Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR014W1981849541e-133
Scas_647.81971838081e-111
CAGL0B03927g1961967781e-106
Sklu_1575.21911947551e-103
Kwal_33.154611961837421e-101
ACL112C1991856973e-94
KLLA0F21934g2001836887e-93
KLLA0F07469g99284740.14
CAGL0J07678g10862680.22
YNL244C (SUI1)10862680.25
Scas_706.1510862670.36
Kwal_26.9460100266700.48
Sklu_2263.7101679670.97
KLLA0C03091g10870631.0
AER457W10862611.9
ADL395C10862611.9
CAGL0I02222g151257633.2
Scas_720.593193615.0
Sklu_2432.820262605.5
AFR642C10862585.8
Scas_657.741745607.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR014W
         (196 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with sim...   372   e-133
Scas_647.8                                                            315   e-111
CAGL0B03927g 386875..387465 highly similar to sp|P47089 Saccharo...   304   e-106
Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement        295   e-103
Kwal_33.15461                                                         290   e-101
ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [6...   273   3e-94
KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces...   269   7e-93
KLLA0F07469g 703955..706933 similar to sp|Q02792 Saccharomyces c...    33   0.14 
CAGL0J07678g 750008..750334 highly similar to sp|P32911 Saccharo...    31   0.22 
YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (...    31   0.25 
Scas_706.15                                                            30   0.36 
Kwal_26.9460                                                           32   0.48 
Sklu_2263.7 YGR274C, Contig c2263 8141-11191 reverse complement        30   0.97 
KLLA0C03091g complement(276491..276817) highly similar to sp|P32...    29   1.0  
AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH] complement(...    28   1.9  
ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..180...    28   1.9  
CAGL0I02222g complement(190099..194637) similar to sp|P38859 Sac...    29   3.2  
Scas_720.5                                                             28   5.0  
Sklu_2432.8 YNL244C, Contig c2432 18118-18726                          28   5.5  
AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH] (1607516..1...    27   5.8  
Scas_657.7                                                             28   7.1  

>YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with
           similarity to human DENR/DRP density-regulated protein
           [597 bp, 198 aa]
          Length = 198

 Score =  372 bits (954), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60
           MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA
Sbjct: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60

Query: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120
           ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV
Sbjct: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120

Query: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV 180
           FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV
Sbjct: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV 180

Query: 181 ETID 184
           ETID
Sbjct: 181 ETID 184

>Scas_647.8
          Length = 197

 Score =  315 bits (808), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 170/183 (92%), Gaps = 2/183 (1%)

Query: 2   LREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLAE 61
           L+EV+YCG+CSYPPEYCEF+GKLKRCKVWL ENH DL+ KLYG DDN  +V AV  KLAE
Sbjct: 3   LQEVVYCGVCSYPPEYCEFTGKLKRCKVWLKENHPDLFTKLYG-DDNG-DVAAVAGKLAE 60

Query: 62  SSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEVF 121
           SSIGE REEKLEKDLLK+Q KQENREQRELAKKLSSKVIIKREARTKRKFI+AISGLEVF
Sbjct: 61  SSIGEEREEKLEKDLLKLQTKQENREQRELAKKLSSKVIIKREARTKRKFIIAISGLEVF 120

Query: 122 DIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKVE 181
           +IDMKKLAKTFAS+FATGCSVSKNAEKKEE+VIQGDV++ VE YIHSLL+EKGLKDVKVE
Sbjct: 121 EIDMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVLEAVEAYIHSLLKEKGLKDVKVE 180

Query: 182 TID 184
           TID
Sbjct: 181 TID 183

>CAGL0B03927g 386875..387465 highly similar to sp|P47089
           Saccharomyces cerevisiae YJR014w, start by similarity
          Length = 196

 Score =  304 bits (778), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/196 (77%), Positives = 167/196 (85%), Gaps = 2/196 (1%)

Query: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60
           ML+EV+YCG+C+YP +YCEFSGKLKRCKVWL ENHADLY KLY  DD      +     A
Sbjct: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYSEDDAAAASLSAKL--A 58

