Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR015W51050124560.0
Scas_647.944942111651e-156
YGR197C (SNG1)54742411581e-154
CAGL0B03971g54348610871e-143
Scas_617.354150810691e-141
CAGL0G09273g54542310581e-139
Kwal_55.2210649545310411e-137
Sklu_2316.34875029801e-128
CAGL0B03949g6324239811e-126
KLLA0E02134g5394998951e-114
ADL193C4654116095e-73
Scas_434.13572614915e-57
Scas_617.0d46451431e-11
KLLA0B14476g39587820.050
KLLA0B03806g38362664.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR015W
         (501 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   950   0.0  
Scas_647.9                                                            453   e-156
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   450   e-154
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   423   e-143
Scas_617.3                                                            416   e-141
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   412   e-139
Kwal_55.22106                                                         405   e-137
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             382   e-128
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   382   e-126
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   349   e-114
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   239   5e-73
Scas_434.1                                                            193   5e-57
Scas_617.0d                                                            60   1e-11
KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces...    36   0.050
KLLA0B03806g 343108..344259 similar to sp|P38698 Saccharomyces c...    30   4.4  

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/501 (95%), Positives = 476/501 (95%)

Query: 1   MTSSLDDIEPTAYNNMEADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEPN 60
           MTSSLDDIEPTAYNNMEADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEPN
Sbjct: 1   MTSSLDDIEPTAYNNMEADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEPN 60

Query: 61  SEDKKAXXXXXXXXXXXNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLH 120
           SEDKKA           NLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLH
Sbjct: 61  SEDKKAFPPSSGSFFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLH 120

Query: 121 KVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQ 180
           KVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQ
Sbjct: 121 KVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQ 180

Query: 181 QVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNL 240
           QVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNL
Sbjct: 181 QVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNL 240

Query: 241 KSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHR 300
           KSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHR
Sbjct: 241 KSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHR 300

Query: 301 PFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXX 360
           PFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSW      
Sbjct: 301 PFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFA 360

Query: 361 XXXXXXXXAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFW 420
                   AIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFW
Sbjct: 361 SLFFCTTTAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFW 420

Query: 421 ILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVAL 480
           ILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVAL
Sbjct: 421 ILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVAL 480

Query: 481 IALNTALLPFVGKYASRKLKQ 501
           IALNTALLPFVGKYASRKLKQ
Sbjct: 481 IALNTALLPFVGKYASRKLKQ 501

>Scas_647.9
          Length = 449

 Score =  453 bits (1165), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/421 (50%), Positives = 293/421 (69%), Gaps = 7/421 (1%)

Query: 79  LQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDN 138
           ++G+RK VL+ F FTN +LA+ CFT+FVLFWG  Y  +   H+V++L VIQ+  +     
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGI----- 55

Query: 139 NSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFA 198
           N+S V+P  S  LPT + + P  W +YN+ +F  KF  N+ + ++ +V+  V+ E YW A
Sbjct: 56  NNSTVLPMAS-ILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMA 114

Query: 199 INIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTF 258
           +N+KPNAT+ LFE+ IN   P FNST + Q V+ + RDP+N + T+LP+ + +E  Y  +
Sbjct: 115 LNVKPNATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNY 174

Query: 259 YTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYC 318
           Y   Y P  ++N++ +     T N   IA AG  N++Y+D+RPFT+R L+AP  IGV YC
Sbjct: 175 YINTYFPQFMSNVS-IANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYC 233

Query: 319 LLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDFTKS 378
           LLLTFFQFL+Y  LH E +++L+P   + YRI M W              AIFQVDFT++
Sbjct: 234 LLLTFFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRA 293

Query: 379 FGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLAL 438
           FG+GGFVVYWM+TWLFM+A GG NENAV L+  +GP++LG WILSF+ILNI P+F+PL L
Sbjct: 294 FGKGGFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLIL 353

Query: 439 NNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASRK 498
            N VYRYGYMMPVHN IDIYRVIF D+++ KMGRN+G+L+A IA+NTA LPFV K+ S+ 
Sbjct: 354 ANPVYRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKI 413

Query: 499 L 499
           L
Sbjct: 414 L 414

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  450 bits (1158), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 296/424 (69%), Gaps = 9/424 (2%)

