Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJL080C (SCP160)1222120058880.0
Scas_711.361219115637180.0
CAGL0M03223g1209116433430.0
Kwal_14.23971206117130400.0
AAL177W1198115430380.0
KLLA0D02398g1205110326820.0
Kwal_27.12486299140850.061
Scas_515.634260850.062
KLLA0B03542g657198840.11
KLLA0E00847g713139810.22
CAGL0G04037g778142810.24
Kwal_55.20652694232800.28
Sklu_1732.229854750.87
YLL032C825197751.1
KLLA0D17094g29646721.9
Scas_543.681263722.7
AER186C31653703.9
KLLA0E09350g629148705.2
AFR186W71775705.2
Scas_667.637838678.6
YGR273C17454659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL080C
         (1200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein...  2272   0.0  
Scas_711.36                                                          1436   0.0  
CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...  1292   0.0  
Kwal_14.2397                                                         1175   0.0  
AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH] complement(...  1174   0.0  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...  1037   0.0  
Kwal_27.12486                                                          37   0.061
Scas_515.6                                                             37   0.062
KLLA0B03542g complement(321676..323649) similar to sp|P32349 Sac...    37   0.11 
KLLA0E00847g complement(87991..90132) some similarities with sgd...    36   0.22 
CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces c...    36   0.24 
Kwal_55.20652                                                          35   0.28 
Sklu_1732.2 YLR146C, Contig c1732 733-1629 reverse complement          33   0.87 
YLL032C (YLL032C) [3388] chr12 complement(74269..76746) Protein ...    33   1.1  
KLLA0D17094g complement(1449542..1450432) similar to sp|Q12455 S...    32   1.9  
Scas_543.6                                                             32   2.7  
AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH] (982057..98...    32   3.9  
KLLA0E09350g complement(832187..834076) similar to sgd|S0005548 ...    32   5.2  
AFR186W [3378] [Homologous to ScYLL032C - SH] complement(775246....    32   5.2  
Scas_667.6                                                             30   8.6  
YGR273C (YGR273C) [2218] chr7 complement(1038719..1039243) Prote...    30   9.4  

>YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein
            involved in control of mitotic chromosome transmission,
            contains 14 KH domains which are found in RNA-binding
            proteins such as Mer1p and mouse hnRNP X [3669 bp, 1222
            aa]
          Length = 1222

 Score = 2272 bits (5888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1133/1200 (94%), Positives = 1133/1200 (94%)

Query: 1    MSEEQTAIDSPPXXXXXXXXXXXXXXXXXXXXXXXXXXXEEHPQLEKKPTPLPSLKDLPS 60
            MSEEQTAIDSPP                           EEHPQLEKKPTPLPSLKDLPS
Sbjct: 1    MSEEQTAIDSPPSTVEGSVETVTTIDSPSTTASTIAATAEEHPQLEKKPTPLPSLKDLPS 60

Query: 61   LGSNAAFANVKVSWGPNMKXXXXXXXXXXXXXXXLTTGLGAKRMRSKNIQEAFTLDLQSQ 120
            LGSNAAFANVKVSWGPNMK               LTTGLGAKRMRSKNIQEAFTLDLQSQ
Sbjct: 61   LGSNAAFANVKVSWGPNMKPAVSNSPSPSPSAPSLTTGLGAKRMRSKNIQEAFTLDLQSQ 120

Query: 121  LSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKRELVKKLTKPINA 180
            LSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKRELVKKLTKPINA
Sbjct: 121  LSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKRELVKKLTKPINA 180

Query: 181  VIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFE 240
            VIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFE
Sbjct: 181  VIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFE 240

Query: 241  SVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDEEVKVQFYKKSGDI 300
            SVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDEEVKVQFYKKSGDI
Sbjct: 241  SVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDEEVKVQFYKKSGDI 300

Query: 301  VILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEELKEKYNVIVTFPST 360
            VILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEELKEKYNVIVTFPST
Sbjct: 301  VILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEELKEKYNVIVTFPST 360

Query: 361  PDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFTKYSVL 420
            PDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFTKYSVL
Sbjct: 361  PDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFTKYSVL 420

Query: 421  KGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELISFVNNIPPSETL 480
            KGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELISFVNNIPPSETL
Sbjct: 421  KGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELISFVNNIPPSETL 480

Query: 481  VITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKPSIEEIQA 540
            VITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKPSIEEIQA
Sbjct: 481  VITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKPSIEEIQA 540

Query: 541  SLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQEGHLQIKL 600
            SLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQEGHLQIKL
Sbjct: 541  SLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQEGHLQIKL 600

Query: 601  HTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQI 660
            HTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQI
Sbjct: 601  HTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQI 660

Query: 661  REKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVP 720
            REKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVP
Sbjct: 661  REKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVP 720

Query: 721  VKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKAHEELKALLDFEME 780
            VKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKAHEELKALLDFEME
Sbjct: 721  VKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKAHEELKALLDFEME 780

Query: 781  NGHKMVINVPAEHVPRXXXXXXXXXXXXRAEYGVEMDFLQKSTDPKAQETGEVELEITGS 840
            NGHKMVINVPAEHVPR            RAEYGVEMDFLQKSTDPKAQETGEVELEITGS
Sbjct: 781  NGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGS 840

Query: 841  RQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKS 900
            RQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKS
Sbjct: 841  RQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKS 900

Query: 901  VDIPNADSENKDITVQGPQKFXXXXXXXXXXXXXDAENSVTKTIDIPAERKGALIGPGGI 960
            VDIPNADSENKDITVQGPQKF             DAENSVTKTIDIPAERKGALIGPGGI
Sbjct: 901  VDIPNADSENKDITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIPAERKGALIGPGGI 960

Query: 961  VRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIRENFDREVDVPASI 1020
            VRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIRENFDREVDVPASI
Sbjct: 961  VRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIRENFDREVDVPASI 1020

Query: 1021 YEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVCGSTEGENAEKTKF 1080
            YEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVCGSTEGENAEKTKF
Sbjct: 1021 YEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVCGSTEGENAEKTKF 1080

Query: 1081 TIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAKKEEALDTAVKL 1140
            TIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAKKEEALDTAVKL
Sbjct: 1081 TIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAKKEEALDTAVKL 1140

