Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR021C (REC107)31430916060.0
ACL124W2402592312e-22
Scas_647.15*108951784e-16
KLLA0E16533g2142001432e-10
CAGL0M07832g3641901462e-10
Scas_480.2556111700.78
YGR247W (CPD1)23948671.3
AFR007W848126662.9
YOL069W (NUF2)45167653.3
CAGL0B00682g483127635.4
Kwal_23.331581555636.8
Scas_644.3473107627.8
YAL029C (MYO4)1471100628.2
YKL007W (CAP1)268666110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR021C
         (309 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR021C (REC107) [2922] chr10 complement(468469..469097,469178.....   623   0.0  
ACL124W [925] [Homologous to ScYJR021C (REC107) - SH] complement...    94   2e-22
Scas_647.15*                                                           73   4e-16
KLLA0E16533g join(1468303..1468521,1468683..1469108) some simila...    60   2e-10
CAGL0M07832g join(complement(784445..784724),complement(783505.....    61   2e-10
Scas_480.2                                                             32   0.78 
YGR247W (CPD1) [2194] chr7 (984970..985689) Cyclic nucleotide ph...    30   1.3  
AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C (...    30   2.9  
YOL069W (NUF2) [4750] chr15 (198941..200296) Component of the Ti...    30   3.3  
CAGL0B00682g complement(58189..59640) similar to sp|P25573 Sacch...    29   5.4  
Kwal_23.3315                                                           29   6.8  
Scas_644.3                                                             28   7.8  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...    28   8.2  
YKL007W (CAP1) [3249] chr11 (428945..429751) Actin-capping prote...    28   10.0 

>YJR021C (REC107) [2922] chr10
           complement(468469..469097,469178..469493) Meiotic
           recombination protein, component of a complex that
           processes double-stranded DNA breaks [945 bp, 314 aa]
          Length = 314

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/309 (98%), Positives = 303/309 (98%)

Query: 1   MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAG 60
           MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAG
Sbjct: 1   MVARGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVANAGALEESDKQILEWAG 60

Query: 61  KLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIE 120
           KLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIE
Sbjct: 61  KLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIE 120

Query: 121 NQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQE 180
           NQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQE
Sbjct: 121 NQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQE 180

Query: 181 MLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHD 240
           MLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHD
Sbjct: 181 MLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTLLHD 240

Query: 241 MDEAHDKQRKKSVPPPRMMVTRSMKXXXXXXPTLSTSQNHNSEDNDDASHRLKRAARTII 300
           MDEAHDKQRKKSVPPPRMMVTRSMK      PTLSTSQNHNSEDNDDASHRLKRAARTII
Sbjct: 241 MDEAHDKQRKKSVPPPRMMVTRSMKRRRSSSPTLSTSQNHNSEDNDDASHRLKRAARTII 300

Query: 301 PWEELRPDT 309
           PWEELRPDT
Sbjct: 301 PWEELRPDT 309

>ACL124W [925] [Homologous to ScYJR021C (REC107) - SH]
           complement(129093..129348,129404..129870) [723 bp, 240
           aa]
          Length = 240

 Score = 93.6 bits (231), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 115/259 (44%), Gaps = 51/259 (19%)

Query: 48  LEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGN 107
           L+E+D+QILEWAGKLELES++LRE +D L+ +L +     C  +    Q LE    T G 
Sbjct: 27  LDETDRQILEWAGKLELESVDLREKADALLGLLQQR----CSEVAASQQGLETWKQTVGA 82

Query: 108 VKTLIK-DLASQIENQLDKVSTAMLSKGDEKKTKSDSSYRQVLVEEISRYNSKITRHVTN 166
             +  K D+   +E Q   V+  +       +T            ++ R+  +I +    
Sbjct: 83  ELSAFKADVVQALEEQRKAVAGEVRRAAGRARTPPP---------DMERFAGRIIKSFET 133

