Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR010W (MET3)51150226620.0
Scas_647.251150222230.0
CAGL0B03839g50750221810.0
Sklu_2014.150650320790.0
Kwal_33.1543450550220680.0
KLLA0E09812g50250220460.0
AGR322W50050217780.0
KLLA0B02827g94242665.0
AER353W149476657.3
KLLA0A07293g58356657.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR010W
         (502 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase (su...  1030   0.0  
Scas_647.2                                                            860   0.0  
CAGL0B03839g 380291..381814 highly similar to sp|P08536 Saccharo...   844   0.0  
Sklu_2014.1 YJR010W, Contig c2014 195-1715                            805   0.0  
Kwal_33.15434                                                         801   0.0  
KLLA0E09812g complement(870664..872172) highly similar to sp|P08...   792   0.0  
AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH] complement(...   689   0.0  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    30   5.0  
AER353W [2854] [Homologous to ScYMR219W (ESC1) - SH] complement(...    30   7.3  
KLLA0A07293g 652702..654453 weakly similar to sgd|S0005477 Sacch...    30   7.3  

>YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase
           (sulfate adenylyltransferase), catalyzes incorporation
           of inorganic sulfate into ATP to form adenosine
           5'-phosphosulfate (APS) [1536 bp, 511 aa]
          Length = 511

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/502 (100%), Positives = 502/502 (100%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
           NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV
Sbjct: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR
Sbjct: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL
Sbjct: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420

Query: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480
           QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS
Sbjct: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480

Query: 481 ADIQLESADEPISHIVQKVVLF 502
           ADIQLESADEPISHIVQKVVLF
Sbjct: 481 ADIQLESADEPISHIVQKVVLF 502

>Scas_647.2
          Length = 511

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/502 (81%), Positives = 446/502 (88%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           MPAPHGGILQDL+ARDA KK  L  EAQS  +  W LT RQ+CDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
            E DY SVV +SRLADGTLWT+PITLDVDE FA  + P++RI L QD EIPIAILTV DV
Sbjct: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           Y+P+K +EA++VFRGDPEHPAI YL N+AG+YY+GGSLEAIQLPQHYDYPGLRK PAQLR
Sbjct: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEFQSRQWDR+VAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNGIAFLSLLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           GVDFYGPYDAQELVESYK+ELDI+VVPFRMVTYLPDEDRYAPIDQIDT+KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LR+RLRVGGEIPEWFSYPEVVKILRESNPPRPKQGF+IVL +SL     QL+IALLSTFL
Sbjct: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420

Query: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480
           QFGGGR+YK+FEH N  +LL LI DFI +GSGLI+PNQW     S    QNVY L  S++
Sbjct: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480

Query: 481 ADIQLESADEPISHIVQKVVLF 502
           +DI+L+S DE I HIVQKVVLF
Sbjct: 481 SDIKLDSVDETIFHIVQKVVLF 502

>CAGL0B03839g 380291..381814 highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3, start by
           similarity
          Length = 507

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/502 (80%), Positives = 448/502 (89%), Gaps = 4/502 (0%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           MPAPHGG+LQDL+ARDA K++ LLSE+Q   +  W LT RQ+CDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGVLQDLVARDASKRDSLLSESQQ--LSQWTLTARQICDIELILNGGFSPLTGFL 58

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
            + DY+ VV +SRL+DGTLWT+PITLDV E FAN +KP+ RIAL QD  IP+AILTV+D+
Sbjct: 59  AQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDI 118

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           YKP+K++EAEKVFRGDPEHPAI+YLFN AGDYY+GG+L+AIQLPQHYDYPGLRKTPAQLR
Sbjct: 119 YKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLR 178

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 179 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVR 238

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNGIAFLSLLPLAMRM GDREAVWHAIIRKNYGASHFIVGRDHAGPG NSK
Sbjct: 239 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSK 298

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           GVDFYGPYDAQELVESYK+ELDI+VVPFRMVTYLPDEDRYAPID+IDT+KTRTLNISGTE
Sbjct: 299 GVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTE 358

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LR+RLR GGEIPEWFSYPEVVKILRESNPPRPKQGF++V  + + V R+QLSIALLSTFL
Sbjct: 359 LRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFL 418

Query: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480
           QFGGGR+YKI++HN+K E L LI DF+ +GSGLIIP+ W     + V   NVY +  +  
Sbjct: 419 QFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWS--ASNKVNSANVYTIGHAKD 476