Query: 1141 IKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINVPRKSDKVNDVV 1200
            IKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINVPRKSDKVNDVV
Sbjct: 1141 IKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVIINVPRKSDKVNDVV 1200

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 5/53 (9%)

Query: 727  LIGPHGTYRNRLQEKYNVFINFPRD----NEIVTIRGPSRGVNKAHEE-LKAL 774
            ++GP G+   +++E  +V IN PR     N++V IRG   GV KA E  LK+L
Sbjct: 1168 IVGPGGSNIKKIREAADVIINVPRKSDKVNDVVYIRGTKAGVEKAGEMVLKSL 1220

>Scas_711.36
          Length = 1219

 Score = 1436 bits (3718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/1156 (61%), Positives = 900/1156 (77%), Gaps = 11/1156 (0%)

Query: 49   PTPLPSLKDLPSLGSNAAFANVKVSWGPNMKXXXXXXXXXXXXXXXLTTGL-GAKRMRSK 107
            P PLPSLKDLPSLGSN+ FAN KV+WGPNM+                 + + GAKRMRSK
Sbjct: 49   PVPLPSLKDLPSLGSNSIFANSKVTWGPNMQPSPPISCSPSLSSSLSPSPVSGAKRMRSK 108

Query: 108  NIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAK 167
            NIQE+FTLDLQSQLSITKPELSRIVQSVK+ ++VSVESTLSKN+RTFL+SGVA  V +AK
Sbjct: 109  NIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAK 168

Query: 168  RELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMD 227
            R+LVK+LT+PI+ V+ VP++C+A+IIGSGG+TIR IS+ Y+V IN+++E N +SYDED++
Sbjct: 169  RDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLN 228

Query: 228  DTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDE 287
            D T+NV+  GDFESVN+AK +I  IVKEETK  ++++ V+DEK +P+ID+S     EG  
Sbjct: 229  DFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEG-- 286

Query: 288  EVKVQFYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEEL 347
             VK  FY+ + ++ I GPR+  KATKT +QDYL +L+S L EEK+KIP+KFQFLID + L
Sbjct: 287  -VKCNFYRDTAEVNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKAL 345

Query: 348  KEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHA 407
            K+++NVIVTFPS P DELVSFVG +DKV EAI +AR++SK++ V+SLDISK+HSKNL HA
Sbjct: 346  KKEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHA 405

Query: 408  KNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKEL 467
            KNL +YFTKY  LK ++E++P VKI LP+   L  A +V I+ISAKS+ AN+IK  RKEL
Sbjct: 406  KNLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKEL 465

Query: 468  ISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTE 527
            I+FVN I P +TL ITDLDYELF  SIK  LLA+E  V F+Q GDY+P ++SI+L   + 
Sbjct: 466  INFVNTITPLDTLTITDLDYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSP 525

Query: 528  DEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIME 587
            +EDFKPS EEI A L K N SL  LR K N M  K Y    ++QD L  PSSAT  LI+E
Sbjct: 526  EEDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILE 585

Query: 588  DISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVA 647
            D+S++EG+LQIKLHTPE N++T+RGD+KA K ANK   SI+ +P+ KSK+TV + +NS+A
Sbjct: 586  DVSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIA 645

Query: 648  RLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAK 707
            RL+G KGSNL +IREKF CQID+P   N++  KDKT E+ LTG EYNL  AKK++AAEAK
Sbjct: 646  RLVGTKGSNLNEIREKFDCQIDVP---NHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAK 702

Query: 708  KWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKA 767
            KWADI+TKEL+VP K+HGSLIG +G YRNRLQ+KY+VFINFPRD++IVTIRGPSRGV +A
Sbjct: 703  KWADIVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQA 762

Query: 768  HEELKALLDFEMENGHKMVINVPAEHVPRXXXXXXXXXXXXRAEYGVEMDFLQKSTDPKA 827
              EL ALLDFE ENG+K ++ VPAEHVPR            RA++GVEMDFLQKSTDPK 
Sbjct: 763  FTELSALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKV 822

Query: 828  QETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREI 887
            QETGEVELEITG+R  I +AA +V+ I+ EA+DF +E L +  KYH+ IVGSGGH LR+I
Sbjct: 823  QETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDI 882

Query: 888  ISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFXXXXXXXXXXXXXDAENSVTKTIDIP 947
            ISKAGG++IRNK++DIPNA+SE+  ITVQGP+KF             D ENSVTKT++IP
Sbjct: 883  ISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIP 942

Query: 948  AERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIR 1007
             ER GAL+GPGG++RRQLE+EFN+ L VP+K++ +G + ITG PENVEKAEKKIL EI+R
Sbjct: 943  EERHGALVGPGGMIRRQLETEFNVILEVPHKNE-TGPVRITGLPENVEKAEKKILTEIVR 1001

Query: 1008 ENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVC 1067
            ++FDRE+ VPAS++E+VSERGAF QKLR++  VNV+ GN S++A +L R+ + IP+EKV 
Sbjct: 1002 DSFDRELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVR 1061

Query: 1068 GSTEGENAEKTKFTIEEVGAPTSS-EEGDITMRLTYEPIDLSSILSD--GEEKEVTKDTS 1124
             +TE E  E+ +  IEEVG P +  E+GDI  RLTYEPID S +LS+   E KE T    
Sbjct: 1062 PATEDEKKEQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVE 1121

Query: 1125 NDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAAD 1184
             D AKKEE L+  VK+I++R+AKA S+T+AGY+W AD R+FN +VGPGGSNIKKIR+AAD
Sbjct: 1122 IDEAKKEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAAD 1181

Query: 1185 VIINVPRKSDKVNDVV 1200
            VIINVPR+SDKVNDV+
Sbjct: 1182 VIINVPRRSDKVNDVI 1197

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 720  PVKFHGSLIGPHGTYRNRLQEKYNVFINFPRD----NEIVTIRGPSRGVNKA 767
            P KF+  ++GP G+   ++++  +V IN PR     N+++ +RG   GV KA
Sbjct: 1159 PRKFN-KVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVRGTKEGVEKA 1209

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score = 1292 bits (3343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1164 (56%), Positives = 860/1164 (73%), Gaps = 19/1164 (1%)