Query: 167 KQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYD 226
           +Q    K  + TQ++L+NV  QL+    VL S+S+D+ +L  RQ   E AF   A H ++
Sbjct: 134 RQQRWFKEFQATQDVLYNVTVQLDRATDVLGSVSRDLQALSARQAQTE-AF--LARHVHE 190

Query: 227 RPDVSLNGTTLLHDMDEAHDKQRKKSVPPPRMMVTRSMKXXXXXXPTLSTSQNHNSEDND 286
                L G+ L              S PPP M             P    S    +    
Sbjct: 191 -----LGGSVL-------------PSTPPPSM------------APRQRASPPGPAARTR 220

Query: 287 DASHRLKRAARTIIPWEEL 305
           D +H+     R +IPWE++
Sbjct: 221 DKAHQ----TRYLIPWEDI 235

>Scas_647.15*
          Length = 108

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 58/95 (61%), Gaps = 9/95 (9%)

Query: 4   RGRTDEISTDVSEANSEHSLMITETSSPFRSIFSHSGKVAN-AGALEESDKQILEWAGKL 62
           R  T++ISTD+S ANS       E SSP +     SG + N A  + E+DKQIL+WAGKL
Sbjct: 15  RAHTEDISTDISCANSSA----LEISSPVKG----SGCIGNDAKKMSEADKQILKWAGKL 66

Query: 63  ELESMELRENSDKLIKVLNENSKTLCKSLNKFNQL 97
           ELES +LRE S  LI +L  NSK L   ++   +L
Sbjct: 67  ELESCDLREKSSLLIGLLKRNSKELVTVIDSLTEL 101

>KLLA0E16533g join(1468303..1468521,1468683..1469108) some
           similarities with sp|P21651 Saccharomyces cerevisiae
           YJR021c REC107 meiotic recombination protein,
           hypothetical start
          Length = 214

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 91/200 (45%), Gaps = 43/200 (21%)

Query: 29  SSPFRSIFSHSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSKTLC 88
           SSPF+ I              ++DKQILEW  +LELE+++LR+ S+ L K++ EN   L 
Sbjct: 13  SSPFKKI-------------PDADKQILEWTSRLELETVQLRDTSESLFKIIKENVDELS 59

Query: 89  KSLNKFNQLLEQD----------AATNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKK 138
            S   F   L+               +GN +T   ++ S+++++LD++     S G+  +
Sbjct: 60  HSRKLFQAELDSRKTPRSRRYFCVYLDGNQETGT-EIVSEVKSRLDQLKA---SSGESLQ 115

Query: 139 TKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLS 198
             +D+                IT+ +  +  E        + ++FNV  Q++D+   + +
Sbjct: 116 LLADN----------------ITKQMDKRHREWMDRFTMNENVMFNVVQQMQDLTDAIQT 159

Query: 199 LSKDMHSLQTRQTALEMAFR 218
           L +DM     RQ  LE   R
Sbjct: 160 LHEDMRLASKRQALLEKRLR 179

>CAGL0M07832g
           join(complement(784445..784724),
           complement(783505..784319)) some similarities with
           sp|P21651 Saccharomyces cerevisiae YJR021c meiotic
           recombination protein
          Length = 364

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 93/190 (48%), Gaps = 26/190 (13%)

Query: 38  HSGKVANAGALEESDKQILEWAGKLELESMELRENSDKLIKVLNENSK-------TLCKS 90
           HSG      +L E+DKQI+EWAGKLELES++LRE S+KLI  L   S+        L K 
Sbjct: 28  HSGD----SSLGEADKQIMEWAGKLELESIDLREKSEKLINTLTNMSQELMKVSSQLVKQ 83

Query: 91  LNKFNQLLEQDAA-----TNGNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKSDSSY 145
           L   N   E+D        + N+   ++D      +QL  ++    + G  K      + 
Sbjct: 84  LENCNHSKEEDIVDQVYKLDVNINNQLQDWKKSFSDQLKSINHNS-NLGQIKNLTECMAN 142