Query: 79  LQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDN 138
           L+  RKK+L KFV  N  +A +C ++  ++WGA Y T +Y  KVK +VV+Q+ P      
Sbjct: 98  LRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAP------ 151

Query: 139 NSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFA 198
            S+  V SIS  +P+ +  +P  W IYN+ +F  KF      +++ K+VDL+YDE+YW A
Sbjct: 152 -SNTSVQSISAIIPSLLASVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLA 210

Query: 199 INIKPNATETLFESLIN-DTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHT 257
           +N+KPNAT+TL+ SLI+ D    FNS++F + V+E+GRDP+++KSTILP+ Q +E     
Sbjct: 211 LNVKPNATDTLYNSLISQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQK 270

Query: 258 FYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVY 317
           +Y   YLP L++NIT   R  L  N    A AG+  + Y D+RPF DRIL+AP Q+G++Y
Sbjct: 271 YYVKEYLPSLMSNITSNDR-DLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIY 329

Query: 318 CLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDFTK 377
           C+LLT  Q  LYG LH EMA+VL+P + LIYR+ +SW              AIF++DFT 
Sbjct: 330 CILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTP 389

Query: 378 SFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLA 437
           +FGRGGFVVYWMSTWL M+A GGANEN + LVI   P YL  W+++++ILNI+ SF+P+ 
Sbjct: 390 AFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMV 449

Query: 438 LNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASR 497
           LNN  YRYGY+MP+HN +DIY+VIF ++T+RKMGRNYGILVA +ALNT+L+PF  K+A +
Sbjct: 450 LNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGK 509

Query: 498 KLKQ 501
           K+++
Sbjct: 510 KMQK 513

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  423 bits (1087), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 224/486 (46%), Positives = 306/486 (62%), Gaps = 14/486 (2%)

Query: 19  DEEYCRRNDIHDLSSVVGD--AVSQGVPDMDGQTTDSSKDPEPNSEDKKAXXXXXXXXXX 76
           DEE  R ++  D S    D  A + G    +      + +PEP +   K           
Sbjct: 58  DEESIRTSN-EDYSEEAKDPQAYAPGPEGDEKGKPTQNNNPEPTNTLTKTKTRFFSP--- 113

Query: 77  XNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVIL 136
            N + QRK+V  +++    LL   CFT+ VL WG LY T  Y+ + K+L VIQE  V   
Sbjct: 114 -NFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRF 172

Query: 137 DNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYW 196
             N ++  PS+S  L   I ++P  W+IYN+ +FQ K++V   + +N KV+DLVY E++W
Sbjct: 173 --NDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFW 230

Query: 197 FAINIKPNATETLFESLIN-DTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYY 255
            A+N++ N T+TL  SLI+ D+   FNST   +VVYE+GRD TNL S +LPV Q IE  +
Sbjct: 231 LALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVF 290

Query: 256 HTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGV 315
              YT  YLP LL NIT    +   N AR +AAAG+  + Y D+RP TDR+ L  TQIG 
Sbjct: 291 QKVYTYQYLPQLLGNITNGDNF---NPAR-VAAAGRMKFNYNDYRPVTDRVTLLSTQIGA 346

Query: 316 VYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDF 375
           VYCLLLT FQFL++GPLH EM+++++ +N  IYR+ + W              A++QVDF
Sbjct: 347 VYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDF 406

Query: 376 TKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFP 435
           TK+FGR GFVVYWMST+L+MLA GG NEN +ML+I + P Y+GFWILSFVILN+AP+FF 
Sbjct: 407 TKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFA 466

Query: 436 LALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYA 495
           +   N  YRYGY MP+H ++ I RVIFFD+++ ++GRNYGIL A + LNT  +PFV K+ 
Sbjct: 467 IGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFV 526

Query: 496 SRKLKQ 501
            + L +
Sbjct: 527 LKTLHK 532

>Scas_617.3
          Length = 541

 Score =  416 bits (1069), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 211/508 (41%), Positives = 312/508 (61%), Gaps = 17/508 (3%)

Query: 1   MTSSLDDIEPTAYNNMEADEEYCRRND---IHDLSSVVGDAVSQGVPDMDGQTTDSSKDP 57
           MTS  D  E +  N+  ++++  + ++   ++  SS  G       PD       +   P
Sbjct: 37  MTSVTD--EESQINDTNSEKDAAKGSNSYAVNSFSSAAGSQPQAYNPDGQNTAKPAVTQP 94