Query: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120
           ESSIGEAREEKLEKDL K+Q KQEN+EQRELAKKLSSKVI+KREARTKRK+IVAISGLEV
Sbjct: 59  ESSIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEV 118

Query: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV 180
           F+IDMKKLAKTFAS+FATGCSVSKNAEKKEEVV+QGDV+DEV  YIHSLLEEKG+KDVKV
Sbjct: 119 FEIDMKKLAKTFASKFATGCSVSKNAEKKEEVVVQGDVLDEVVAYIHSLLEEKGMKDVKV 178

Query: 181 ETIDAXXXXXPAAEGA 196
           ETID      P A  A
Sbjct: 179 ETIDTKKKKKPEATPA 194

>Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement
          Length = 191

 Score =  295 bits (755), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 165/194 (85%), Gaps = 4/194 (2%)

Query: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60
           ML+ V+YCG+CS PPEYCEF+GKLKRCKVWL ENHADL+ +LY  D    EV+ V  KL 
Sbjct: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPAD---CEVDDVATKLG 57

Query: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120
            SSIG AREEKLEKDLL++Q KQE+REQRELAKKLSSKV+IKREARTKRK ++AISGLEV
Sbjct: 58  NSSIGGAREEKLEKDLLRLQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEV 117

Query: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV 180
           F+IDMKKLAKTFAS+FATGCSVSKNAEKKEE+V+QGDV DEVE YIHSLLEEKGLK VKV
Sbjct: 118 FEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGLKQVKV 177

Query: 181 ETIDAX-XXXXPAA 193
           E ID       PAA
Sbjct: 178 EHIDTQKKKKKPAA 191

>Kwal_33.15461
          Length = 196

 Score =  290 bits (742), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 159/183 (86%), Gaps = 4/183 (2%)

Query: 2   LREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLAE 61
           LR+VIYCG+CS+PP++CEF+GKLKRCKVWLSENH++ Y  LYG     QEVE     LA 
Sbjct: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGD----QEVEEAAANLAG 58

Query: 62  SSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEVF 121
           SSIGE REEKLEKDLLK+Q KQENREQRELAKKLSSKVIIKREARTKRK +VAISGLEVF
Sbjct: 59  SSIGEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVF 118

Query: 122 DIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKVE 181
           +IDMKKLAKTFAS+FATGCSVSKN EKKEE++IQGDV DE E YI  LLEEKGLKD+KVE
Sbjct: 119 EIDMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGLKDIKVE 178

Query: 182 TID 184
            +D
Sbjct: 179 QMD 181

>ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [600
           bp, 199 aa]
          Length = 199

 Score =  273 bits (697), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 127/185 (68%), Positives = 163/185 (88%), Gaps = 2/185 (1%)

Query: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60
           ML++V+YCG+CS PPEYCEF+GK++RCKVWL E+  +L+A+LYG  D+ ++V+ V  +L 
Sbjct: 1   MLKKVVYCGVCSLPPEYCEFTGKIRRCKVWLHEHDQELFAQLYG--DDKEDVDGVAARLG 58

Query: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120
           +SSIGE REE+LEK L K+Q ++E++EQRELA+KLSS+V+I+REARTKRK +V ++GLEV
Sbjct: 59  QSSIGEEREEQLEKKLQKLQAREESKEQRELARKLSSRVVIRREARTKRKCMVVVAGLEV 118

Query: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKV 180
           F+IDMKKLAKTFAS+FATGCSVSKN EKKEEVV+QGD+ DEVE YIH+LLEEKG+K VKV
Sbjct: 119 FEIDMKKLAKTFASKFATGCSVSKNVEKKEEVVVQGDIADEVEAYIHALLEEKGMKGVKV 178

Query: 181 ETIDA 185
           E IDA
Sbjct: 179 EQIDA 183

>KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces
           cerevisiae YJR014w singleton, start by similarity
          Length = 200

 Score =  269 bits (688), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 133/183 (72%), Positives = 157/183 (85%), Gaps = 5/183 (2%)