Query: 146 RQVLVEEISRYNSKI----TRHVTNKQH-----ETEKSMRCTQEMLFNVGSQLEDVHKVL 196
           ++  +    R+NS I     R +   Q      + ++++    E++ N+  Q E ++++L
Sbjct: 143 QEANILGAIRHNSTILKDECRDIIKSQELAGAPKLQRAVDYLHEIMHNMSCQTESMNELL 202

Query: 197 LSLSKDMHSL 206
           LS+ K +H++
Sbjct: 203 LSIDKQLHNI 212

>Scas_480.2
          Length = 556

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 51/111 (45%), Gaps = 18/111 (16%)

Query: 169 HETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRP 228
           ++T K  RCT  ++F     L +++       +++H + +    + + + + A+ A+ R 
Sbjct: 399 YDTSKKYRCTWSIMFQEPLYLSNLYYYHGRFPRNLHMMNSAPKQISV-YVKLANDAHVRT 457

Query: 229 DVSL---NG---TTLLHDMDEA-----------HDKQRKKSVPPPRMMVTR 262
            V L   NG   T +LH  D +           H++Q ++ +P PR  + +
Sbjct: 458 FVELARTNGGETTHILHQRDTSYVKIAQFTYNIHNRQLRQQIPLPRWFIAQ 508

>YGR247W (CPD1) [2194] chr7 (984970..985689) Cyclic nucleotide
           phosphodiesterase [720 bp, 239 aa]
          Length = 239

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 190 EDVHKVLLSLSKDMHSLQTRQTALEMAFREKADHAYDRPDVSLNGTTL 237
           +DV+K+L S    + S+++ QTA +   + +  HA   P VS NG ++
Sbjct: 52  DDVNKILTSCVAAIQSIRSHQTA-KKGRKGQVSHAVAAPLVSFNGCSV 98

>AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C
           (UBP5) - SH] complement(448632..451178) [2547 bp, 848
           aa]
          Length = 848

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 10/126 (7%)

Query: 82  ENSKTLCKSLNKFNQLLEQDAATNG----NVKTLIKDLASQIENQLDKVSTAMLSKGDEK 137
           + S+  C+S+++ + L EQ    NG    ++K L++     + N  D+       K   K
Sbjct: 5   QESRVWCRSISQLSHLAEQFVTENGTESTDMKLLLQQCVDTLSNYQDECKKI---KSVSK 61

Query: 138 KTKSDSSYRQVLVEEISRYNSKITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLL 197
              S   Y   L E    Y   ++  V NK  + E+  R   + +   G QL +++ +L+
Sbjct: 62  PVPSKELYD--LYETAYVYFKIVSLIVLNKIPKLEEYARAKSDAVDRTGKQLLEIYNMLV 119

Query: 198 S-LSKD 202
           + L KD
Sbjct: 120 NRLVKD 125

>YOL069W (NUF2) [4750] chr15 (198941..200296) Component of the
           Tid3p-Nuf2p-Spc24p-Spc25p centromere complex, involved
           in chromosome segregation [1356 bp, 451 aa]
          Length = 451

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 62  LELESMELRENSDKLIKVLNENSKTLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIEN 121
           L  + +EL  N DKLIK+ N + + L + + + N LL Q   T       + DL +Q +N
Sbjct: 230 LSFQIVELESNRDKLIKISNTDMEELSEGIKELNDLLIQRKKT-------LDDLTAQQKN 282

Query: 122 QLDKVST 128
             D V+T
Sbjct: 283 LQDTVTT 289

>CAGL0B00682g complement(58189..59640) similar to sp|P25573
           Saccharomyces cerevisiae YCL044c, start by similarity
          Length = 483

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 57/127 (44%), Gaps = 19/127 (14%)