Query: 40   EEHPQLEKKPTPLPSLKDLPSL-GSNAAFANVKVSWGPNMKXXXXXXXXXXXXXXXLTTG 98
            EE P+ E  P PLPSLKDLPSL  SN+     KV WGPNMK                 + 
Sbjct: 40   EEAPKPE--PKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRS-ASA 96

Query: 99   LGAKRMRSKNIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSG 158
              A RMRS NIQE FTLDLQSQLS+TK ELSRI+Q+VK+ ++VSVESTLS+N+RTFL+SG
Sbjct: 97   TSAGRMRSNNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISG 156

Query: 159  VAANVHEAKRELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVN 218
             A  V EAKREL+K LT+PI   IEVPS+CKA IIGSGG+ IREISD Y+VKI++SKE  
Sbjct: 157  PAPKVKEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPK 216

Query: 219  ENSYDEDMDDTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVS 278
             +SY+ED+DD  S++S+FGDFESV  AKAKIL+IV E+ KN T +L VED     +++V 
Sbjct: 217  PDSYNEDLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVK 276

Query: 279  EFASDEGDEEVKVQFYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKF 338
            E +SD+    VKVQ+Y+ +G   I G  +  K  KT I+DYL+KL++ L EE VKIPSKF
Sbjct: 277  EVSSDD----VKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKF 332

Query: 339  QFLIDAEELKEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISK 398
            QFLIDA+E+K+++ VIV FP +  DE V F GL+DKV EAI++AR+SSK Y+V+SLDISK
Sbjct: 333  QFLIDADEVKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISK 392

Query: 399  AHSKNLTHAKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEAN 458
            AH+KNL HAK L++YF KY+VL  + E  P+VK  LPSI+ L  A+ V I++SAK+D+ +
Sbjct: 393  AHNKNLDHAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTS 452

Query: 459  DIKAVRKELISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDN 518
            +IKA R+E+I+ VN+I P+ETLVI DLDYELF  +IKH LL  ES   F+Q GDY+  D+
Sbjct: 453  EIKAARREIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDD 512

Query: 519  SILLVALTEDEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPS 578
            S++L A + DEDFKPS +EI+ SL K N +LN LR KQN++E  TY+   E QD  F   
Sbjct: 513  SVVLFATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKD 572

Query: 579  SATWKLIMEDISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMT 638
            S   KLI+EDIS  +GH+QIKLH+PE+N++T+RGDE+A K ANK  +SI+ +PS+ +K+T
Sbjct: 573  SVALKLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKIT 632

Query: 639  VNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHA 698
            V +P  SV+RLIGNKG+NLQ++R K+ C IDIP +    + +DKTVE+T+ GL++ + HA
Sbjct: 633  VEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQ--GESDQDKTVEITIKGLQFIIEHA 690

Query: 699  KKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIR 758
            KK +A EAK+ ADI+TKEL+   K+H +L GP G YR RLQEKYNVFINF ++N  +TI+
Sbjct: 691  KKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIK 750

Query: 759  GPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRXXXXXXXXXXXXRAEYGVEMDF 818
            GPSRGVNKA++ELKALLDFEMENGHK ++NVP EH+ R              E+GVE+DF
Sbjct: 751  GPSRGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDF 810

Query: 819  LQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVG 878
            LQKS DPKA ETG VELEITG+R  IK+A+ ++ +IV+EA+D VTE L ID KYHK+IVG
Sbjct: 811  LQKSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVG 870

Query: 879  SGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFXXXXXXXXXXXXXDAEN 938
            +GGH LREIIS AGG+E+R ++VDIPNADSE+  IT+QGP+KF             +++N
Sbjct: 871  AGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQN 930

Query: 939  SVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAE 998
            S+TK I++P ER GALIGPGGIVR+QLESEFNI L+VP +D+   ++++TG PEN+EKAE
Sbjct: 931  SITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKAE 990

Query: 999  KKILNEIIRENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAP 1058
            KKI  EIIR+NFD E+ VPA++  YVS+RG   Q+LR++  VNVR+GN +KKAN L R P
Sbjct: 991  KKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNRTP 1050

Query: 1059 IEIPLEKVCGSTEGENAEKTKFTIEEVGAPTSSE--EGDITMRLTYEPIDLSSILSDGEE 1116
            ++IP EKV G+ EG   EK KFT+EE G P+  E  +G+I  RL YEPID  SIL   EE
Sbjct: 1051 VDIPYEKVAGA-EG---EKVKFTVEETG-PSVVENVDGEIPWRLIYEPIDFDSILD--EE 1103

Query: 1117 KEVTKDTSNDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNI 1176
                K+ S D  KK++ L  A ++I+ RI  AP+ATY+GYVW +D  +F  +VG GGSN+
Sbjct: 1104 NGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNV 1163

Query: 1177 KKIREAADVIINVPRKSDKVNDVV 1200
            KKIRE+ + I+ VP+KSDK+N+V+
Sbjct: 1164 KKIRESTNCIVYVPKKSDKINNVI 1187

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 954  LIGPGGIVRRQLESEFNINLFVPNKDDP-SGKITITGAPENVEKAEKKILNEI 1005
            ++G GG   +++    N  ++VP K D  +  I I GA ENVEKA + I+  +
Sbjct: 1155 VVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKGAKENVEKAGEAIIKSL 1207

>Kwal_14.2397
          Length = 1206

 Score = 1175 bits (3040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1171 (52%), Positives = 814/1171 (69%), Gaps = 33/1171 (2%)

Query: 41   EHPQLEKKPTPLPSLKDLPSLGSNAAFANV-KVSWGPNMKXXXXXXXXXXX-------XX 92
            E P  E+ P PLPS KD P+LGS A  A   KVSWGPNMK                    
Sbjct: 36   EAPVPEQAPKPLPSKKDFPTLGSGAFLAAASKVSWGPNMKTQTASSASGASSTSNSAVQS 95

Query: 93   XXLTTGLGAKRMRSKNIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNAR 152
               T  L AK  RSK IQEAF+LDLQSQ+S++KP+ SRI+Q +K  H VSVESTLSK++R
Sbjct: 96   RSTTPALSAKPARSKTIQEAFSLDLQSQISMSKPDFSRIIQGIKTTHSVSVESTLSKSSR 155