Query: 481 ADIQLESADEPISHIVQKVVLF 502
           ADI+L S +E I HIVQKVVLF
Sbjct: 477 ADIKLASTEETIFHIVQKVVLF 498

>Sklu_2014.1 YJR010W, Contig c2014 195-1715
          Length = 506

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/503 (77%), Positives = 440/503 (87%), Gaps = 7/503 (1%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           MPAPHGG+LQDLIARDA  K +LL EA  S  L W+LT RQ+CD+ELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGVLQDLIARDASIKPQLLQEASDSK-LTWSLTGRQICDLELILNGGFSPLTGFL 59

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
           NE DY+SVV DSRL++G +WT+PITLDVD  FA++++ D RI L Q++EIP+A LTV DV
Sbjct: 60  NEKDYTSVVNDSRLSNGLVWTMPITLDVDSEFASKLQIDDRILLLQENEIPLAFLTVTDV 119

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           YKP+K++EA+KVFRGDPEHPAISYL N+AG+YYVGG L+AIQLPQHYDYPGLR+TPAQLR
Sbjct: 120 YKPDKSVEAKKVFRGDPEHPAISYLNNIAGEYYVGGELQAIQLPQHYDYPGLRRTPAQLR 179

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEF S+QWDR+VAFQTRNPMHRAHRELTVRAARE NAK+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 180 LEFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREQNAKILIHPVVGLTKPGDIDHHTRVR 239

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPGKNSK
Sbjct: 240 VYQEIIKRYPNGMAHLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSK 299

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           GVDFYG YDAQELVESYK+EL+IEVVPFRMVTYLPDEDRYAPIDQID   T+TLNISGTE
Sbjct: 300 GVDFYGAYDAQELVESYKNELEIEVVPFRMVTYLPDEDRYAPIDQIDLATTKTLNISGTE 359

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LR RLR GGEIP WFSYPEVVKILRES+PPRP QGF++VL +SL  + +QLSIALLSTFL
Sbjct: 360 LRNRLRDGGEIPAWFSYPEVVKILRESSPPRPNQGFAVVLDDSLK-NNKQLSIALLSTFL 418

Query: 421 QFGGGRYYKIFEH-NNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSS 479
           QFGGGR+YKIF H NN  EL+ LI DFI SG+GLI+P Q+    D+     NV+ +  + 
Sbjct: 419 QFGGGRHYKIFNHSNNNEELVELIPDFIRSGAGLIVPGQFNGSSDAT----NVFTVGVAD 474

Query: 480 SADIQLESADEPISHIVQKVVLF 502
            A+I+LES DEPI H+VQKVVLF
Sbjct: 475 DAEIKLESEDEPILHVVQKVVLF 497

>Kwal_33.15434
          Length = 505

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/502 (75%), Positives = 438/502 (87%), Gaps = 6/502 (1%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           MPAPHGGILQDLIARDA  KN+LL EA  + I  W+LT RQ+CD+ELI NGGFSPL+GFL
Sbjct: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKI-TWDLTARQICDLELIQNGGFSPLSGFL 59

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
           N+ DY SVV +SRL++  +WTIPITLDVD  FA Q+KP+TR+ L QD+EIP+AILTV DV
Sbjct: 60  NQKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDV 119

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           YKP+K +EA+KVFRGDPEHPA+ YL   AG+YYVGG ++AIQ P HYDYPGLRKTPAQLR
Sbjct: 120 YKPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLR 179

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDR+VAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 180 LEFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVR 239

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPGKNS 
Sbjct: 240 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSA 299

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           GVDFYG YDAQELVE+YKHELDIEVVPFRMVTYLPDEDRYAPIDQID + T+TLNISGTE
Sbjct: 300 GVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTE 359

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LR RLR GG IPEWFSYPEVVKILRESNPPRP+QGF+IVL ++L+ + +QL+ ALLSTFL
Sbjct: 360 LRNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALS-NNKQLATALLSTFL 418

Query: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480
           QFGGGR+YK+ EH++++ +L L+ DFI SG+GLIIP+++++   +     N Y + TS  
Sbjct: 419 QFGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATT----NAYQVGTSDG 474

Query: 481 ADIQLESADEPISHIVQKVVLF 502
           ADI+LES DE + H+VQKVVLF
Sbjct: 475 ADIKLESNDESVLHVVQKVVLF 496

>KLLA0E09812g complement(870664..872172) highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3 sulfate
           adenylyltransferase singleton, start by similarity
          Length = 502