Query: 42  VANAGALEESDKQILEWAGKLELESMELRENSDKL------------IKVLNENSKTLCK 89
           VA   A  E++  I+ W G +E + M   E  D+L             +  NE +     
Sbjct: 285 VALVRAQTEAENPIISWFGPIEYKPMTFSEFLDRLEYHLDMFEYFQGKRAANETALGFLT 344

Query: 90  SL-NKFNQLLEQDAATNGNVKTLIKDLAS--QIENQLD-KVSTAMLSKGDEKKTKSDSSY 145
            +  + + L +Q+A    N   ++K+L S  Q+ N L  K   A + KG ++   S ++ 
Sbjct: 345 GIKTETSNLRDQNAQ---NRSRILKELKSEDQLSNDLSIKTGNAKIPKGTQRHGFSAAAN 401

Query: 146 RQVLVEE 152
           R +++EE
Sbjct: 402 RSIILEE 408

>Kwal_23.3315
          Length = 815

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (63%), Gaps = 4/55 (7%)

Query: 106 GNVKTLIKDLASQIENQLDKVSTAMLSKGD--EKKTKSDSSYRQVLVEEISRYNS 158
           GN+KT++KD +++++++L  V+  +   GD  EK  K  + Y +  VE IS Y+S
Sbjct: 102 GNLKTIVKD-SAELDSKLTNVAQVVAPLGDKLEKAIKRKNMYIKS-VELISHYSS 154

>Scas_644.3
          Length = 473

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/107 (20%), Positives = 48/107 (44%), Gaps = 12/107 (11%)

Query: 106 GNVKTLIKDLASQIENQLDKVSTAMLSKGDEKKTKS-------DSSYRQVLVEEISRYNS 158
           G++   +++    + N L  +S A++    +   +S        + +++ L     + N+
Sbjct: 267 GSLTNSLEEFGKFLGNTLQSISIALMPGAGDPSDRSLPQQPLHKALFKEALRPYFDKMNN 326

Query: 159 KITRHVTNKQHETEKSMRCTQEMLFNVGSQLEDVHKVLLSLSKDMHS 205
           +I   VTN        +    E+L   G  + D+HK ++S S+D+ S
Sbjct: 327 EILNLVTNPYQFNINGI----ELLAIAGQNINDIHKYVIS-SQDLDS 368

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy
           chain, class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 15/100 (15%)

Query: 117 SQIENQLDKVSTAMLSKGDEKKTKSDSS-----YRQVLVEE-ISRYNSKITRHVTNK--- 167
           SQIE+Q+   +  M + G+ K T++D+S     Y Q+L +E  +   SKI  ++  K   
Sbjct: 198 SQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRL 257

Query: 168 --QHETEKSMRCTQEMLFNVGSQL-EDVHKVLLSLSKDMH 204
             Q ETE++     ++L  +   + +++H   LS  KD H
Sbjct: 258 VYQPETERNYHIFYQILEGLPEPVKQELH---LSSPKDYH 294

>YKL007W (CAP1) [3249] chr11 (428945..429751) Actin-capping protein,
           alpha subunit [807 bp, 268 aa]
          Length = 268

 Score = 28.1 bits (61), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 68  ELRENSDKLIKVLNENSK-TLCKSLNKFNQLLEQDAATNGNVKTLIKDLASQIENQLDKV 126
           ELRE  D LIK+ +ENSK T+  ++  +N         NGN   +I     +     D V
Sbjct: 21  ELREVYDDLIKITSENSKNTILDAIENYNVQNCIPIEVNGN-SVIISKYNKEGAKFFDPV 79

Query: 127 STAMLS 132
           ++ + S
Sbjct: 80  NSVIFS 85

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.123    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,530,329
Number of extensions: 385139
Number of successful extensions: 2017
Number of sequences better than 10.0: 206
Number of HSP's gapped: 1983
Number of HSP's successfully gapped: 240
Length of query: 309
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 208
Effective length of database: 13,099,691
Effective search space: 2724735728
Effective search space used: 2724735728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)