Query: 153  TFLVSGVAANVHEAKRELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKIN 212
            TFL+ G   +V  A+RE+VKKLTKP+   IEVPSK +++IIG+GG+ IREIS+  EV+I+
Sbjct: 156  TFLIFGKPQDVKAARREIVKKLTKPVTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRID 215

Query: 213  VSKEVNENSYDEDMDDTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYL 272
            + KE+ E++YDED+DD+  +VS+ GD ESV +A+ KI AIVKE+TKNA+I++ VED+  +
Sbjct: 216  IGKEIKEDTYDEDLDDSMVDVSIHGDLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLV 275

Query: 273  PYIDVSEFASDEGDE-EVKVQFYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEK 331
            P+I++      EG +  V  +F   SG I + G R++ +A K +I  YL++L+S +   K
Sbjct: 276  PFINL------EGLKLPVDAKFNTASGQIQLSGLRDEVQAAKANILQYLRELSSQIKTLK 329

Query: 332  VKIPSKFQFLIDAEELKEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVV 391
            VKIP KFQFLID  E+KEK+NV V  P+   +E VSFVG    + EA+++AR +SK Y+V
Sbjct: 330  VKIPVKFQFLIDESEIKEKFNVTVHLPTAGGEE-VSFVGPAVHLDEAVSFARENSKKYIV 388

Query: 392  ESLDISKAHSKNLTHAKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHIS 451
            ESL+ISKAH KN+ HAKN+ +YF  Y+VL+ ++++ PNV+ ++PS Q L  A+ V I IS
Sbjct: 389  ESLEISKAHGKNVAHAKNIAIYFEIYNVLEPIKKAFPNVRFAIPSPQELQDADAVAIRIS 448

Query: 452  AKSDEANDIKAVRKELISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFG 511
              S+ A+D+K VRK++I+ VN +P S+ LV+ DLDYEL+   IKH LL  + +  FVQ G
Sbjct: 449  TTSENADDLKTVRKDIINLVNELPTSQVLVVEDLDYELYSKDIKHLLLQQQQNADFVQLG 508

Query: 512  DYYPNDNSILLVALTEDEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQ 571
            D++P ++ ILL A   DEDF+PS +E++ +L   N +L  LR KQ+N+  K +E   E Q
Sbjct: 509  DFFPGNDKILLFARLSDEDFRPSDDELKQTLADVNSALEPLRAKQSNLSLKIFEIPSEKQ 568

Query: 572  DSLFKPSSATWKLIMEDISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSP 631
            D+ FKPS+ T +LI +DI+ + GH Q KLH P  +QLT+RGD KA K A    ESI+ + 
Sbjct: 569  DAFFKPSTFTRELIEQDIATEGGHAQFKLHAPTADQLTIRGDTKAVKVATAAIESIVANS 628

Query: 632  SSKSKMTVNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGL 691
              K +    + +NSV RLIG+KG+NL  IREK+ C ID+  E + N +     EVT+TGL
Sbjct: 629  GEKFETKFAVSSNSVPRLIGSKGANLNAIREKYQCNIDVAQESSGNQT-----EVTVTGL 683

Query: 692  EYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRD 751
            +Y++ HAK YL +E+KKWAD+ITKEL V  K+ G LIG  GTYRNRLQ KY+V I+FP +
Sbjct: 684  KYSVEHAKAYLLSESKKWADVITKELNVLPKYRGRLIGSQGTYRNRLQTKYSVHIHFPME 743

Query: 752  --NEIVTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRXXXXXXXXXXXXR 809
              NE VTIRGPSRGV KA++ELKALLDFE+ENGH  +I VP EHVPR            R
Sbjct: 744  GENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSIITVPTEHVPRIIGKNGDNINDIR 803

Query: 810  AEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKID 869
            A+ GVE+DFLQK+TDPKA ETG+VELEITGSRQ IK+A ++VE+IV EASD  TE  +++
Sbjct: 804  ADCGVELDFLQKTTDPKAVETGKVELEITGSRQAIKEATQKVEAIVKEASDVETESFEVN 863

Query: 870  HKYHKSIVGSGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFXXXXXXXX 929
             KY + IVG+GG +L+ +ISKAGG+EIRNKSVDIP+A+S++K IT+QGP  F        
Sbjct: 864  PKYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVKEI 923

Query: 930  XXXXXDAENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITG 989
                 + E+SV K +D+PA+R GALIGPGG+VRRQLESEFNI L +P+  D S K+ I G
Sbjct: 924  KLIIKEREDSVEKELDVPADRVGALIGPGGMVRRQLESEFNIKLSLPDIGDKSSKVKILG 983

Query: 990  APENVEKAEKKILNEIIRENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSK 1049
             P+N+   EKKI  ++IR++ D EV VPAS++E+VSE+GA IQ+LR D  VNVRFGN++ 
Sbjct: 984  LPDNIAACEKKIFTQLIRDSCDAEVQVPASLHEFVSEKGALIQRLRSDYFVNVRFGNSNG 1043

Query: 1050 KANKLARAPIEIPLEKVCGSTEGENAEKTKFTIEEVGAPTSSEEGDITMRLTYEPIDLSS 1109
            KANKLAR+ + IP+EK  G+ E    E  KFT EE+       +G I  RL+YEP+DLS 
Sbjct: 1044 KANKLARSNLNIPVEKATGTAE----ESIKFTTEEIPLAIEESQGFIPWRLSYEPVDLSD 1099

Query: 1110 ILSDGEEKEVTKDTSNDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIV 1169
            IL++ EEK   K+      KKEE L+T  KLIK+RI  A  A+  GY+W + +  F  +V
Sbjct: 1100 ILTE-EEKANEKE-----PKKEEVLETVEKLIKDRIELATKASTVGYLWSSKSSEFRKVV 1153

Query: 1170 GPGGSNIKKIREAADVIINVPRKSDKVNDVV 1200
            G  GSNIKKIREA   +INVP+K+DKV+D++
Sbjct: 1154 GSMGSNIKKIREATGTLINVPKKNDKVSDII 1184

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%)

