Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR011C26125713440.0
Scas_647.42702675506e-70
Kwal_33.154442311011103e-06
CAGL0B03861g294105820.019
ABL083W38184740.19
AGR326C20291720.26
Sklu_2349.4107545626.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR011C
         (257 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protei...   522   0.0  
Scas_647.4                                                            216   6e-70
Kwal_33.15444                                                          47   3e-06
CAGL0B03861g complement(382452..383336) no similarity, hypotheti...    36   0.019
ABL083W [509] [Homologous to ScYHR201C (PPX1) - SH] complement(2...    33   0.19 
AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)...    32   0.26 
Sklu_2349.4 YDL231C, Contig c2349 5250-8477                            28   6.1  

>YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protein
           of unknown function [786 bp, 261 aa]
          Length = 261

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/257 (100%), Positives = 257/257 (100%)

Query: 1   MSETRESNESTVSSLQTKLLLNDGISENNKKNVILLNQIVPFILNTSHYMTDLMYVLYYL 60
           MSETRESNESTVSSLQTKLLLNDGISENNKKNVILLNQIVPFILNTSHYMTDLMYVLYYL
Sbjct: 1   MSETRESNESTVSSLQTKLLLNDGISENNKKNVILLNQIVPFILNTSHYMTDLMYVLYYL 60

Query: 61  AQKQEDEVLNHSGTFISHKKELLALKSDICELIYDLRTGFRLLLDSCELDHFETPGKCRH 120
           AQKQEDEVLNHSGTFISHKKELLALKSDICELIYDLRTGFRLLLDSCELDHFETPGKCRH
Sbjct: 61  AQKQEDEVLNHSGTFISHKKELLALKSDICELIYDLRTGFRLLLDSCELDHFETPGKCRH 120

Query: 121 LIEKVLVTSIYGVNRYIFQELNRLNVDFKDEFILQMQNCLSGFVNLYKFLNKIPMSKQQS 180
           LIEKVLVTSIYGVNRYIFQELNRLNVDFKDEFILQMQNCLSGFVNLYKFLNKIPMSKQQS
Sbjct: 121 LIEKVLVTSIYGVNRYIFQELNRLNVDFKDEFILQMQNCLSGFVNLYKFLNKIPMSKQQS 180

Query: 181 QMNDLQMKILVNVLQNELLPIWKFQLDLLNCKLFNELSKDKGLINIYRKATNDSVIDVSK 240
           QMNDLQMKILVNVLQNELLPIWKFQLDLLNCKLFNELSKDKGLINIYRKATNDSVIDVSK
Sbjct: 181 QMNDLQMKILVNVLQNELLPIWKFQLDLLNCKLFNELSKDKGLINIYRKATNDSVIDVSK 240

Query: 241 GEPFIRYVNWLKDQIIG 257
           GEPFIRYVNWLKDQIIG
Sbjct: 241 GEPFIRYVNWLKDQIIG 257

>Scas_647.4
          Length = 270

 Score =  216 bits (550), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/267 (44%), Positives = 176/267 (65%), Gaps = 20/267 (7%)

Query: 6   ESNEST--VSSLQTKLLLNDGISENNKKN----------VILLNQIVPFILNTSHYMTDL 53
           ESN +T  +++  T L   D ISE   K           V +LNQIVPF+L+TS+YMTDL
Sbjct: 5   ESNTTTNILTASNTSLANTDNISELTPKPSDSTLEQGRYVGILNQIVPFVLHTSYYMTDL 64

Query: 54  MYVLYYLAQKQEDEVLNHSGTFISHKKELLALKSDICELIYDLRTGFRLLLDSCELDHFE 113
           +Y LYY+A  +E    N           LL LK+++C L+  LRT FR LLD C+L+  E
Sbjct: 65  IYTLYYVANTEE----NMQEKNTEKSDALLNLKTELCSLVVKLRTRFRNLLDECDLNDPE 120

Query: 114 TPGKCRHLIEKVLVTSIYGVNRYIFQELNRLNVDFKDEF---ILQMQNCLSGFVNLYKFL 170
           TP   R+LI+K +++ +Y VN  +  EL  L+ D    F   I+Q+QNC +GF NL+ F+
Sbjct: 121 TPIVFRNLIDKNIISILYQVNDILTNELGELSNDHDSNFNGLIIQLQNCFNGFGNLFNFV 180

