Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR013W40339718990.0
Scas_647.642340412021e-164
KLLA0D09647g40238010711e-145
Kwal_33.1544939638410641e-143
ACR034W39739010601e-143
CAGL0B03905g43139310131e-135
Kwal_27.1155819288627.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR013W
         (397 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with mod...   736   0.0  
Scas_647.6                                                            467   e-164
KLLA0D09647g complement(814829..816037) some similarities with s...   417   e-145
Kwal_33.15449                                                         414   e-143
ACR034W [1082] [Homologous to ScYJR013W - SH] complement(420791....   412   e-143
CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces c...   394   e-135
Kwal_27.11558                                                          28   7.4  

>YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with
           moderate similarity to mannosyltransferase I
           (glycosylphosphatidylinositol mannosyltransferase I, rat
           Pigm), which transfers the first mannose to
           glycosylphosphatidylinositol (GPI) during the
           biosynthesis of GPI membrane anchors [1212 bp, 403 aa]
          Length = 403

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/397 (91%), Positives = 364/397 (91%)

Query: 1   MTGEEWGLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDT 60
           MTGEEWGLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDT
Sbjct: 1   MTGEEWGLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDT 60

Query: 61  YRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLL 120
           YRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLL
Sbjct: 61  YRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLL 120

Query: 121 NPMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKXXXXXXXXXXXXX 180
           NPMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFK             
Sbjct: 121 NPMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKIYPIIYCIPIAIF 180

Query: 181 XXXNKRNQGPRTQXXXXXXXXXXXXXXXXXCGWAMYKIYGYEFLDQAYLYHLYRTDHRHN 240
              NKRNQGPRTQ                 CGWAMYKIYGYEFLDQAYLYHLYRTDHRHN
Sbjct: 181 IYYNKRNQGPRTQLTSLLNIGLSTLTTLLGCGWAMYKIYGYEFLDQAYLYHLYRTDHRHN 240

Query: 241 FSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFA 300
           FSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFA
Sbjct: 241 FSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFA 300

Query: 301 FVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGK 360
           FVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGK
Sbjct: 301 FVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGK 360

Query: 361 NVFYPGLFIASVLFFVTNVWLLGQFITDIKIPTQPTV 397
           NVFYPGLFIASVLFFVTNVWLLGQFITDIKIPTQPTV
Sbjct: 361 NVFYPGLFIASVLFFVTNVWLLGQFITDIKIPTQPTV 397

>Scas_647.6
          Length = 423

 Score =  467 bits (1202), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 244/404 (60%), Positives = 282/404 (69%), Gaps = 15/404 (3%)

Query: 1   MTGEEWGLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYE--------- 51
           +   E  L V   L+RV F+LFGIYQDA+FKVRYTDIDYFVFHDAA YVYE         
Sbjct: 3   LQNTERLLVVSGLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNF 62

Query: 52  --GKSPYARDTYRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQ---AI 106
               SPY RDTYRYTPLLSWLLVP+HYF  FHLGK +F+IFDL TG++IMK+L      I
Sbjct: 63  PVNGSPYQRDTYRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNISPKI 122

Query: 107 SRKRALILESIWLLNPMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHF 166
           S  +  +L SIWLLNPMVITISTRGNAES+LC L+M +L+FLQK RY LAGI+YGLSIHF
Sbjct: 123 SSLKLGLLSSIWLLNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHF 182

Query: 167 KXXXXXXXXXXXXXXXXNKRNQGP-RTQXXXXXXXXXXXXXXXXXCGWAMYKIYGYEFLD 225
           K                   N     ++                  G  MY IYG+EFLD
Sbjct: 183 KIYPIIYCLAISIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLD 242

Query: 226 QAYLYHLYRTDHRHNFSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNP 285
           QAY YHLYRTDHRHNFS+WN+LLY DSA+  N  S LS+++F PQ+L+ +V   LE+  P
Sbjct: 243 QAYFYHLYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQP 302

Query: 286 TFDNLLRVLFVQTFAFVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQ 345
           TF NLL VLF+QTFAFVTYNKVCTSQYFVWYLIFLPF L  T I  K+G+ M  +WVGTQ
Sbjct: 303 TFANLLNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQ 362

Query: 346 GIWLSQGYYLEFEGKNVFYPGLFIASVLFFVTNVWLLGQFITDI 389
            +WLSQGYYLEFEG+NVFYPG+F  +V FF  NVW LGQFI DI
Sbjct: 363 ALWLSQGYYLEFEGRNVFYPGIFFGAVAFFAGNVWTLGQFIDDI 406

