1/239 (0%)

Query: 2   SSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEK 61
           ++Q  L+ S+D  HPAN+IC LC+ F+ NNW TGTGGGISIK P T + Y+APSGVQKE+
Sbjct: 4   AAQTSLVVSEDRRHPANVICALCRLFYANNWVTGTGGGISIKHPATGHIYIAPSGVQKEQ 63

Query: 62  MIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLFG 121
           + PEDLFV+D     YLR+P  ++PSACTPLFLACY+ + AGA+IHTHSQ+AV+C+LLF 
Sbjct: 64  IEPEDLFVLDGVDGAYLRAPAGHRPSACTPLFLACYRARGAGAVIHTHSQHAVLCTLLFD 123

Query: 122 DEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDY 181
           D FRIANIEQIKA+PSG+ D    KP++LSFFDTL+IPII+N AHE++L   L      +
Sbjct: 124 DVFRIANIEQIKALPSGRRD-AAGKPLSLSFFDTLEIPIIDNTAHEEDLAPGLEAALARH 182

Query: 182 PDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK 240
           P   AV+VRRHGI+VWGPT D+AK++NEAIDYL+ELA+ M+++G+PPDC IGEEK+ L+
Sbjct: 183 PACTAVLVRRHGIYVWGPTADRAKVYNEAIDYLLELAVHMHRLGVPPDCPIGEEKRFLR 241

>Scas_647.17
          Length = 295

 Score =  329 bits (844), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/236 (66%), Positives = 187/236 (79%), Gaps = 4/236 (1%)

Query: 8   IHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEKMIPEDL 67
           + S+D  HPANLIC+L +QF++NNWCTGTGGG+SIKDP +   Y  PSGVQKE M P DL
Sbjct: 60  VDSNDSIHPANLICSLSRQFYNNNWCTGTGGGLSIKDPQSRLTYFTPSGVQKELMTPSDL 119

Query: 68  FVMDAQTLEYLRSP---KLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLFGDEF 124
           +V +    EY+  P   K YKPSACTPLF  CY+ KNAGA+IHTHSQNAVICS++FGDEF
Sbjct: 120 YVRNEDG-EYVNKPLVSKNYKPSACTPLFSICYEAKNAGAVIHTHSQNAVICSMIFGDEF 178

Query: 125 RIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYPDT 184
           +I+NIEQIKAIP+G+VDP T K   L  FDTL IPII+NM HEDEL D  H+  + YP+T
Sbjct: 179 QISNIEQIKAIPNGEVDPNTGKLKYLQNFDTLVIPIIDNMPHEDELQDSFHEILRSYPNT 238

Query: 185 CAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLK 240
            A+IVRRHGIFVWG +I KAKI NEAIDYLMELAIKM+++GIP  C IG+EKK+LK
Sbjct: 239 VAIIVRRHGIFVWGDSIAKAKIHNEAIDYLMELAIKMHKLGIPSTCPIGDEKKYLK 294

>CAGL0M07876g complement(785578..786204) highly similar to sp|P47095
           Saccharomyces cerevisiae YJR024c, hypothetical start
          Length = 208

 Score =  287 bits (734), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 168/214 (78%), Gaps = 15/214 (7%)

Query: 17  ANLICTLCKQFFHNNWCTGTGGGISIKDPN--TNYYYLAPSGVQKEKMIPEDLFVMDAQT 74
           A LICTLCKQF+H NWCTGTGGGISI++ N  ++  Y+APSGVQKE M PEDLFVMD   
Sbjct: 5   AELICTLCKQFYHLNWCTGTGGGISIRERNGESDVAYIAPSGVQKELMRPEDLFVMDLIK 64

Query: 75  LEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLFGDEFRIANIEQIKA 134
            +YL  P+  KPSACTPLFLACY+K+N+GA+IHTHSQNAV+CSLLF  EF+I+NIEQIKA
Sbjct: 65  GDYLSIPRGLKPSACTPLFLACYKKRNSGAVIHTHSQNAVMCSLLFDKEFKISNIEQIKA 124

Query: 135 IPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYP-DTCAVIVRRHG 193
           +P+              ++DTL IPIIENMAHEDELID L+     Y  DT AVIVRRHG
Sbjct: 125 MPNH------------GYYDTLTIPIIENMAHEDELIDQLNDVLDKYSQDTVAVIVRRHG 172

Query: 194 IFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIP 227
           IFVWGP+I+K KI+NEAIDYL+ELA+KM+Q  IP
Sbjct: 173 IFVWGPSIEKCKIYNEAIDYLLELALKMHQYNIP 206