Query: 727  LIGPHGTYRNRLQEKYNVFINFPRDN----EIVTIRGPSRGVNKAHE 769
            ++G  G+   +++E     IN P+ N    +I+ IRG   GV KA E
Sbjct: 1152 VVGSMGSNIKKIREATGTLINVPKKNDKVSDIIYIRGTKEGVQKASE 1198

>AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH]
            complement(27774..31370) [3597 bp, 1198 aa]
          Length = 1198

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/1154 (53%), Positives = 812/1154 (70%), Gaps = 29/1154 (2%)

Query: 49   PTPLPSLKDLPSLGSNAAFANVKVSWGPNMKXXXXXXXXXXXXXXXLTTGLGAKRMRSKN 108
            P  +P+  D P L S+  F   KV WGPNMK               + +G  AK MRSK 
Sbjct: 50   PKRMPTRADFPPL-SSVIFETQKVQWGPNMKKPESQSASPSPSPGPVGSG--AKPMRSKT 106

Query: 109  IQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAKR 168
            +QEAF+LDLQ+Q++I+K E S+ V SVK++H VS+ESTLSK +RTFL++G   NV+ AKR
Sbjct: 107  MQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKR 166

Query: 169  ELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYE-VKINVSKEVNENSYDEDMD 227
            ELVKKLT+P+  VI+VPSK  +SIIG GGR IREI++A   +KI+++K    ++YD D+D
Sbjct: 167  ELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEADAYDADLD 226

Query: 228  DTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDE 287
            D   N+SL GD  SVN AK KIL+IVKEETKNATI + VE+++ +P+I +++    E  E
Sbjct: 227  DQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADV---EISE 283

Query: 288  EVKVQ-FYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEE 346
            +V V+ F   S  IV++GPR++AK  K ++Q+YL  LAS + E+K+ IP KFQ LIDAE+
Sbjct: 284  DVTVKAFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAED 343

Query: 347  LKEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTH 406
            ++EKY V V FP+   D+ VSF GL   + +AI YAR SSK Y+VESL++SKAH KN+ H
Sbjct: 344  VREKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAH 403

Query: 407  AKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKE 466
            AKNL+ YF KY +LK ++ES   VK+ LP+ + LP  + V+I+I +K+D A   K VRK+
Sbjct: 404  AKNLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQ 463

Query: 467  LISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALT 526
            +I+ VN + PS  L + DLDYELF   IK  L  S++ + FVQ GD+Y  DN++LL A  
Sbjct: 464  IINIVNRLTPSHVLAVDDLDYELFHKDIKQAL--SKAEIPFVQLGDHYEGDNTVLLFAKV 521

Query: 527  EDEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIM 586
            ++EDF+PS EE++  L K    L+ +RTKQ+ + TK   F  E Q   F   S TW L++
Sbjct: 522  DEEDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVL 581

Query: 587  EDISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSV 646
            E+I+   GH QIKLHTP E+++T+RGDEKA KAA K FESI  +PS KSK+TV++PAN+V
Sbjct: 582  ENITSAGGHAQIKLHTPSEDEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVSVPANTV 641

Query: 647  ARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEA 706
            +RLIG KG+NL QIR+KF  QID+P+E N     D   E+TLTGLEYNL HAK ++A+EA
Sbjct: 642  SRLIGPKGTNLAQIRQKFDVQIDVPSESN-----DTNTEITLTGLEYNLQHAKTHIASEA 696

Query: 707  KKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNK 766
            KKWADI TKELIVP K+HGSLIG  GTYR RL+ KY+V I FP++ E+VTI+GPSRGVNK
Sbjct: 697  KKWADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNK 756

Query: 767  AHEELKALLDFEMENGHKMVINVPAEHVPRXXXXXXXXXXXXRAEYGVEMDFLQKSTDPK 826
            AH ELKALLDFE+ENGHK VINVP EHVPR            RAE GVE+  LQ +   K
Sbjct: 757  AHAELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAK 816

Query: 827  AQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILRE 886
             Q    V+LEITGSRQ IK+A+K V++I+AEASDF T+ L+ID KYHK IVG GG  L++
Sbjct: 817  EQNLDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKD 876

Query: 887  IISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFXXXXXXXXXXXXXDAENSVTKTIDI 946
             ISKAGG++IRNK+VD+PNA+S NK IT+ GP+ F             D + SV K ++I
Sbjct: 877  FISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNI 936

Query: 947  PAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEII 1006
            PA+R+GALIGPGG VRRQLES+FN+ + VP+K    GK+TI G PE VEK EK+I + II
Sbjct: 937  PADRQGALIGPGGSVRRQLESQFNVRIEVPDKGK-EGKVTIHGRPEAVEKCEKEIFSTII 995

Query: 1007 RENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKV 1066
            R+++D+E+ VPA  + +VSERG  I KLRM   +NV+ GN+SKKANKL+R+   IP+E+V
Sbjct: 996  RDSYDQEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERV 1055

Query: 1067 CGSTEGENAEKTKFTIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSND 1126
             GS EGE    TK TIEEV AP +S   +I  RLTYE +DLS IL  GEE          
Sbjct: 1056 RGS-EGEG---TKLTIEEVSAPEASANDNIPWRLTYEHVDLSDIL--GEE-------GKH 1102

Query: 1127 SAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAADVI 1186
            +  KE+AL+ A   IKERI  AP A   GY+W  + ++FN +VGPGGSNIK+IRE  + +
Sbjct: 1103 AMTKEQALEAAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTL 1162

Query: 1187 INVPRKSDKVNDVV 1200
            INVP+KSDKV+D++
Sbjct: 1163 INVPKKSDKVSDII 1176

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 721  VKFHGSLIGPHGTYRNRLQEKYNVFINFPRD----NEIVTIRGPSRGVNKA 767
            VK    ++GP G+   +++E  N  IN P+     ++I+ +RG    V KA
Sbjct: 1138 VKKFNKVVGPGGSNIKQIRETTNTLINVPKKSDKVSDIIYVRGTKESVEKA 1188

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1103 (49%), Positives = 745/1103 (67%), Gaps = 25/1103 (2%)

Query: 101  AKRMRSKNIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVA 160
            AK +RS+NIQE F+LDL +Q  ITK E S IVQSVK+ +DVSVESTLSK +RTFL+SG +
Sbjct: 104  AKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSS 163