>KLLA0D09647g complement(814829..816037) some similarities with
           sp|P47088 Saccharomyces cerevisiae YJR013w singleton,
           hypothetical start
          Length = 402

 Score =  417 bits (1071), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 208/380 (54%), Positives = 269/380 (70%), Gaps = 4/380 (1%)

Query: 16  RVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPLLSWLLVPNH 75
           R+GFF +GI+QD++F V+YTDIDYFVFHDAA YV  G+SPY RDTYRYTPLLS+LL+PN+
Sbjct: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTYRYTPLLSFLLLPNY 75

Query: 76  YFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLLNPMVITISTRGNAES 135
           Y  W H+GKV FV+FDL+TG++I+KLL  +    + LIL SIWLLNP+VITISTRGNAES
Sbjct: 76  YLKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLLNPIVITISTRGNAES 135

Query: 136 VLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKXXXXXXXXXXXXXXXXNKRNQGPRTQXX 195
           VLC LI+  L+FL++ R  ++G+ YGLSIHFK                +  N   R    
Sbjct: 136 VLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHN---RNCIW 192

Query: 196 XXXXXXXXXXXXXXXCGWAMYKIYGYEFLDQAYLYHLYRTDHRHNFSVWNMLLYLDSANK 255
                            + MYK+YG EF++ +Y+YHL RTDHRHNFS+WN++L L+SA  
Sbjct: 193 RLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWNLVLLLESAGI 252

Query: 256 ENGES-NLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFAFVTYNKVCTSQYFV 314
              +S  LS+ AFVPQL L  V   L W + TF+NL+ VLFVQT+AFVT+NKVCTSQYF+
Sbjct: 253 HLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQTYAFVTFNKVCTSQYFI 312

Query: 315 WYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGKNVFYPGLFIASVLF 374
           WYL+  PFY + T I W+KG++   LW+ +Q +WLSQ Y LEF+G+NVF+P LF  +++F
Sbjct: 313 WYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVFFPNLFFGNIVF 372

Query: 375 FVTNVWLLGQFITDIKIPTQ 394
           F+ NV+LLG FITDIK  T 
Sbjct: 373 FLINVYLLGVFITDIKSRTS 392

>Kwal_33.15449
          Length = 396

 Score =  414 bits (1064), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 207/384 (53%), Positives = 273/384 (71%), Gaps = 8/384 (2%)

Query: 7   GLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPL 66
           GL  +S ++RVGFFL+G+YQD +F V+YTDIDYFVF+DAA++V+ G SPY RDTYRYTPL
Sbjct: 9   GLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRYTPL 68

Query: 67  LSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLLNPMVIT 126
           LSWLLVPNHY  W H GK++FV+ DL+TG++I+ LL +  +++R LIL S+WLLN MVIT
Sbjct: 69  LSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALL-EIPNKRRRLILASLWLLNIMVIT 127

Query: 127 ISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKXXXXXXXXXXXXXXXXNKR 186
           ISTRGNAESV+C L++ +L+FL+   Y LAG + GL+IHFK                 K+
Sbjct: 128 ISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIAVYIYFQKK 187

Query: 187 NQGPRTQXXXXXXXXXXXXXXXXXCGWAMYKIYGYEFLDQAYLYHLYRTDHRHNFSVWNM 246
           +                         + MY  YG E+L+ AYLYH+ RTDHRHNFSV++M
Sbjct: 188 DG-----LVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTDHRHNFSVFHM 242

Query: 247 LLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFAFVTYNK 306
           LLY +SA     ES  ++ AF+PQ ++ L    L + + +F+NLL VLF+QT+AFVTYNK
Sbjct: 243 LLYFESALP--AESYWAKLAFLPQAMITLGVVPLCFRSSSFNNLLSVLFIQTYAFVTYNK 300

Query: 307 VCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGKNVFYPG 366
           VCTSQYF+WYLIFLPF+L+ T I  ++G+ M  LW+ TQ  WL  GY LEF+G+NVFYPG
Sbjct: 301 VCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEFKGQNVFYPG 360

Query: 367 LFIASVLFFVTNVWLLGQFITDIK 390
           LF+AS+ FF++NVW++GQFI DI 
Sbjct: 361 LFLASLSFFLSNVWIIGQFINDIN 384

>ACR034W [1082] [Homologous to ScYJR013W - SH]
           complement(420791..421984) [1194 bp, 397 aa]
          Length = 397

 Score =  412 bits (1060), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/390 (54%), Positives = 264/390 (67%), Gaps = 5/390 (1%)

Query: 1   MTGEEWGLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDT 60
           M  EE  L +   L RVGFF +GIYQDA+F V+YTDIDY VFHDAA+YV +G SPY RDT
Sbjct: 1   MKREECLLVLAGLLARVGFFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDT 60

