Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
YJL078C (PRY3)88151013361e-171
YKR013W (PRY2)3291385792e-67
CAGL0G07667g2581385619e-66
Scas_675.272901385604e-65
YJL079C (PRY1)2991335518e-64
KLLA0D02442g3681375421e-61
Sklu_956.13191245274e-60
Scas_711.372671445208e-60
Kwal_14.24103731385192e-58
AAL179W3601394803e-53
CAGL0F05137g2271504456e-50
KLLA0D02420g2121474154e-46
AAL178W2051364111e-45
Kwal_14.24092381344113e-45
AFR700W4341632813e-26
KLLA0C01496g4561332726e-25
Kwal_33.131927991422375e-20
CAGL0J07040g124570800.25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YJL078C
         (866 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   519   e-171
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   227   2e-67
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   220   9e-66
Scas_675.27                                                           220   4e-65
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   216   8e-64
KLLA0D02442g complement(207613..208719) some similarities with s...   213   1e-61
Sklu_956.1 YJL079C, Contig c956 998-1957                              207   4e-60
Scas_711.37                                                           204   8e-60
Kwal_14.2410                                                          204   2e-58
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   189   3e-53
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   176   6e-50
KLLA0D02420g complement(206544..207182) some similarities with s...   164   4e-46
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   162   1e-45
Kwal_14.2409                                                          162   3e-45
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   112   3e-26
KLLA0C01496g complement(113533..114903) some similarities with s...   109   6e-25
Kwal_33.13192                                                          96   5e-20
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    35   0.25 

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  519 bits (1336), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 305/510 (59%), Positives = 305/510 (59%)

Query: 357 KFANXXXXXXXXXXXXXXXXXXXXXXDDIQGSTSKEATSSVSEHTSIVTSATNAAQYATX 416
           KFAN                      DDIQGSTSKEATSSVSEHTSIVTSATNAAQYAT 
Sbjct: 357 KFANTTVFSAQTTSSVSASLSSSVAADDIQGSTSKEATSSVSEHTSIVTSATNAAQYATR 416

Query: 417 XXXXXXXXXXXXXXXXXXXXXXXXXIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 476
                                    IA                                 
Sbjct: 417 LGSSSRSSSGAVSSSAVSQSVLNSVIAVNTDVSVTSVSSTAHTTKDTATTSVTASESITS 476

Query: 477 XXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXGHGVTYAAEYAITSEQSSALATSVPATNC 536
                     K                    GHGVTYAAEYAITSEQSSALATSVPATNC
Sbjct: 477 ETAQASSSTEKNISNSAATSSSIYSNSASVSGHGVTYAAEYAITSEQSSALATSVPATNC 536

Query: 537 SSIVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDPTLDPTDNSASPTDNA 596
           SSIVK                                     IDPTLDPTDNSASPTDNA
Sbjct: 537 SSIVKTTTLENSSTTTITAITKSTTTLATTANNSTRAATAVTIDPTLDPTDNSASPTDNA 596

Query: 597 KHXXXXXXXXXXXXLDSLRXXXXXXXXXXXXQLVSTCTSESDYSDSPSFAISTATTTESN 656
           KH            LDSLR            QLVSTCTSESDYSDSPSFAISTATTTESN
Sbjct: 597 KHTSTYGSSSTGASLDSLRTTTSISVSSNTTQLVSTCTSESDYSDSPSFAISTATTTESN 656

Query: 657 LITNTITASCSTDSNFPTSAASSTDETAFTRTISTSCSTLNGASTQTSELTTSPMKTNTV 716
           LITNTITASCSTDSNFPTSAASSTDETAFTRTISTSCSTLNGASTQTSELTTSPMKTNTV
Sbjct: 657 LITNTITASCSTDSNFPTSAASSTDETAFTRTISTSCSTLNGASTQTSELTTSPMKTNTV 716

Query: 717 VPASSFPSTTTTCLENDDTAFSSIYTEVNAATIINPGETSSLASDFATSEKPNEPTSVKX 776
           VPASSFPSTTTTCLENDDTAFSSIYTEVNAATIINPGETSSLASDFATSEKPNEPTSVK 
Sbjct: 717 VPASSFPSTTTTCLENDDTAFSSIYTEVNAATIINPGETSSLASDFATSEKPNEPTSVKS 776