Query: 58  EPNSEDKKAXXXXXXXXXXXNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSK 117
           E N E+               L  QRKK+ +KF+ +N LLA +C ++  L+WG+LY T+K
Sbjct: 95  EEN-EENVPISPTKTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTK 153

Query: 118 YLHKVKLLVVIQE---PPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKF 174
           +L ++ ++ +IQ+   PP  +  N +S+V P     +P+FI +    W +YN   FQ KF
Sbjct: 154 HLERISIIAIIQDDYIPPNDL--NLTSVVAP-----VPSFIEQSTGKWHVYNQSYFQEKF 206

Query: 175 DVNTPQQVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETG 234
           +V  P  +N+++  L++DEKYW A+NI  N T  +  SL     P FNST   +VVYET 
Sbjct: 207 NVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRVVYETS 266

Query: 235 RDPTNLKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTN-NARYIAAAGKYN 293
           R+PT L++ +LP+ Q IE  Y  FY   YLP LL+ +       L+N  A  +A  GK+ 
Sbjct: 267 REPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQ 326

Query: 294 YEYYDHRPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMS 353
           ++Y D   F DRIL+AP Q+G++YCL+LT FQ  L+GPLH EMAK L+P + +IYR+++S
Sbjct: 327 FDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVS 386

Query: 354 WXXXXXXXXXXXXXXAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLG 413
           W              AIFQ+DFT +FG+GGFV+YWM+T+L MLA GGANEN + L+I   
Sbjct: 387 WATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLSLIILFI 446

Query: 414 PQYLGFWILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRN 473
           P+YL  W+LS++I+NI+P+F P+ L+N  YRYGYMMP+H  +DI++V+F +V++R MGRN
Sbjct: 447 PEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRN 506

Query: 474 YGILVALIALNTALLPFVGKYASRKLKQ 501
           YGILVA I +NT L P V K   + +++
Sbjct: 507 YGILVAWIVVNTCLFPLVMKIVGKTVQK 534

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  412 bits (1058), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 279/423 (65%), Gaps = 9/423 (2%)

Query: 79  LQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDN 138
           L+  +  +  +F FTN LLA +C ++  ++WGA Y T  YL KV +L VIQ+      D 
Sbjct: 110 LESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQ-----DY 164

Query: 139 NSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDV-NTPQQVNDKVVDLVYDEKYWF 197
           N+   + S++  LP  I++ P  W +YN  +F  K+ + NT + V+ K+ DL+++EKYW 
Sbjct: 165 NN---IQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWM 221

Query: 198 AINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHT 257
           ++N+K  ATE L+ SL ++TAP FNS+ + + ++E+GRDPTNLKS ILP+ Q ++  Y  
Sbjct: 222 SLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQ 281

Query: 258 FYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVY 317
           +YT  YLP +L N++         N   +A +G + + Y D+RPF DR+LLAP Q+G+++
Sbjct: 282 YYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIF 341

Query: 318 CLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDFTK 377
            L+LT  Q  LYGP+H +M +V +P + L+YR  +SW              AI+Q+DFT 
Sbjct: 342 TLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTL 401

Query: 378 SFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLA 437
           +FGRGGFV+YW++T+  MLA G  NEN + L++   PQY+  W++S++ILNI+PSF+P+ 
Sbjct: 402 AFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMV 461

Query: 438 LNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASR 497
           LNN  YRYGY MP+HN +DIYRVIF D++R K+GRNYGIL A +A+   + PFV K A  
Sbjct: 462 LNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGT 521

Query: 498 KLK 500
           K+K
Sbjct: 522 KMK 524

>Kwal_55.22106
          Length = 495

 Score =  405 bits (1041), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/453 (42%), Positives = 289/453 (63%), Gaps = 15/453 (3%)

Query: 41  QGVPDMDGQTTDSSKDPEPNSEDKKAXXXXXXXXXXXNLQGQRKKVLLKFVFTNCLLAII 100
           +G  ++D +    + + E    + K             ++G+R+K++++F+  + LLA++
Sbjct: 38  RGYKELDPENEAGATEGELRRVESK-LSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAML 96