Query: 161  ANVHEAKRELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNEN 220
              +  AKRELVKKLTKP+N   EVPSK +++IIGSGG+TIR ISDA  VKI V KEV+E 
Sbjct: 164  DKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEG 223

Query: 221  SYDEDMDDTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEF 280
            +YD D++D +  +SL GD ESV +AK+KIL +VKEETKNA I L VED K +P+ID+   
Sbjct: 224  TYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLE-- 281

Query: 281  ASDEGDEEVKVQFYKKS--GDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKF 338
             S E   +VK Q +  +   +I + GPR+  K  K  + +YL +L   +  +K K+P KF
Sbjct: 282  -SVEIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKF 340

Query: 339  QFLIDAEELKEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISK 398
              L+   EL EK++V V  PS   D+   F+G  D V EAI YA++SSK + VESL+ISK
Sbjct: 341  HPLVKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISK 400

Query: 399  AHSKNLTHAKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEAN 458
            AH KN+ HAKNLI+YF KY+VL  + E  P V++ LP ++S+P  E+V+I + + +D A+
Sbjct: 401  AHGKNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAAD 460

Query: 459  DIKAVRKELISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDN 518
             IK VRK++++ VN + P +TL I+DLDY LF   IK  L+++ES V F+Q GD +P ++
Sbjct: 461  AIKTVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGND 520

Query: 519  SILLVALTEDEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPS 578
             ILL+    ++DFKPS +E++  L   N+ L  +R KQ+ + +     +++ QD L   S
Sbjct: 521  DILLITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGES 580

Query: 579  SATWKLIMEDISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMT 638
              T  LI E +S    H  IKL TP  NQ+T+RGD+   K A+   +SI+ + S++SK+T
Sbjct: 581  KVTLNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKIT 640

Query: 639  VNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHA 698
              +P N V+RLIG KG+NLQQIREKF  Q  IP +     SKD+  +VTLTGL+YNL  A
Sbjct: 641  FQVPTNVVSRLIGPKGANLQQIREKFDVQTFIPQD-----SKDENTDVTLTGLQYNLDQA 695

Query: 699  KKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIR 758
            K Y+ AEAKKW+DIITKELIVP+K+H +L GP GTYR RL+ KY+VFI FP+D+E+VTIR
Sbjct: 696  KTYILAEAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIR 755

Query: 759  GPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRXXXXXXXXXXXXRAEYGVEMDF 818
            GPSRGV  A++ELKALLDFE+ENGHK ++ VP ++V R            +AEYGVE++F
Sbjct: 756  GPSRGVKAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNF 815

Query: 819  LQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLK-IDHKYHKSIV 877
            L K+   KA+E GEVELEITGSR +IK+AA +V+SI+ +AS+F T  L+ ID KY+  I+
Sbjct: 816  LDKTDSEKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDII 875

Query: 878  GSGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFXXXXXXXXXXXXXDAE 937
            G  G  L+EIISKAGG+EIRNK V+IP+A SE+K IT+ GP  F               E
Sbjct: 876  GRSGSQLKEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFVKKVVKQIKGVVSGLE 935

Query: 938  NSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKA 997
            NS+T+ ++IP E+ GALIGP G VRR+LE+EF + + VPNK+    K+T++G+P N+E  
Sbjct: 936  NSITEELNIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANIESC 995

Query: 998  EKKILNEIIRENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARA 1057
            +KKI  EIIR++FD E+ VPA  + YVS  G   Q LR + S++V  GN ++ A  L+RA
Sbjct: 996  KKKIEKEIIRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRA 1055

Query: 1058 PIEIPLEKVCGSTEGENAEKTKFTIEEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEK 1117
              ++P E V G   GEN E +   I+ V   T ++   I  RLTY PIDLS +L +    
Sbjct: 1056 NYKVP-ENVAG---GEN-ESSNVLIQSV-TETEAKVDTIPWRLTYSPIDLSDVLGE---- 1105

Query: 1118 EVTKDTSNDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIK 1177
                D   D   K++ L+ A KLI++RIA+A      G+VW  D ++FN IVGP G NI+
Sbjct: 1106 ----DYKKDEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIR 1161

Query: 1178 KIREAADVIINVPRKSDKVNDVV 1200
            +IR A   +I+VPRKSDKVN+V+
Sbjct: 1162 EIRNATKTVIHVPRKSDKVNNVI 1184

>Kwal_27.12486
          Length = 299

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 67/140 (47%), Gaps = 22/140 (15%)

Query: 641 IPANS-VARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVT------------ 687
           I +NS V+ +IG +GS ++ + EK   ++ + ++     S+D+ VE+             
Sbjct: 119 IVSNSQVSSIIGTQGSRIKALIEKHGVKV-VASKNFLPDSQDRVVEIQGFPGSIASCIIE 177

Query: 688 ---LTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQE--KY 742
              L   E   +H K+Y      +    +TKE+ +PV+F G+L+G  G   + L++  K 
Sbjct: 178 ISELLATETKPSHEKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGGNRVSSLRKYTKT 237

Query: 743 NVFIN---FPRDNEIVTIRG 759
            V ++      +N + TI G
Sbjct: 238 KVIVSDEPNEENNRVFTITG 257

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 67/149 (44%), Gaps = 25/149 (16%)

Query: 875  SIVGSGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQG-PQKFXXXXXXXXXXXX 933
            SI+G+ G  ++ +I K G + + +K+  +P  DS+++ + +QG P               
Sbjct: 127  SIIGTQGSRIKALIEKHGVKVVASKNF-LP--DSQDRVVEIQGFPGSIASCIIEISELLA 183

Query: 934  XDA----------------ENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFV-- 975
             +                 E SVTK + IP E  GAL+G GG     L       + V  
Sbjct: 184  TETKPSHEKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGGNRVSSLRKYTKTKVIVSD 243

Query: 976  -PNKDDPSGKITITGAPEN-VEKAEKKIL 1002
             PN+++ +   TITG  +N V+ AE  +L
Sbjct: 244  EPNEEN-NRVFTITGNNQNSVKLAETMLL 271

>Scas_515.6
          Length = 342

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 713 ITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINF--PRDNE---IVTIRGPSRGVNKA 767
           ITK +  P K+   +IG  GTY N L+E  +  I    P D E   I++IRGP   V+ A
Sbjct: 266 ITKVVTYPDKYSSKVIGREGTYINMLRESTSCSIRLKSPDDKEDLAIISIRGPPLCVDAA 325