Query: 777 XXXXXXXXXXXXXXXXXXXLYAKPSSTSLGAXXXXXXXXXXXXXQQDGSAMHQPTSSIYT 836
                              LYAKPSSTSLGA             QQDGSAMHQPTSSIYT
Sbjct: 777 TSNEGTSSTTTTYQQTVATLYAKPSSTSLGARTTTGSNGRSTTSQQDGSAMHQPTSSIYT 836

Query: 837 QLKEGTSTTAKLSAYEGAATPLSIFQCNSL 866
           QLKEGTSTTAKLSAYEGAATPLSIFQCNSL
Sbjct: 837 QLKEGTSTTAKLSAYEGAATPLSIFQCNSL 866

 Score =  386 bits (991), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 174/219 (79%)

Query: 1   MLEFPISVLLGCLVAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYA 60
           MLEFPISVLLGCLVAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYA
Sbjct: 1   MLEFPISVLLGCLVAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYA 60

Query: 61  DQYDCSGVLTHSDGPYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWK 120
           DQYDCSGVLTHSDGPYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWK
Sbjct: 61  DQYDCSGVLTHSDGPYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWK 120

Query: 121 STAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEPLXXXXXXXXXXXXXXXXXXX 180
           STAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEPL                   
Sbjct: 121 STAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEPLISTVSSSSSSSSSTSTTSD 180

Query: 181 XXXXXXXXXMPAVAQGYXXXXXXXXXXXXXXXXXINPAK 219
                    MPAVAQGY                 INPAK
Sbjct: 181 TVSTISSSIMPAVAQGYTTTVSSAASSSSLKSTTINPAK 219

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  227 bits (579), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 110/138 (79%)

Query: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83
           +F + ++NEHN  RALH DT  LTWSDTLATYAQNYAD YDCSG L HS GPYGENLALG
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250

Query: 84  YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143
           Y  TG+VDAWY EI+ Y+YSNPGFSES GHFTQVVWK T+E+GCG K CG  W +YI+CS
Sbjct: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310

Query: 144 YNPPGNYLGEFAEEVEPL 161
           Y   GN +GEFA+ V PL
Sbjct: 311 YKAAGNVIGEFADNVMPL 328

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  220 bits (561), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 110/138 (79%)

Query: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83
           +F   +LNEHN  RALH DT PLTWSD LA YAQNYA+ YDCSG L HS GPYGENLA+G
Sbjct: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIG 179

Query: 84  YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143
           Y+  G+VDAWY EI  YNY+NPGFSESTGHFTQVVWKS+ ++GC  K CG  W +Y++CS
Sbjct: 180 YSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICS 239

Query: 144 YNPPGNYLGEFAEEVEPL 161
           Y+P GN+LGEFA+ V PL
Sbjct: 240 YDPAGNFLGEFAQNVAPL 257

>Scas_675.27
          Length = 290

 Score =  220 bits (560), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 111/138 (80%), Gaps = 1/138 (0%)

Query: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84
           F S VLNEHN  RALH +T  L+WSD LA+YAQNYAD YDCSG L HS GPYGENLALGY
Sbjct: 152 FASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGENLALGY 211

Query: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYC-GTTWNNYIVCS 143
              G+VDAWY EIS Y+YSNPGFSE+ GHFTQVVWKS+ ++GCG K C  T W +Y++CS
Sbjct: 212 DAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWGSYVICS 271

Query: 144 YNPPGNYLGEFAEEVEPL 161
           YNP GN++GEFAE VEPL
Sbjct: 272 YNPAGNFIGEFAENVEPL 289

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  216 bits (551), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (81%)

Query: 29  VLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGYTDTG 88
           VL EHNK RALH DT  L+WSDTLA+YAQ+YAD YDCSG LTHS GPYGENLALGY    
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 89  AVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPG 148
           AVDAWY EIS Y++SNPGFS +TGHFTQVVWKST ++GCG K CG  W +Y++CSY+P G
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 149 NYLGEFAEEVEPL 161
           NY GE+A+ VEPL
Sbjct: 286 NYEGEYADNVEPL 298