Query: 101 CFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPC 160
             ++F L+WGA Y  SK++HKVK+L V+Q+ P              I+ ++PT   + P 
Sbjct: 97  IMSVFSLYWGATYQRSKHMHKVKILAVVQDEP---------GTGTGIASSIPTLAEQAPG 147

Query: 161 DWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPL 220
            W +YN+ +FQ K+ V    +V+ K+  LV+D+KYW ++N+KPNAT TL ESL N  A  
Sbjct: 148 TWHVYNTSSFQQKYGV-AQDEVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASP 206

Query: 221 FNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALT 280
           FNS+ F ++ YE+GRDPTNLKS+ILP+A ++E  Y   Y    LP +L+NITQ     + 
Sbjct: 207 FNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTILPGILSNITQ----RVG 262

Query: 281 NNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVL 340
           + +R +A AG   +   D+RPF D +LL P Q+G++YC+LLTFFQ  L+GP+H  + + L
Sbjct: 263 DVSRNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKL 322

Query: 341 RPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGG 400
           +P + L+YR  +++                FQVDFTK+FGR GF+V WMS+WL M A GG
Sbjct: 323 KPVHMLLYRYVIAFVNYFFLSLFFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLMAAVGG 382

Query: 401 ANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRV 460
           ANEN + +++  GPQYLGFW++ +V+LNI+P+F+P+ L +N YRYGYM P++N + I+RV
Sbjct: 383 ANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRV 442

Query: 461 IFFDVTRRKMGRNYGILVALIALNTALLPFVGK 493
            F D+ R  +GRNYGIL A I LN A+ PFV K
Sbjct: 443 TFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMK 475

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  382 bits (980), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 205/502 (40%), Positives = 296/502 (58%), Gaps = 30/502 (5%)

Query: 1   MTSSL-DDIEPTAYNNMEADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEP 59
           M+SS   + E   +  + A E+         L+      + Q   + D   T  S   E 
Sbjct: 1   MSSSFATEPESLGFKEVAAGEQ-------QSLNQFEQRCLDQAQSEHDSVRTSLS---EV 50

Query: 60  NSEDKKAXXXXXXXXXXXNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYL 119
            S D  +            LQ QRK V  +F+F    LA +  ++F L+WGALY+ + +L
Sbjct: 51  ASNDGGSLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHL 110

Query: 120 HKVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTP 179
            KV++L VIQ+               S+  ALP  I+  P  W +Y S  FQ+K+ +N  
Sbjct: 111 GKVRILAVIQDDG-------------SLPGALPAIIDANPGGWHVYTSEQFQSKYHINE- 156

Query: 180 QQVNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTN 239
            Q++ K+  LV+ +K+W ++N+KPNAT  L ESL N +A  F ++ + + +YE+GRDPTN
Sbjct: 157 TQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPTN 216

Query: 240 LKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDH 299
            +S+ILP+ Q +E  +   YT +YLP LL++ T +   +  N    +AAAG   +   D 
Sbjct: 217 FRSSILPLLQEVELSFQKNYTSSYLPELLSH-TNLSNASPAN----LAAAGNLEFCSEDM 271

Query: 300 RPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXX 359
           RPF++ +LL P Q+G+++C+LLTFFQ  ++GPLH  ++  L+PA+ LIYR  +S      
Sbjct: 272 RPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFF 331

Query: 360 XXXXXXXXXAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGF 419
                    AIFQVDFT +FGR GF+VYWMSTWL M A GGANEN + L++  G QYLGF
Sbjct: 332 LSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGF 391

Query: 420 WILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVA 479
           W++ +++ NI+PSFFPLAL NN YRYGYMMP+HN +DIY+VIF +  +  +GRNYGIL A
Sbjct: 392 WLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCA 451

Query: 480 LIALNTALLPFVGKYASRKLKQ 501
            + +N+ L   V K    K+KQ
Sbjct: 452 WVVINSILFVPVLKIVGNKMKQ 473

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  382 bits (981), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 178/423 (42%), Positives = 271/423 (64%), Gaps = 4/423 (0%)

Query: 79  LQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDN 138
           ++  R+++L KF+ T+ LLAI       L+WGA+Y+ S  L++V  + VIQ+ P    D 
Sbjct: 176 MKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDG 235