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 24/151 (15%)

Query: 110 QEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSV---ESTLSKNARTFLVSGVAANVHEA 166
             A  LD  ++L I   + S  ++ ++   DV +   +       R   V G+A NV + 
Sbjct: 25  MRALMLDETTKLIIG--DGSETIRQLRAESDVKIWFSKQVYGNEHRILFVKGLAENVAQT 82

Query: 167 KRELVKKL---TKP----INAV-IEV----PSKCKASIIGSGGRTIREISDAYEVKINVS 214
              + + L   T P    INAV +E+    P+     IIG GG  ++EI+ A       S
Sbjct: 83  FGSIARILAMATSPNAVDINAVHVEIKFLFPNPVVGRIIGKGGLNVKEITKA-------S 135

Query: 215 KEVNENSYDEDMDDTTSNVSLFGDFESVNLA 245
             + + SY      T   VS++G   S+++A
Sbjct: 136 AAIVKKSYHFLEGSTDRLVSIYGVPNSIHIA 166

>KLLA0B03542g complement(321676..323649) similar to sp|P32349
            Saccharomyces cerevisiae YPR190c RPC82 DNA-directed RNA
            polymerase III, 82 KD subunit singleton, start by
            similarity
          Length = 657

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 85/198 (42%), Gaps = 29/198 (14%)

Query: 1019 SIYEYVSERGAFIQKLRMDLSVN-VRFGNTSKKA-----------NKLARAPIEIPLEKV 1066
            ++Y Y +E G F+     D+S   V++ N  ++            N LA   + +   K 
Sbjct: 121  TLYYYFNEEGLFLMLYAGDISDRIVQYFNQDEEQHLVNIAQQIIHNVLALGSLTV---KD 177

Query: 1067 CGSTEGENAEKTKFTIEEVGAPTSSEEGDITMR-LTYEPI-DLSSILSDGEEKEVTKDTS 1124
              ++E  + +   F I +     +  E  + ++ + Y PI DL ++L   E K++ K+T+
Sbjct: 178  YLASESNSNDTDIFNIHQAFVRLADLEFLVPLQGIHYTPIVDLWNMLYLREYKKLPKNTT 237

Query: 1125 NDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAAD 1184
                KK        KL   RI  +PS    G ++  D+          G+  KK+ E+  
Sbjct: 238  QSDLKKRNEAKAKAKLEFNRIVSSPSQDSNGKIFLTDS----------GTGFKKVNESVS 287

Query: 1185 VIINVPR--KSDKVNDVV 1200
            +  N+ R  KS + N +V
Sbjct: 288  LTFNLERYLKSRRSNQLV 305

>KLLA0E00847g complement(87991..90132) some similarities with
           sgd|S0003955 Saccharomyces cerevisiae YLL032c,
           hypothetical start
          Length = 713

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 55/139 (39%), Gaps = 25/139 (17%)

Query: 651 GNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWA 710
           G K   L +I ++  C I + N+ + +      + V L G ++        L  +     
Sbjct: 395 GKKNGKLMKIMDRKKCAISLENDSSGH------MLVILQGEDWQQIQDSFSLLLQELP-- 446

Query: 711 DIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEI------------VTIR 758
               K   +P  +H  +IG  G+    +  KYNVFI F    ++            V IR
Sbjct: 447 --CEKSFFIPEAYHRPVIGTGGSVIQTIMRKYNVFIQFSNSFQLPQGDWTFTRYDNVIIR 504

Query: 759 GPSR---GVNKAHEELKAL 774
            PS+    +  A E+L +L
Sbjct: 505 CPSKNTINIEAAKEQLLSL 523

>CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces
           cerevisiae YLL032c, hypothetical start
          Length = 778

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 56/142 (39%), Gaps = 28/142 (19%)

Query: 651 GNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWA 710
           G K   L +I EK   Q+D+  EE++       +   +  LE   T     L  E     
Sbjct: 399 GKKNGKLTRIMEKSQAQLDLNFEEDDKNMFLSIISNKVNNLESAFTLLLDELPCEGT--- 455

Query: 711 DIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINF------PR--------DNEIVT 756
                   +P  +H   IG  G+       K+NVFI F      P+        DN  V 
Sbjct: 456 ------FFIPEVYHRPAIGSGGSIIQTTMRKHNVFIQFSNTFLLPQSGLSFVRFDN--VI 507

Query: 757 IRGP---SRGVNKAHEELKALL 775
           IR P    +G++ A E+LK L+
Sbjct: 508 IRCPFKNRKGIDLAIEDLKVLI 529

>Kwal_55.20652
          Length = 694

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 87/232 (37%), Gaps = 36/232 (15%)

Query: 651 GNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWA 710
           G K   + +I +   C + +  +E+ +      + +TLT   +   +A   L  E    A
Sbjct: 391 GKKNGKISRITDNAKCVLSLEFQEDQS-----NMLITLTSNSFAAANAGINLLGEELP-A 444

Query: 711 DIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFP-------------RDNEIVTI 757
           +I      +P  +H  +IG  G+    +  ++NVFI F              R N +V I
Sbjct: 445 EI---SFFIPEAYHRPVIGTGGSVIQTIMRRFNVFIQFSNTFQLPQNDFGLTRHNNVV-I 500

Query: 758 RGPS---RGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRXXXXXXXXXXXXRAEY-- 812
           R PS   + +++A +EL  L++       K  +                      AE   
Sbjct: 501 RCPSKNRKSISQAKKELMRLVNEYSNQQPKTCLRFSPGQYRFYFQDCNHFKHNLIAELEK 560

Query: 813 --GVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFV 862
             GV + F      P      E  LEI GS QN K+AA  +    A   + V
Sbjct: 561 KTGVYIKF------PTELPKKEWSLEIRGSEQNSKNAASEMAKTFASEREIV 606

>Sklu_1732.2 YLR146C, Contig c1732 733-1629 reverse complement
          Length = 298