Query: 171 NKIPMSKQQSQMNDLQMKILVNVLQNELLPIWKFQLDLLNCKLFNELSKDKGLINIYRKA 230
            K+P+ ++Q ++  LQ+ +L+ V++N+LLP WK QLDLLNCKLF++LS+++ +++ YR+A
Sbjct: 181 KKMPL-QRQYKVTSLQLDVLITVVRNDLLPTWKTQLDLLNCKLFDDLSRNQNVVSRYREA 239

Query: 231 TNDSVIDVSKGEPFIRYVNWLKDQIIG 257
           TND   DV +GE F+++VNWLK++IIG
Sbjct: 240 TNDRDSDVKEGESFVKFVNWLKEEIIG 266

>Kwal_33.15444
          Length = 231

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 155 QMQNCLSGFVNLYKFLNKIPMSKQQSQMNDLQMKILVNVLQNELLPIWKFQLDLLNCKLF 214
            ++NC+ GFV ++ F  K+P+ ++Q Q++ LQM++L   L+ +LL  W  Q++ L+  + 
Sbjct: 134 HLKNCILGFVQIFHFFRKLPI-QEQYQISKLQMRVLELELKTDLLGPWTRQVETLHSTIG 192

Query: 215 NELSKDKGLINIYRKATNDSVIDVSKGEPFIRYVNWLKDQI 255
             L  D      +R   ++  I V        +  WL+++I
Sbjct: 193 WILLSDPH----FRNKLDEYKIKVQSDPEVPVFNEWLRNEI 229

>CAGL0B03861g complement(382452..383336) no similarity, hypothetical
           start
          Length = 294

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 51/105 (48%), Gaps = 11/105 (10%)

Query: 156 MQNCLSGFVNLYKFLNKIPM------SKQQSQMNDLQMKILVNVLQNELLPIWKFQLDLL 209
           M N   G  N+  +  K+ +        +Q  ++ ++ K L++ ++NELLP W+  L+  
Sbjct: 140 MNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTLLHCIKNELLPSWRKVLEDY 199

Query: 210 NCKLFNELSKDKGLINIY---RKATNDSVIDVSKGEPFIRYVNWL 251
               F+ + + + L +++    K+ +DS  +    E    Y+NW+
Sbjct: 200 KAACFDAVMQSRKLKDLFVTVDKSVSDS--NFEDTESMHTYLNWI 242

>ABL083W [509] [Homologous to ScYHR201C (PPX1) - SH]
           complement(241517..242662) [1146 bp, 381 aa]
          Length = 381

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 102 LLLDSCELDHFETPGKCRHLIEKVL-VTSIYGVNRYIFQELNRLNVDFKDEFILQMQNCL 160
           L +D   +DH E  G C+ LI++V+ V   +   R  ++++ + N  +    +    +C 
Sbjct: 105 LTIDGVLVDHNELQGPCKDLIDEVVGVIDHHEDQRIYYEQVKKTNGPY---IVAPTGSCS 161

Query: 161 SGFVNLYKFLNKIPMSKQQSQMND 184
           S  VN   + N I  S  QSQ+ D
Sbjct: 162 SHVVN---YWNGILGSSDQSQLTD 182

>AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)
           [609 bp, 202 aa]
          Length = 202

 Score = 32.3 bits (72), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 118 CRHLIEKVLVTSIYGVNRYIFQELNRLNVDFKDEFILQMQNCLSGFVNLYKFLNKIPMSK 177
           CR +I++ +   + G+ R   +   +L V  +   +  + NC +GFV+  +F+ K+P+  
Sbjct: 80  CRGVIDRPM---LQGLGRIKDKMQAQLQVAKETRLVNVLANCYNGFVHTLQFMRKLPVGN 136

Query: 178 QQS--QMNDLQMKILVNVLQNELLPIWKFQL 206
            Q   ++   Q K+L++  Q  +   WK QL
Sbjct: 137 GQVSYEIPAHQWKVLLDE-QESMNSNWKAQL 166

>Sklu_2349.4 YDL231C, Contig c2349 5250-8477
          Length = 1075

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 131 YGVNRYIFQELNRLNVDFKDEFILQMQNCLSGFVNLYKFLNKIPM 175
           YG    IF   +  N  F D F ++  N  + +++L+KF   IP 
Sbjct: 96  YGSESSIFSYFSHWNNSFSDFFSIEWSNVRNNWISLFKFF--IPF 138

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,640,546
Number of extensions: 383397
Number of successful extensions: 1345
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1341
Number of HSP's successfully gapped: 33
Length of query: 257
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 158
Effective length of database: 13,168,927
Effective search space: 2080690466
Effective search space used: 2080690466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)