Query: 139 NSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFA 198
               V+P+++  +   IN IP +W I NS  F+  ++V   Q++++KV +L++DEK+W A
Sbjct: 236 T---VIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKFWLA 292

Query: 199 INIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTF 258
           +N++  ATE  ++S+  + AP+FNST + Q +YE+GRDPTNLKS+I P+    E  + + 
Sbjct: 293 VNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESVFRSQ 352

Query: 259 YTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYC 318
           Y   Y+P  + NIT    +  T N   +   G +    YD RPFTDR+LL P  +G+ Y 
Sbjct: 353 YLKIYVPEFIKNITSP-DFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGLNYN 411

Query: 319 LLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDFTKS 378
           ++ + F   ++GP++ EMAK L+P +   YRI +SW              AIFQ+DFT  
Sbjct: 412 IMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDFTPG 471

Query: 379 FGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLAL 438
           FG+ GFV+YWM++WL M A G ANEN + +++T  PQY+ +W++ + ILNIAPS +PL L
Sbjct: 472 FGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYPLVL 531

Query: 439 NNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASRK 498
            +  YR+GY MP+HN + IYRVIF D++R +M RNYGIL A +A+NTA+ PFV K+ S+ 
Sbjct: 532 ISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKV 591

Query: 499 LKQ 501
           +K+
Sbjct: 592 VKK 594

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 187/499 (37%), Positives = 277/499 (55%), Gaps = 41/499 (8%)

Query: 18  ADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEPNSEDKK------------ 65
           A  E  R++    L+ V  D   Q   D   ++ +       N +DK             
Sbjct: 54  AGNESGRKSRTPSLAMVGEDNQDQSTSDEQAESVEEFNKESANIDDKNEEQNDGSPAEAG 113

Query: 66  --AXXXXXXXXXXXNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVK 123
             A            L   R     +F     LL  +   MF L+WGALY+ S   H VK
Sbjct: 114 QPALGRVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVK 173

Query: 124 LLVVIQEPPVVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKF--DVNTPQQ 181
            + V+++       +  + V+P +  A+P F         +YN+ +F+ K+  DVN    
Sbjct: 174 FIAVVEDD-----GDMGAGVIPIMDSAIPQFF--------VYNTSSFRDKYGQDVN---- 216

Query: 182 VNDKVVDLVYDEKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLK 241
           +++KV  LV+ +K+W ++ + P  T+   +SL  D AP FNST + +  Y+T RD +N++
Sbjct: 217 ISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMR 276

Query: 242 STILPVAQTIEE-YYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHR 300
           ++I+P+  +IE  Y  TF+  +Y P ++ NIT +       +   ++AAG  N++  D+R
Sbjct: 277 ASIVPLLTSIETTYKKTFFYNDYFPSVIANITNI-------SGPNLSAAGDMNWKQIDNR 329

Query: 301 PFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXX 360
           PFTD  LL P Q+G++YC+LLTFFQ  L+GP H  ++ +L+P + ++YR+  SW      
Sbjct: 330 PFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFL 389

Query: 361 XXXXXXXXAIFQVDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFW 420
                   AIF VDFT +FGRGGFVVYWM+TW+ M A GGANEN + +++   PQYLGFW
Sbjct: 390 SLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFW 449

Query: 421 ILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVAL 480
           ++S++I+NI+ SF PL L N  YRYGYM P++N ++IYRVIF D  +  MGRNYGIL A 
Sbjct: 450 LISWIIINISASFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAW 509

Query: 481 IALNTALLPFVGKYASRKL 499
             LNT L PFV K   +K 
Sbjct: 510 CVLNTLLFPFVMKIVGQKF 528

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  239 bits (609), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 134/411 (32%), Positives = 220/411 (53%), Gaps = 15/411 (3%)

Query: 83  RKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDNNSSM 142
           RK++L+ F+     LA +   +F L  G L +  +YL ++ +L+V+Q       D ++ M
Sbjct: 60  RKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQ-------DEDAGM 112

Query: 143 VVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFAINIK 202
               +  A           W   +     + F +     +++ +  L+   +YW A++++
Sbjct: 113 SAELLRAA-----EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVR 167