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/502 (75%), Positives = 428/502 (85%), Gaps = 9/502 (1%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           MP+PHGG+LQDL+ARDA KK ELL  AQS D+  W+LT RQ+CD+ELILNGGFSPL GFL
Sbjct: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
           N+ DY SVV  SRL +G +WTIPITLDVD  FA+Q+ PD RI L QD+E P+AILTV DV
Sbjct: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           Y+P+K +EA+KVFRGDPEHPA+ YLF  AG++YVGGSLEAIQLP HYDYPG RKTPAQLR
Sbjct: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDRVVAFQTRNPMHRAHRELTVRAAR  N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRM GDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK
Sbjct: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           GVDFYGPYDAQELVESYK+ELDIEVVPFRMVTYLPDEDRYAPID+IDT KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LR RLR GGEIP WFSYPEVVKILRESNP RPKQGF++VL  +L     QL  ALLSTFL
Sbjct: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPA---QLKTALLSTFL 417

Query: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480
           Q+GGGR+YK+ EH N  E+L+L+ DF+ SG+GLI+ N       S +   NV+ +   S 
Sbjct: 418 QYGGGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNA------SSLKGTNVFKIGEESG 471

Query: 481 ADIQLESADEPISHIVQKVVLF 502
           +DI LE+ D+ I HIVQ+VVLF
Sbjct: 472 SDIPLETEDKNILHIVQRVVLF 493

>AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH]
           complement(1332643..1334145) [1503 bp, 500 aa]
          Length = 500

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/502 (67%), Positives = 406/502 (80%), Gaps = 11/502 (2%)

Query: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60
           M +PHGGILQDL+ARDA KK+ LL EAQ   +  WNLT RQLCDIELILNGGFSPLTGFL
Sbjct: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQG--LPQWNLTARQLCDIELILNGGFSPLTGFL 58

Query: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120
            + DY SVV +SRL  G LWTIPITLDVDE FA  +    RIAL QDD+I +AI+TV D+
Sbjct: 59  GKEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDI 118

Query: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180
           Y P+K +EA+KVFRGD EHPAI YL   AGD Y+GG LEAIQLP HYDY  LRK+PA LR
Sbjct: 119 YTPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALR 178

Query: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
            +F ++QWDRVVAFQTRNPMHRAHRELT+RAA+E NAKVL+HPVVGLTKPGDID+HTR++
Sbjct: 179 ADFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIK 238

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300
           VY+EI+KRYP GIA L+LLPLAMRM+GDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 239 VYKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSK 298

Query: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360
           G DFYGPYDAQ LVESYK+EL IEVVPF+++TYLPD+D Y P+D+ID +  +TL ISGTE
Sbjct: 299 GDDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGS-VKTLTISGTE 357

Query: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420
           LR+RLR G +IP+WF+YPE+V+ILR+ NPPR +QGF IV+ +    + ++++ ALLSTFL
Sbjct: 358 LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHE---NPKRIANALLSTFL 414

Query: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480
           Q GGGR YKIF+H  + +LL LI DF+ SG+GLI+ +       S V   N+Y L+T  S
Sbjct: 415 QVGGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLP----SSVDAHNIYELNTYPS 470

Query: 481 ADIQLESADEPISHIVQKVVLF 502
           A I++ SA EP++ IVQK V F
Sbjct: 471 AHIKV-SATEPVTEIVQKTVFF 491

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 232 DIDHHTRVRVYQEIIKRYPNGIA---FLSLLPLAMRMSGDRE 270
           D+DH +RV+V + I K    G+A   FL+  P+ +   GD +
Sbjct: 279 DLDHRSRVQVLKGIHKEVNGGVARASFLNGQPIVVTCGGDNQ 320

>AER353W [2854] [Homologous to ScYMR219W (ESC1) - SH]
           complement(1285734..1290218) [4485 bp, 1494 aa]
          Length = 1494

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 6   GGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFLNENDY 65
           G ++ DL+  D+L +N L+ E Q S+   +N +P  + D EL++      +   L  ++ 
Sbjct: 581 GMVVADLVTDDSLGENGLVVE-QVSEESSYNGSPEVMQDPELLVEA----VPDKLEVHEV 635

Query: 66  SSVVTDSRLADGTLWT 81
           +S++ D  LA  ++ T
Sbjct: 636 ASIIQDGILASSSMKT 651

>KLLA0A07293g 652702..654453 weakly similar to sgd|S0005477
           Saccharomyces cerevisiae YOL117w, hypothetical start
          Length = 583

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 401 GNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIP 456
           GN++T++R+QL   L+ +  +     YYK          L L++D++  G    +P
Sbjct: 442 GNTITMNRDQLLTLLMKSIAKDTADVYYK----------LDLVEDYVYFGEEYFVP 487

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,231,405
Number of extensions: 772123
Number of successful extensions: 1919
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1944
Number of HSP's successfully gapped: 21
Length of query: 502
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 396
Effective length of database: 12,926,601
Effective search space: 5118933996
Effective search space used: 5118933996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)