Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJL079C (PRY1)2991307052e-92
Scas_675.272901315626e-71
KLLA0D02442g3681305662e-70
YKR013W (PRY2)3291305534e-69
CAGL0G07667g2581305397e-68
Kwal_14.24103731305226e-64
Sklu_956.13191175117e-63
Scas_711.372671314991e-61
YJL078C (PRY3)8811305312e-61
AAL179W3601314572e-54
CAGL0F05137g2271334262e-51
Kwal_14.24092381304171e-49
AAL178W2051303964e-47
KLLA0D02420g2121303861e-45
KLLA0C01496g4561352798e-28
AFR700W4341392453e-23
Kwal_33.131927991402305e-21
KLLA0E03531g40758643.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL079C
         (295 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   276   2e-92
Scas_675.27                                                           221   6e-71
KLLA0D02442g complement(207613..208719) some similarities with s...   222   2e-70
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   217   4e-69
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   212   7e-68
Kwal_14.2410                                                          205   6e-64
Sklu_956.1 YJL079C, Contig c956 998-1957                              201   7e-63
Scas_711.37                                                           196   1e-61
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   209   2e-61
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   180   2e-54
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   168   2e-51
Kwal_14.2409                                                          165   1e-49
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   157   4e-47
KLLA0D02420g complement(206544..207182) some similarities with s...   153   1e-45
KLLA0C01496g complement(113533..114903) some similarities with s...   112   8e-28
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...    99   3e-23
Kwal_33.13192                                                          93   5e-21
KLLA0E03531g 327965..329188 similar to sgd|S0002873 Saccharomyce...    29   3.7  

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  276 bits (705), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 286 NYEGEYADNV 295
           NYEGEYADNV
Sbjct: 286 NYEGEYADNV 295

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 26/74 (35%)

Query: 28  EHAHEAAXXXXXXXXXXENGQTRTTYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 87
           EHAHEAA          ENGQTRTTYE                                 
Sbjct: 28  EHAHEAAVVTVQGVVYVENGQTRTTYETLAPASTATPTSTATALVAPPVAPSSASSNSDV 87

Query: 88  XXXXXKNLASVWGK 101
                KNLASVWGK
Sbjct: 88  VLSALKNLASVWGK 101

>Scas_675.27
          Length = 290

 Score =  221 bits (562), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 102/131 (77%), Positives = 113/131 (86%), Gaps = 1/131 (0%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           VL EHN KRALH++TPALSWSD LASYAQ+YAD YDCSG L HSGGPYGENLALGYD   
Sbjct: 156 VLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGYDAVG 215

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGA-WGDYVICSYDPA 284
           +VDAWYNEIS+YD+SNPGFS N GHFTQVVWKS+TQVGCGIK C    WG YVICSY+PA
Sbjct: 216 SVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICSYNPA 275

Query: 285 GNYEGEYADNV 295
           GN+ GE+A+NV
Sbjct: 276 GNFIGEFAENV 286

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  222 bits (566), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 101/130 (77%), Positives = 113/130 (86%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           +L EHN KRALHKDTP LSWSD LASYAQ+YAD+YDCSG+LTHSGGPYGENLA+GY    
Sbjct: 235 MLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGYGTTG 294

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           AVDAWY+EI +Y FSNP +SS+TGHFTQVVWKSTT+VGCGIK CGG WGDY+ICSYDPAG
Sbjct: 295 AVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSYDPAG 354

Query: 286 NYEGEYADNV 295
           N  G +A NV
Sbjct: 355 NMLGTFASNV 364

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  217 bits (553), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 113/130 (86%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           ++ EHN KRALHKDT +L+WSDTLA+YAQ+YAD+YDCSG L HSGGPYGENLALGY    
Sbjct: 196 MVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTG 255

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           +VDAWYNEI++YD+SNPGFS + GHFTQVVWK T++VGCG+K+CGG WGDY+ICSY  AG
Sbjct: 256 SVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAG 315

Query: 286 NYEGEYADNV 295
           N  GE+ADNV
Sbjct: 316 NVIGEFADNV 325

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  212 bits (539), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 93/130 (71%), Positives = 112/130 (86%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           +L EHN KRALH+DT  L+WSD LA YAQ+YA+NYDCSG L HSGGPYGENLA+GY    
Sbjct: 125 MLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGYSPVG 184

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           +VDAWY+EI +Y+++NPGFS +TGHFTQVVWKS+T+VGC +K+CGG WGDYVICSYDPAG
Sbjct: 185 SVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSYDPAG 244