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  213 bits (542), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 108/137 (78%)

Query: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84
           F S +L+EHN  RALH DT  L+WSD LA+YAQNYAD YDCSG LTHS GPYGENLA+GY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSY 144
             TGAVDAWY EI  Y++SNP +S STGHFTQVVWKST ++GCG K CG  W +YI+CSY
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 145 NPPGNYLGEFAEEVEPL 161
           +P GN LG FA  VEPL
Sbjct: 351 DPAGNMLGTFASNVEPL 367

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  207 bits (527), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 103/124 (83%)

Query: 22  FPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLA 81
             +F S +L+EHNK RALH DT+ LTWS+TLA YAQ YAD YDCSG LTHS GPYGENLA
Sbjct: 169 LSDFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENLA 228

Query: 82  LGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIV 141
           LGY+ TGAVDAWYGEIS Y++SNP +S STGHFTQVVWKST+E+GCG K C  +W +Y++
Sbjct: 229 LGYSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYVI 288

Query: 142 CSYN 145
           CSYN
Sbjct: 289 CSYN 292

>Scas_711.37
          Length = 267

 Score =  204 bits (520), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 90/144 (62%), Positives = 107/144 (74%), Gaps = 1/144 (0%)

Query: 19  QTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYAD-QYDCSGVLTHSDGPYG 77
           QT   +F+S +L EHNK RALH +T PLTWS+ LA YAQ YAD  Y+C G L HS GPYG
Sbjct: 122 QTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYG 181

Query: 78  ENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWN 137
           ENLA GYT  G+VDAWY EIS+Y+YSNPGFSESTGHFTQ+VWK T+++GC  K C   W 
Sbjct: 182 ENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWG 241

Query: 138 NYIVCSYNPPGNYLGEFAEEVEPL 161
            Y++CSYN  GN+ GE+   V PL
Sbjct: 242 TYLICSYNSAGNFDGEYEANVLPL 265

>Kwal_14.2410
          Length = 373

 Score =  204 bits (519), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 109/138 (78%)

Query: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83
           +F S +L  HN  R+LH DT+ L+WSD LA+YAQ+YAD+YDCSG L+HS GPYGENLA+G
Sbjct: 235 DFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAVG 294

Query: 84  YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143
           Y+ TG+VDAWYGEI  Y++SNP +S STGHFTQVVWK ++ +GCG K CG    +Y++CS
Sbjct: 295 YSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVICS 354

Query: 144 YNPPGNYLGEFAEEVEPL 161
           Y   GN+LGEFAE V+ L
Sbjct: 355 YKTAGNFLGEFAENVKGL 372

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  189 bits (480), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/139 (57%), Positives = 102/139 (73%), Gaps = 1/139 (0%)

Query: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83
           +FE ++L  HN  R LH DT PLTWS+ LA +A+++A+QYDCSG L HSD PYGENLA+G
Sbjct: 221 SFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVG 280

Query: 84  Y-TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVC 142
           Y T   AV AWY EIS Y+YS+P FS STGHF+Q+VWK T  +GC  K CG +  +Y++C
Sbjct: 281 YPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLIC 340

Query: 143 SYNPPGNYLGEFAEEVEPL 161
           SY+P GN+L  F E V P+
Sbjct: 341 SYDPAGNFLRRFGENVAPI 359

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  176 bits (445), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 79/150 (52%), Positives = 99/150 (66%), Gaps = 3/150 (2%)

Query: 15  AVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDG 74
           A K ++    ++  +L++HNK R LH DT  L W+D LA  AQ+YAD+YDCSG L H+  
Sbjct: 77  AQKKRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPE 136

Query: 75  ---PYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKY 131
                GENLA+GY D  A+DAWY EI  Y+YSNP     T HFTQ+VWK T  +GC YK 
Sbjct: 137 FIEAIGENLAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKT 196

Query: 132 CGTTWNNYIVCSYNPPGNYLGEFAEEVEPL 161
           CG    NYIVC Y+P GN+ GEFA+ V+PL
Sbjct: 197 CGGDLYNYIVCEYDPAGNWAGEFADNVKPL 226

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  164 bits (415), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 72/147 (48%), Positives = 102/147 (69%), Gaps = 1/147 (0%)