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 317 QDYLKKLASNLDEEKVKI--PSKFQFLIDAEELKEKYNVIVTFPSTPDDELVSF 368
           ++YL  +A   +  KVK+     FQ+L DA   +EKY++I+T  S P+    +F
Sbjct: 128 KEYLPGMACAFNHPKVKVELCDGFQYLKDAALQEEKYDIIITDSSDPEGPAEAF 181

>YLL032C (YLL032C) [3388] chr12 complement(74269..76746) Protein
           containing a KH domain, which may bind RNA [2478 bp, 825
           aa]
          Length = 825

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 79/197 (40%), Gaps = 29/197 (14%)

Query: 569 EVQDSLFKPSSATWKLIMEDISEQEGHLQIKLHTPEE---NQLTVRGDEKAAKAANKIFE 625
           EVQ SL +  + + +LI++      G+ QI + TP+E   NQL V G++ +   A+    
Sbjct: 334 EVQISLNENCAMSPELIIDSFFGHTGN-QIVVITPKEDSFNQLIVVGNQSSTDEASD--T 390

Query: 626 SILNSPSS---KSKMTVNIPANSVARLI-----------GNKGSNLQQIREKFACQIDIP 671
           SIL+  S     S   +N     +  +            G K   L +I E  AC I + 
Sbjct: 391 SILHYLSDFIMGSNQVINPNLRQIKAIFEIHPDFEDFISGKKNGKLTRIMELSACLIQLE 450

Query: 672 NEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPH 731
            EE ++      V  +    + +  +      AE         +   +P   H  +IG  
Sbjct: 451 MEEEDDNLYLNLVSDSFPDFKESFKNVINEFPAE---------ESFFIPEVCHRPIIGTG 501

Query: 732 GTYRNRLQEKYNVFINF 748
           G+       K+NVFI F
Sbjct: 502 GSLIQATMRKHNVFIQF 518

>KLLA0D17094g complement(1449542..1450432) similar to sp|Q12455
           Saccharomyces cerevisiae YLR146c SPE4 spermine synthase,
           start by similarity
          Length = 296

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 319 YLKKLASNLDEEKV--KIPSKFQFLIDAEELKEKYNVIVTFPSTPD 362
           YL  +A +    KV  K+   FQFL D  E   KY+VI+T  S P+
Sbjct: 129 YLPNMACSFKHPKVNVKLCDGFQFLRDVAESGTKYDVIITDSSDPE 174

>Scas_543.6
          Length = 812

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 723 FHGSLIGPHGTYRNRLQEKYNVFINFP----RDNEIVTIRGPSRGVNKAHEEL-KALLDF 777
           + GS+IG        L++ +NV+I FP     DN ++TI+G     +KA  +L  +   F
Sbjct: 587 YGGSIIG-------TLEKAHNVYIMFPLSVPTDNFVLTIKGMEENPSKAATDLINSYFGF 639

Query: 778 EME 780
           EME
Sbjct: 640 EME 642

>AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH]
           (982057..983007) [951 bp, 316 aa]
          Length = 316

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 638 TVNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTG 690
           TV IPA  V  L+G+ G+ +  +R+    +I +  E N N  +    E T+TG
Sbjct: 240 TVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEPNQNNER----EFTITG 288

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 178 INAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFG 237
           + A + +P++   +++G GG  I  +      KI V++E N+N+  E         ++ G
Sbjct: 237 VTATVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQEPNQNNERE--------FTITG 288

Query: 238 -DFESVNLAKAKIL 250
            D +SV LA+  I+
Sbjct: 289 NDQKSVKLAQNMIM 302

>KLLA0E09350g complement(832187..834076) similar to sgd|S0005548
           Saccharomyces cerevisiae YOR022c, hypothetical start
          Length = 629

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 58/148 (39%), Gaps = 22/148 (14%)

Query: 538 IQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIM--EDISE---- 591
           +   L KA E L+     ++  ++KT     E++D    P  + WK +M  ED       
Sbjct: 109 LSHDLTKAIEELHQQWLSRDKEKSKT----TELRDIFRLPKDSKWKYVMFFEDDRTAFLL 164

Query: 592 ---QEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVAR 648
                GHLQ+ +      QL   G  K  K   +        PSS ++    I    +  
Sbjct: 165 PDIYGGHLQLTILRSSVAQLIQLGASKLTKGYEE--------PSSLTERAKEIEGQVIEH 216

Query: 649 LIGNKGSNLQQIREKFACQIDIPNEENN 676
            +G  G     I  +F+  +  PNEENN
Sbjct: 217 AMG-LGKISDMISWEFSDLVKFPNEENN 243

>AFR186W [3378] [Homologous to ScYLL032C - SH]
           complement(775246..777399) [2154 bp, 717 aa]
          Length = 717

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 15/75 (20%)

Query: 715 KELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEI------------VTIRGPS- 761
           +   +P  +H  +IG  G+    +  K+NVFI F    ++            V IR PS 
Sbjct: 447 RSFFIPEAYHRPVIGTGGSVIQTIMRKHNVFIQFSNSFQLPQNKLAHIRYDNVVIRCPSK 506

Query: 762 -RG-VNKAHEELKAL 774
            RG +  A EEL  L
Sbjct: 507 NRGEIIPAKEELNQL 521

>Scas_667.6
          Length = 378

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 179 NAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKE 216
           N  + VP++  +SIIG GG  I+ + + Y VKI  SK 
Sbjct: 158 NLRLIVPNRHLSSIIGKGGVRIKALIETYGVKIVASKH 195

>YGR273C (YGR273C) [2218] chr7 complement(1038719..1039243) Protein
           of unknown function, has moderate similarity to
           uncharacterized S. cerevisiae Ymr295p [525 bp, 174 aa]
          Length = 174

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 30/54 (55%)

Query: 649 LIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYL 702
           +I +K  NL+ +++ F   I  P+  N   ++++    T+ G EY++T   ++L
Sbjct: 64  VIYDKDGNLKSMKDTFGRNIKTPDISNPTRARNERPLDTIRGFEYSITKDPRWL 117

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.129    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 37,179,486
Number of extensions: 1653302
Number of successful extensions: 6166
Number of sequences better than 10.0: 123
Number of HSP's gapped: 6184
Number of HSP's successfully gapped: 138
Length of query: 1200
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1087
Effective length of database: 12,684,275
Effective search space: 13787806925
Effective search space used: 13787806925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)