Query: 2   LREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLAE 61
           L  VIYCG+C +P EYCEFSGK KRCK WL ENH +LY K YG  D T   E V+ +LAE
Sbjct: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYG--DVT---EDVSKQLAE 57

Query: 62  SSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEVF 121
           SSIG+ REEKLEK L K+++KQ+ RE+RELAKKLSSKV+I+REARTKRK ++AISGLEVF
Sbjct: 58  SSIGDEREEKLEKALEKLERKQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVF 117

Query: 122 DIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKVE 181
           +IDMKKL+KTFAS+FATGCS+SKNAEKKEEV++QGD+ DEVE YIHSLLEEKG+K+VKVE
Sbjct: 118 EIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLLEEKGMKEVKVE 177

Query: 182 TID 184
            ID
Sbjct: 178 VID 180

>KLLA0F07469g 703955..706933 similar to sp|Q02792 Saccharomyces
           cerevisiae YOR048c RAT1 5 -3 exoribonuclease, start by
           similarity
          Length = 992

 Score = 33.1 bits (74), Expect = 0.14,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%)

Query: 41  KLYGTDDNTQEVEAVTNKLAESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVI 100
           K Y T D T  +E V   L +  +G+   +  +K  ++  +KQE  ++R   KKL S   
Sbjct: 363 KTYLTCDGTLNLEPVEALLEQ--LGDRETDLFKKKYIQEVRKQEAHDRR---KKLKSNPN 417

Query: 101 IKREARTKRKFIVAISGLEVFDID 124
           +  + +  R F++ +  + V+D+D
Sbjct: 418 VS-QGKVDRNFMIPLENMPVYDVD 440

>CAGL0J07678g 750008..750334 highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3, start by similarity
          Length = 108

 Score = 30.8 bits (68), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           S+ + I+ + R  RK +  + G+   + D K++ K     FA   ++ K++E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPA-EYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQ 81

Query: 156 GD 157
           GD
Sbjct: 82  GD 83

>YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (16
           kDa) of translation initiation factor eIF3, involved in
           initiation and in monitoring translational accuracy
           during elongation [327 bp, 108 aa]
          Length = 108

 Score = 30.8 bits (68), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           S+ + I+ + R  RK +  + G+   + D+K++ K     FA   ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQ 81

Query: 156 GD 157
           GD
Sbjct: 82  GD 83

>Scas_706.15
          Length = 108

 Score = 30.4 bits (67), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           ++ + I+ + R  RK +  + G+   + D+K++ K     FA   ++ K+ E  E + +Q
Sbjct: 23  ANYIHIRIQQRNGRKTLTTVQGVPA-EYDLKRILKVLKKDFACNGNIVKDVEMGEIIQLQ 81

Query: 156 GD 157
           GD
Sbjct: 82  GD 83

>Kwal_26.9460
          Length = 1002

 Score = 31.6 bits (70), Expect = 0.48,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 52  VEAVTNKLAESSIGEAREEK-------LEKDLLKIQKKQENREQRELAKKLSSKVIIKRE 104
           +E + N   +   GE  EEK       LE+ L K+QK QE R+ R+LAK+ +      + 
Sbjct: 886 LEELMNDNIDLVSGENTEEKQLKQKKLLEEQLAKLQKSQERRQARKLAKEKTKDGKAAKA 945

Query: 105 ARTKRK 110
             T R+
Sbjct: 946 RNTNRR 951

>Sklu_2263.7 YGR274C, Contig c2263 8141-11191 reverse complement
          Length = 1016

 Score = 30.4 bits (67), Expect = 0.97,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 39  YAKLYGTDDNTQEVEAVTNKLAESSIGEAREEK-------LEKDLLKIQKKQENREQREL 91
           Y K    D+   +++ + N   +   G   EEK       LE+ L ++QK QE R  R++
Sbjct: 884 YEKKREQDEANLDLDQLMNDNIDLVSGVNDEEKQMKQKKLLEEQLARLQKSQERRHARKM 943

