Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJR010C-A (SPC1)94944881e-65
Scas_647.390902599e-31
Kwal_33.1544288882293e-26
Sklu_2014.488872223e-25
AGR325C91891782e-18
KLLA0E09724g91811651e-16
Sklu_2336.767857601.6
YGL200C (EMP24)20330591.8
CAGL0L10956g69147565.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJR010C-A
         (94 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit...   192   1e-65
Scas_647.3                                                            104   9e-31
Kwal_33.15442                                                          93   3e-26
Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement       90   3e-25
AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH] (1337706....    73   2e-18
KLLA0E09724g 862612..862887 weakly similar to sp|P46965 Saccharo...    68   1e-16
Sklu_2336.7 YDR205W, Contig c2336 8748-10784                           28   1.6  
YGL200C (EMP24) [1795] chr7 complement(122697..123308) Component...    27   1.8  
CAGL0L10956g complement(1169353..1171428) weakly similar to tr|Q...    26   5.2  

>YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit
          of the signal peptidase complex [285 bp, 94 aa]
          Length = 94

 Score =  192 bits (488), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60
          MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC
Sbjct: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60

Query: 61 VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD 94
          VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD
Sbjct: 61 VITLICVLPAYPWYNKQKLRWAQPKIEINVDQYD 94

>Scas_647.3
          Length = 90

 Score =  104 bits (259), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%)

Query: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60
          MS IL ++Q+ LV PIDFPSQ++T + QQ  L+IGA+ A I GF  QSL   L  YG++ 
Sbjct: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGVTF 60

Query: 61 VITLICVLPAYPWYNKQKLRWAQPKIEINV 90
          V+TL+ V+P YP+YNKQKL+W QPK+  N+
Sbjct: 61 VVTLLLVVPPYPFYNKQKLQWVQPKLATNL 90

>Kwal_33.15442
          Length = 88

 Score = 92.8 bits (229), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%)

Query: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60
          MSE+LQ++Q+KLVFPIDF SQR+T++    +L+ G + AC +G   QSL  L+ ++G+S 
Sbjct: 1  MSEVLQEIQKKLVFPIDFASQRETDRLVNRTLIFGTIAACFIGLFTQSLANLMMSFGVSL 60

Query: 61 VITLICVLPAYPWYNKQKLRWAQPKIEI 88
           +    VLP+Y  YNK++  W + KI I
Sbjct: 61 ALCFAAVLPSYSAYNKRRPEWVKTKISI 88

>Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement
          Length = 88

 Score = 90.1 bits (222), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 62/87 (71%)

Query: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60
          MSE+LQ++ R +VFPIDFPSQ+ TEK     L  G +V+C +GF  QSL  L+  YG  C
Sbjct: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATLVYCYGACC 60

Query: 61 VITLICVLPAYPWYNKQKLRWAQPKIE 87
          ++ L+ VLP+YP YNK++L+WA  KIE
Sbjct: 61 LLCLLLVLPSYPTYNKRRLKWAGTKIE 87

>AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH]
          (1337706..1337981) [276 bp, 91 aa]
          Length = 91

 Score = 73.2 bits (178), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 52/89 (58%)

Query: 3  EILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVI 62
          EI  D+ RKLVFPID+PSQR+  K   + L  G LV+C+LGF   SL + L A+  +  +
Sbjct: 2  EIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSLTLYAFAAAYGL 61

Query: 63 TLICVLPAYPWYNKQKLRWAQPKIEINVD 91
           L+ V+PAY  Y +QKL W         D
Sbjct: 62 ALLLVVPAYGKYRQQKLAWVGSAAATTKD 90

>KLLA0E09724g 862612..862887 weakly similar to sp|P46965
          Saccharomyces cerevisiae YJR010ca SPC1 signal peptidase
          10.8 kDa subunit singleton, hypothetical start
          Length = 91

 Score = 68.2 bits (165), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%)

Query: 3  EILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVI 62
          E+LQD+ R+LVFPIDF SQ  TE     +L +    + I G+  +S+KV    + +  ++
Sbjct: 2  EVLQDLGRQLVFPIDFESQSYTESISNKALYLITFFSFISGYLTESIKVSGIVFVLGLIV 61

Query: 63 TLICVLPAYPWYNKQKLRWAQ 83
           L+ VLP Y  YNK + +WA 
Sbjct: 62 VLVIVLPPYSAYNKHRPQWAN 82

>Sklu_2336.7 YDR205W, Contig c2336 8748-10784
          Length = 678

 Score = 27.7 bits (60), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 23  KTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVITLI----CVLPAYPWYN 75
           KT ++  L   IG L    L    +     L+ Y I  V+ L+    CVL  Y W N
Sbjct: 127 KTSQYPTLVSYIGLLATVFLQRRSKKAAKYLSGYRIPTVVLLVLSISCVLITYVWIN 183

>YGL200C (EMP24) [1795] chr7 complement(122697..123308) Component
          of COPII-coated vesicles possibly involved in cargo
          sorting [612 bp, 203 aa]
          Length = 203

 Score = 27.3 bits (59), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 31 SLMIGALVACILGFAQQSLKVLLTAYGISC 60
          S     ++AC L F+  +  VLL AYG  C
Sbjct: 3  SFATKFVIACFLFFSASAHNVLLPAYGRRC 32

>CAGL0L10956g complement(1169353..1171428) weakly similar to
           tr|Q12033 Saccharomyces cerevisiae YOR275c, start by
           similarity
          Length = 691

 Score = 26.2 bits (56), Expect = 5.2,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 2   SEILQDVQRKLVFPIDFPSQRK--TEKFQQLSLMIGALVACILGFAQ 46
           ++ +QDV++ L    D  +Q K  T  +QQL   +  LV  I+GF +
Sbjct: 628 TQYIQDVRQSLASLDDVKTQLKKGTAYYQQLIEKVNELVQVIVGFLE 674

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.139    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,796,283
Number of extensions: 87707
Number of successful extensions: 263
Number of sequences better than 10.0: 11
Number of HSP's gapped: 263
Number of HSP's successfully gapped: 11
Length of query: 94
Length of database: 16,596,109
Length adjustment: 65
Effective length of query: 29
Effective length of database: 14,345,939
Effective search space: 416032231
Effective search space used: 416032231
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)