>KLLA0E16489g 1467102..1467719 similar to sp|P47095 Saccharomyces
           cerevisiae YJR024c singleton, start by similarity
          Length = 205

 Score =  201 bits (512), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 136/209 (65%), Gaps = 9/209 (4%)

Query: 17  ANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEKMIPEDLFVMDAQTLE 76
           +  IC++C+ F+ N W  GTGGGI IK    N  Y++PSG++KE + PE +   + Q   
Sbjct: 5   SETICSMCQLFYVNKWVLGTGGGIGIK--QDNIAYISPSGIEKELLEPEQIVKYNIQDDT 62

Query: 77  YLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLFGDEFRIANIEQIKAIP 136
           Y       KPSACTPLFL  ++   A  +IHTHS NAV+CS+++  EF I +IEQIKAIP
Sbjct: 63  YQCGAPGLKPSACTPLFLELFKTLGASCVIHTHSINAVLCSMIYEKEFTIKDIEQIKAIP 122

Query: 137 SGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYPDTCAVIVRRHGIFV 196
            G           L   DTL+IPII+N   E +L+  L +  KDYP+ CAV+V+RHG+FV
Sbjct: 123 KGD-------GTNLRNVDTLRIPIIDNAPEEQDLMPALKQMIKDYPNACAVLVKRHGLFV 175

Query: 197 WGPTIDKAKIFNEAIDYLMELAIKMYQMG 225
           WGPT  KAKI+ E+IDYL E+A+KM ++G
Sbjct: 176 WGPTPKKAKIYIESIDYLFEVALKMKELG 204

>YGR165W (MRPS35) [2117] chr7 (829119..830156) Protein of the
           mitochondrial small ribosomal subunit [1038 bp, 345 aa]
          Length = 345

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 142 PVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYP 182
           PVTKKP+ L +  TL  P +EN   ++   D L + F   P
Sbjct: 101 PVTKKPLQLRYDGTLGPPPVENKRLQNIFKDRLLQPFPSNP 141

>KLLA0F01144g 105169..106983 weakly similar to sp|Q08622
           Saccharomyces cerevisiae YOR205c hypothetical protein,
           start by similarity
          Length = 604

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 25  KQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEKMIPEDL-FVMDAQTLE 76
           KQF     C   G  +  K+P+   YY  P  V+K+    EDL ++M  Q L+
Sbjct: 63  KQFTRFVSCKSCGVELQSKNPSVTGYYKPPRAVRKDAGTIEDLKYLMFTQELQ 115

>Sklu_2297.3 YDR125C, Contig c2297 3633-4892
          Length = 419

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 29  HNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEKMIPEDLFVMDAQTLEYL 78
           +N+WC+ T   ++ +DP + YY      +++ + IP  +F    + L  L
Sbjct: 243 NNHWCSNTWYDLNYEDPGSKYY------MRRMRGIPSTVFQSQVKLLRLL 286

>CAGL0B00330g complement(18031..21441) similar to sp|P25588
           Saccharomyces cerevisiae YCL061c, start by similarity
          Length = 1136

 Score = 29.3 bits (64), Expect = 4.0,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 123 EFRIANIEQIKA--IPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDL 174
           EFR    E +K   + +   D +TK P + +FF+++ + ++E+  + D+L D +
Sbjct: 903 EFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQI 956

>Kwal_34.15977
          Length = 597

 Score = 28.1 bits (61), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 12/93 (12%)

Query: 99  KKNAGAIIHTHS------QNAVICSLLFGDEFRIANIEQ----IKAIPSGKVDPVTKKPM 148
           +K+  ++ H+H        N +IC L  G E+R A IE     +K I   K+D V     
Sbjct: 328 EKSVNSLPHSHPLRAISLSNMIICRLKLG-EYRKA-IEDSSVALKLISCAKLDDVIPASD 385

Query: 149 ALSFFDTLKIPIIENMAHEDELIDDLHKTFKDY 181
               F  +   I+ N A   E I+D  K  K+Y
Sbjct: 386 PPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEY 418

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,825,325
Number of extensions: 394889
Number of successful extensions: 830
Number of sequences better than 10.0: 15
Number of HSP's gapped: 823
Number of HSP's successfully gapped: 15
Length of query: 241
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 142
Effective length of database: 13,168,927
Effective search space: 1869987634
Effective search space used: 1869987634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)