Query: 286 NYEGEYADNV 295
           N+ GE+A NV
Sbjct: 245 NFLGEFAQNV 254

>Kwal_14.2410
          Length = 373

 Score =  205 bits (522), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 92/130 (70%), Positives = 109/130 (83%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           +L  HN KR+LHKDT  LSWSD LASYAQDYAD YDCSG+L+HSGGPYGENLA+GY    
Sbjct: 240 ILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVGYSTTG 299

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           +VDAWY EI +YD+SNP +SS+TGHFTQVVWK ++ +GCGIK+CGG  GDYVICSY  AG
Sbjct: 300 SVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVICSYKTAG 359

Query: 286 NYEGEYADNV 295
           N+ GE+A+NV
Sbjct: 360 NFLGEFAENV 369

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  201 bits (511), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 90/117 (76%), Positives = 104/117 (88%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           +L EHNKKRALHKDT AL+WS+TLA YAQ YAD+YDCSG+LTHSGGPYGENLALGY    
Sbjct: 176 ILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLALGYSATG 235

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYD 282
           AVDAWY EIS+YD+SNP +SS+TGHFTQVVWKST++VGCGIK+C  +WG YVICSY+
Sbjct: 236 AVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVICSYN 292

>Scas_711.37
          Length = 267

 Score =  196 bits (499), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 90/131 (68%), Positives = 106/131 (80%), Gaps = 1/131 (0%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADN-YDCSGTLTHSGGPYGENLALGYDGP 224
           +L EHNKKRALH++T  L+WS+ LA YAQ YADN Y+C G L HSGGPYGENLA GY   
Sbjct: 132 LLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAGYTLL 191

Query: 225 AAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPA 284
            +VDAWYNEIS YD+SNPGFS +TGHFTQ+VWK T+QVGC IK+C  AWG Y+ICSY+ A
Sbjct: 192 GSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICSYNSA 251

Query: 285 GNYEGEYADNV 295
           GN++GEY  NV
Sbjct: 252 GNFDGEYEANV 262

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  209 bits (531), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 92/130 (70%), Positives = 106/130 (81%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           VL EHNK RALH DT  L+WSDTLA+YAQ+YAD YDCSG LTHS GPYGENLALGY    
Sbjct: 29  VLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGYTDTG 88

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           AVDAWY EIS Y++SNPGFS +TGHFTQVVWKST ++GCG K CG  W +Y++CSY+P G
Sbjct: 89  AVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPG 148

Query: 286 NYEGEYADNV 295
           NY GE+A+ V
Sbjct: 149 NYLGEFAEEV 158

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  180 bits (457), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 77/131 (58%), Positives = 100/131 (76%), Gaps = 1/131 (0%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGP- 224
           +L  HN +R LHKDT  L+WS+ LA +A+D+A+ YDCSG L HS  PYGENLA+GY  P 
Sbjct: 226 ILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGYPTPE 285

Query: 225 AAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPA 284
            AV AWY+EIS+Y +S+P FS +TGHF+Q+VWK T  +GC +K CGG+ GDY+ICSYDPA
Sbjct: 286 KAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLICSYDPA 345

Query: 285 GNYEGEYADNV 295
           GN+   + +NV
Sbjct: 346 GNFLRRFGENV 356

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  168 bits (426), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 95/133 (71%), Gaps = 3/133 (2%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGG---PYGENLALGYD 222
           +L +HNKKR LHKDT +L W+D LA  AQ YAD YDCSG L H+       GENLA+GYD
Sbjct: 91  MLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLAVGYD 150

Query: 223 GPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYD 282
              A+DAWY+EI +YD+SNP     T HFTQ+VWK T  VGC  KTCGG   +Y++C YD
Sbjct: 151 DIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIVCEYD 210

Query: 283 PAGNYEGEYADNV 295
           PAGN+ GE+ADNV
Sbjct: 211 PAGNWAGEFADNV 223

>Kwal_14.2409
          Length = 238

 Score =  165 bits (417), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 75/130 (57%), Positives = 92/130 (70%), Gaps = 1/130 (0%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           +L  HN+ R LH D PAL WS  L  +AQ YA+NY+C+GTL HSG PYGENLALG++  A
Sbjct: 107 MLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGFNTTA 165

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           A  AWY+E+  Y++  PGFS  TGHFTQ+VWKS+  +GC    CG  +G Y ICSYDP G
Sbjct: 166 AASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSYDPPG 225