Query: 92  AKKLSSKVIIKREARTKRK 110
           AK+ S    + +   T R+
Sbjct: 944 AKEKSKDGKVSKAKNTTRR 962

>KLLA0C03091g complement(276491..276817) highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3 (eIF3) singleton, start by
           similarity
          Length = 108

 Score = 28.9 bits (63), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 101 IKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMD 160
           I+ + R  RK +  + G+   + D+K++ K     FA   ++ K+ E  E + +QGD   
Sbjct: 28  IRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGEVIQLQGDQRA 86

Query: 161 EVETYIHSLL 170
           +V  ++ + L
Sbjct: 87  KVSEFMITQL 96

>AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH]
           complement(1512587..1512913) [327 bp, 108 aa]
          Length = 108

 Score = 28.1 bits (61), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           S+ + I+ + R  RK +  + G+   + D+K++ K     F    ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 156 GD 157
           GD
Sbjct: 82  GD 83

>ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..18002)
           [327 bp, 108 aa]
          Length = 108

 Score = 28.1 bits (61), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           S+ + I+ + R  RK +  + G+   + D+K++ K     F    ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 156 GD 157
           GD
Sbjct: 82  GD 83

>CAGL0I02222g complement(190099..194637) similar to sp|P38859
           Saccharomyces cerevisiae YHR164c DNA2 DNA helicase,
           hypothetical start
          Length = 1512

 Score = 28.9 bits (63), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%)

Query: 127 KLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGLKDVKVETI 183
           +  K + S+ + GC V  +  ++ E +   DV+D  E  +  +   KG  D  VE +
Sbjct: 601 EFVKKYVSKSSYGCYVPVSGTRRTEPISISDVIDIEENIVSPMYGFKGFLDASVEAL 657

>Scas_720.5
          Length = 931

 Score = 28.1 bits (61), Expect = 5.0,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 16  EYCEFSGKLKRC---KVWLSENHADLYAKLYGTDDNTQEVEAVTNKLAES-SIGEAREEK 71
           EY    G++K+    ++ L + ++ L AK    +     +  +T+ L E+ +I +   +K
Sbjct: 555 EYYASGGEIKKLMNEQLQLVKQYSKLEAKKAWYEWRKLHLNGITHVLLENLTILQEEYDK 614

Query: 72  LEKDLLKIQKKQENREQRELAKKLSSKVIIKRE 104
           +EKDL KIQ  Q N   +E+   +S ++ + RE
Sbjct: 615 IEKDLQKIQ--QVNSRVKEIKNSISHEIKLLRE 645

>Sklu_2432.8 YNL244C, Contig c2432 18118-18726
          Length = 202

 Score = 27.7 bits (60), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           ++ + I+ + R  RK +  + G+   + D+K++ K     FA   ++ K+ E  + + +Q
Sbjct: 117 TNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGQIIQMQ 175

Query: 156 GD 157
           GD
Sbjct: 176 GD 177

>AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH]
           (1607516..1607842) [327 bp, 108 aa]
          Length = 108

 Score = 26.9 bits (58), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 96  SSKVIIKREARTKRKFIVAISGLEVFDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQ 155
           S+ + I+ + R  RK +  + G+     D+K++ K     F    ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGITK-KYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 156 GD 157
           GD
Sbjct: 82  GD 83

>Scas_657.7
          Length = 417

 Score = 27.7 bits (60), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 32 SENHADLYAKLYGTD-DNTQEVEAVTNKLAESSIGEAREEKLEKD 75
          S+N AD    L   D D+  E+  V+N LA   +G ++EE+L  D
Sbjct: 54 SDNGADSDGDLPMLDMDDEDEIHYVSNYLAHQRLGSSKEEELNID 98

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,842,788
Number of extensions: 240330
Number of successful extensions: 1821
Number of sequences better than 10.0: 178
Number of HSP's gapped: 1768
Number of HSP's successfully gapped: 189
Length of query: 196
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 100
Effective length of database: 13,272,781
Effective search space: 1327278100
Effective search space used: 1327278100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)