Query: 203 PNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTFYTLN 262
           P ATE L  SL +  AP+FNS+ F +V YET RD  N   ++  + +T+E  +  +Y   
Sbjct: 168 PGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETLEANFRAYYLDT 226

Query: 263 YLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYCLLLT 322
           +LP  L          L++    I AAG   + Y D  PF D  L    Q+G++ CLLLT
Sbjct: 227 WLPGELRERANTID--LSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLT 284

Query: 323 FFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWXXXXXXXXXXXXXXAIFQVDFTKSFGRG 382
           FFQ  +   LH E++ +LR ++ L+YR  +S+               I+ +D  K++GR 
Sbjct: 285 FFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDMEKAYGRA 344

Query: 383 GFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLALNNNV 442
           GF+V+WM+TWLFM A GGANEN + ++    P+++GFW++ +++ NI P+F+ L L N+ 
Sbjct: 345 GFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDF 404

Query: 443 YRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGK 493
           Y+YGY+ P++N  + Y+V+ FD  R  +   Y +LVA   LN AL P   K
Sbjct: 405 YKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALK 455

>Scas_434.1
          Length = 357

 Score =  193 bits (491), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 157/261 (60%), Gaps = 15/261 (5%)

Query: 78  NLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILD 137
           +L   RKK+  KF+  N ++ + C T+  +FWG LY T++Y HKV  L+V+Q+ P+ +  
Sbjct: 105 HLTQHRKKIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPLQL-- 162

Query: 138 NNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWF 197
               + VPS++  LP  +  +P  W +YN+ TF   + +     +N+KVVDL++ E++W 
Sbjct: 163 --GGLSVPSMASFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLIFQERFWV 220

Query: 198 AINIKPNATETLFESLI--NDTAP--LFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEE 253
           A+N+KPNAT +L +SL+    T P  LFN+T F QV+YET RD T++++ ++ V Q +E 
Sbjct: 221 AVNVKPNATASLMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEMES 280

Query: 254 YYHTFYTLNYLPPLLTNI---TQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAP 310
            Y   Y   YLP +L  +    Q+   A T+ +R    A   N++Y+D+R F +R L+ P
Sbjct: 281 AYREIYMEQYLPTILAQMDPTNQISSLAPTSLSR----ATNINFQYWDYRSFYNRALMGP 336

Query: 311 TQIGVVYCLLLTFFQFLLYGP 331
              G +Y L +T FQFL++ P
Sbjct: 337 LLAGTIYSLTITVFQFLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 59.7 bits (143), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/45 (57%), Positives = 34/45 (75%)

Query: 457 IYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASRKLKQ 501
           +Y+VIF D+ R KMGRNYGILVA I LNT L PF+ K+  + L++
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQE 46

>KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces
           cerevisiae YGR234w YHB1 flavohemoglobin singleton, start
           by similarity
          Length = 395

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 206 TETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTFYTLNYLP 265
           T+  + +++++   L N+  FN+V  + GR PT L  T+L  A+ I++       L+ L 
Sbjct: 25  TKIFYNNMLSENPVLLNT--FNRVNQKKGRQPTALAMTVLAAAKNIDD-------LSVLL 75

Query: 266 PLLTNITQVYRYALTNNARYIAAAGKY 292
           P +  I Q +R      A+Y    GKY
Sbjct: 76  PAVNEIGQKHRALQVEPAQY-DIVGKY 101

>KLLA0B03806g 343108..344259 similar to sp|P38698 Saccharomyces
           cerevisiae YHR201c PPX1 exopolyphosphatase singleton,
           start by similarity
          Length = 383

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 197 FAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGR--DPTNLKSTILPVAQTIEEY 254
            A  I PN    L +SL+ND AP  +      +  +     D  N K +   VA  IEE+
Sbjct: 321 IAFQINPNRDPQLLKSLVNDLAPKLDLVKIESLSSKCFECYDQKNTKMSRKQVAPFIEEF 380

Query: 255 YH 256
            H
Sbjct: 381 IH 382

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,335,706
Number of extensions: 711201
Number of successful extensions: 2306
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 21
Length of query: 501
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 395
Effective length of database: 12,926,601
Effective search space: 5106007395
Effective search space used: 5106007395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 64 (29.3 bits)