Query: 286 NYEGEYADNV 295
           N  G+Y DNV
Sbjct: 226 NVAGQYQDNV 235

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  157 bits (396), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 74/130 (56%), Positives = 88/130 (67%), Gaps = 1/130 (0%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           VL  HN  R  H   P L W+ TL ++AQ YA+   C+G+L HSG P+GENLALGY   A
Sbjct: 75  VLDLHNDYRRRHHAVP-LRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGYSPAA 133

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           AV AWY+EI+ YDFS PGFS  TGHFTQ+VW+STT VGC    CG  +G Y+IC YDP G
Sbjct: 134 AVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQYDPPG 193

Query: 286 NYEGEYADNV 295
           N   +Y  NV
Sbjct: 194 NVADQYVANV 203

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  153 bits (386), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 94/130 (72%), Gaps = 1/130 (0%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225
           +L  HN  R  H+   +L W+  LAS AQ++A++Y C+G L HS  PYGENLALGY+  +
Sbjct: 80  ILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALGYNTTS 138

Query: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285
           AV AWYNE+  YDF+NP F++NTGHFTQ+VWK+T+++GC    CG  +G Y +C YDP G
Sbjct: 139 AVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCEYDPPG 198

Query: 286 NYEGEYADNV 295
           N  G++++NV
Sbjct: 199 NVIGKFSENV 208

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  112 bits (279), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 82/135 (60%), Gaps = 13/135 (9%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDY------ADNYDCSGTLTHSGGPYGENLAL 219
           VL  HN+ RA H+ T  L W++ LA+YA DY      +DN  C+  L HSGGPYGENLA 
Sbjct: 301 VLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENLAA 360

Query: 220 GY--DGPAAVDAWYNEISNYDFSN-PGFSSN---TGHFTQVVWKSTTQVGCGIKTCGGAW 273
           G   D  A V  WY+EI+ YD++N  G S N    GHFTQ+VW ++T VGC +  C    
Sbjct: 361 GTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSSG- 419

Query: 274 GDYVICSYDPAGNYE 288
             Y+IC Y PAGN +
Sbjct: 420 SVYLICEYSPAGNVK 434

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score = 99.0 bits (245), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 73/139 (52%), Gaps = 16/139 (11%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNY------DCSGTLTHSGGPYGENLAL 219
           ++  HN KR LH+DT  L W++ L+ +A  Y           C+  L HS GPYGEN+A 
Sbjct: 274 LVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYGENIAS 333

Query: 220 GYDGPAA-----VDAWYNEISNYDFSNPG----FSSNTGHFTQVVWKSTTQVGCGIKTCG 270
           G           V++WYNEI +YD+++           GHFTQ+VW  + +VGC +  C 
Sbjct: 334 GLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAVVYCS 393

Query: 271 -GAWGDYVICSYDPAGNYE 288
               G Y++C Y P GN E
Sbjct: 394 NNGKGIYILCEYHPVGNIE 412

>Kwal_33.13192
          Length = 799

 Score = 93.2 bits (230), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 79/140 (56%), Gaps = 19/140 (13%)

Query: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYD------CSGTLTHSGGP--YGENL 217
           +L EHN KR+LH +TP L W D L+++A +YA++        CSG L HS      GEN+
Sbjct: 635 ILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQGENI 694

Query: 218 ALGY--DGPAAVDAWYNEISNYDFSN-PGFSSN---TGHFTQVVWKSTTQVGCGIKTCG- 270
           A G   +    VD WY+EIS+YD+ +  G   N    GHFTQ+VW ST +VGC +  C  
Sbjct: 695 AFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQCDT 754

Query: 271 ----GAWGDYVICSYDPAGN 286
               G    Y++C Y  AGN
Sbjct: 755 MAKYGQNSIYLLCEYKDAGN 774

>KLLA0E03531g 327965..329188 similar to sgd|S0002873 Saccharomyces
           cerevisiae YDR465c RMT2 N-delta-arginine
           methyltransferase, start by similarity
          Length = 407

 Score = 29.3 bits (64), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 1/58 (1%)

Query: 187 DTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPAAVDAWYNEISNYDFSNPGF 244
           DT + + QD  D YD    L    G +     LG D P   D  Y +I   D +N G 
Sbjct: 315 DTFSEHYQDMLDLYDVIVGLLKPEGTFSFFNGLGADRPVCYDV-YRKIVELDVANYGM 371

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,819,273
Number of extensions: 215262
Number of successful extensions: 338
Number of sequences better than 10.0: 19
Number of HSP's gapped: 321
Number of HSP's successfully gapped: 20
Length of query: 295
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 194
Effective length of database: 13,099,691
Effective search space: 2541340054
Effective search space used: 2541340054
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)