Query: 61  YRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKRALILESIWLL 120
           YRYTPLLSW+LVPNH+  W H GK IFV+FDL+ G+++M LL +   R+R LIL S+WLL
Sbjct: 61  YRYTPLLSWMLVPNHWLQWVHFGKFIFVLFDLLAGVMVMNLLGKC-GRRRKLILASLWLL 119

Query: 121 NPMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKXXXXXXXXXXXXX 180
           NP+VIT+STRGNAESV+  LIM+ L  L+  ++ L+G +YG++IHFK             
Sbjct: 120 NPVVITVSTRGNAESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISIY 179

Query: 181 XXXNKRNQGPRTQXXXXXXXXXXXXXXXXXCGWAMYKIYGYEFLDQAYLYHLYRTDHRHN 240
               + ++G R                   CG  MY IYG+EFL+ AY+YH  RTDHRHN
Sbjct: 180 I---RSSEGSR-WFLRLLTMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRHN 235

Query: 241 FSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPTFDNLLRVLFVQTFA 300
           FS+WNMLLYLDS+       N + +AF+PQL +      + W  PTF N+  VLF+QTFA
Sbjct: 236 FSLWNMLLYLDSSGVVPTTINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQCVLFLQTFA 295

Query: 301 FVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFEGK 360
           FVTYNKVCTSQYF+WYL+FLP +L  T +   KG+ +  LWVGTQ  WL  GY LEFEGK
Sbjct: 296 FVTYNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFEGK 355

Query: 361 NVFYPGLFIASVLFFVTNVWLLGQFITDIK 390
           N+FYP LF A V FF+ NV+LL QFI D +
Sbjct: 356 NMFYPRLFSACVTFFLANVYLLAQFILDCR 385

>CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces
           cerevisiae YJR013w, hypothetical start
          Length = 431

 Score =  394 bits (1013), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 212/393 (53%), Positives = 264/393 (67%), Gaps = 10/393 (2%)

Query: 7   GLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPL 66
           GL  L+ L+R+ FFLFG+YQD +F V+YTDIDY VF+DAA +V   KSPY RDTYRYTPL
Sbjct: 8   GLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTPL 67

Query: 67  LSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISR-----KRALILESIWLLN 121
           LSWLL+PNH   WFH GK+IFV+ DL TG++I+++L +  S+      R  I+ +IWLLN
Sbjct: 68  LSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMAAIWLLN 127

Query: 122 PMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKXXXXXXXXXXXXXX 181
           PMVITISTRGNAESVLC LI+  L+     +Y L G+L+GLSIHFK              
Sbjct: 128 PMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKIYPIIYALPIAIYV 187

Query: 182 XXNKRN--QGPRTQXXXXXXXXXXXXXXXXXCGWAMYKIYGYEFLDQAYLYHLYRTDHRH 239
                N  Q                          MY +YG +F+DQ YLYH+YRTDHRH
Sbjct: 188 AAAHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHRH 247

Query: 240 NFSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPT-FDNLLRVLFVQT 298
           NFSVWNMLLY +SA  +  E  LS++ F+PQ+++VL     +   P+ F  L  VLF++T
Sbjct: 248 NFSVWNMLLYFNSALPKTSE--LSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLET 305

Query: 299 FAFVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEFE 358
           FAFVT+NKVCTSQYF+WYLIFLPF L  T I  ++G++M  +WV TQ +WL QGY LEFE
Sbjct: 306 FAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEFE 365

Query: 359 GKNVFYPGLFIASVLFFVTNVWLLGQFITDIKI 391
           G+NVFYPGLF ASV FFV+N W+LGQFI D  I
Sbjct: 366 GQNVFYPGLFCASVGFFVSNAWILGQFIEDTII 398

>Kwal_27.11558
          Length = 192

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 51  EGKSPYARDTYRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRKR 110
            G+   + ++ +      + + P  Y        ++F I + V    I K L+ + SRKR
Sbjct: 3   SGRCIISTESNKQCTYKKFTVTPAGYRRSCVTNLILFTIVNAVAFSCIEKNLDLSYSRKR 62

Query: 111 AL-----ILESIWLLNPMVITISTRGNA 133
            +     IL  +W+ NP + ++S   NA
Sbjct: 63  VVCLIFTILSLVWIRNPTIESLSVFKNA 90

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.144    0.478 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,110,094
Number of extensions: 493309
Number of successful extensions: 1355
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1361
Number of HSP's successfully gapped: 16
Length of query: 397
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 293
Effective length of database: 12,995,837
Effective search space: 3807780241
Effective search space used: 3807780241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)