Query: 14  VAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSD 73
           V+ K   T P+F++++L+ HN  R  H   + L W+  LA+ AQN+A+ Y C+G L HS 
Sbjct: 65  VSTKPTATDPDFKTEILDVHNSLRKKH-QVSSLVWAPELASRAQNFANSYVCNGQLEHSK 123

Query: 74  GPYGENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCG 133
            PYGENLALGY  T AV AWY E+  Y+++NP F+ +TGHFTQ+VWK+T+++GC +  CG
Sbjct: 124 LPYGENLALGYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCG 183

Query: 134 TTWNNYIVCSYNPPGNYLGEFAEEVEP 160
             +  Y VC Y+PPGN +G+F+E V P
Sbjct: 184 QYYGQYTVCEYDPPGNVIGKFSENVLP 210

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  162 bits (411), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 93/136 (68%), Gaps = 1/136 (0%)

Query: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84
           F S VL+ HN +R  H    PL W+ TL T+AQ+YA++  C+G L HS  P+GENLALGY
Sbjct: 71  FASAVLDLHNDYRRRH-HAVPLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129

Query: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSY 144
           +   AV AWY EI++Y++S PGFS +TGHFTQ+VW+ST  +GC Y  CG  +  YI+C Y
Sbjct: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189

Query: 145 NPPGNYLGEFAEEVEP 160
           +PPGN   ++   V P
Sbjct: 190 DPPGNVADQYVANVLP 205

>Kwal_14.2409
          Length = 238

 Score =  162 bits (411), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 89/134 (66%), Gaps = 1/134 (0%)

Query: 25  FESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALGY 84
           F+S +L  HN+FR LH D   L WS  L  +AQ YA+ Y+C+G L HS  PYGENLALG+
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161

Query: 85  TDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSY 144
             T A  AWY E+  YNY  PGFSE TGHFTQ+VWKS+  +GC    CG  +  Y +CSY
Sbjct: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221

Query: 145 NPPGNYLGEFAEEV 158
           +PPGN  G++ + V
Sbjct: 222 DPPGNVAGQYQDNV 235

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  112 bits (281), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 87/163 (53%), Gaps = 25/163 (15%)

Query: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQY------DCSGVLTHSDGPYG 77
           N  S+++  HN  R LH DT PL W++ L+ +A +Y  +        C+ VL HS+GPYG
Sbjct: 269 NVASELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYG 328

Query: 78  ENLALGYTD-----TGAVDAWYGEISKYNYSN-PGF---SESTGHFTQVVWKSTAEIGCG 128
           EN+A G +      T  V++WY EI  Y+Y++  G     ++ GHFTQ+VW  + E+GC 
Sbjct: 329 ENIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCA 388

Query: 129 YKYCGTTWNN-YIVCSYNPPGN---------YLGEFAEEVEPL 161
             YC       YI+C Y+P GN             + E V+PL
Sbjct: 389 VVYCSNNGKGIYILCEYHPVGNIEDSTPGKDRYRLYKENVKPL 431

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  109 bits (272), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 80/133 (60%), Gaps = 13/133 (9%)

Query: 29  VLNEHNKFRALHVDTAPLTWSDTLATYAQNY------ADQYDCSGVLTHSDGPYGENLAL 82
           VLN HN++RA H  T PL W++ LA YA +Y      +D   C+  L HS GPYGENLA 
Sbjct: 301 VLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENLAA 360

Query: 83  GYTDTGA--VDAWYGEISKYNYSN-PGFSES---TGHFTQVVWKSTAEIGCGYKYCGTTW 136
           G     A  V  WY EI+ Y+Y+N  G S +    GHFTQ+VW ++ ++GC    C ++ 
Sbjct: 361 GTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKC-SSG 419

Query: 137 NNYIVCSYNPPGN 149
           + Y++C Y+P GN
Sbjct: 420 SVYLICEYSPAGN 432

>Kwal_33.13192
          Length = 799

 Score = 95.9 bits (237), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 73/142 (51%), Gaps = 19/142 (13%)

Query: 27  SDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYD------CSGVLTHS--DGPYGE 78
           S +L EHN  R+LH++T  L W D L+ +A NYA+         CSG L HS      GE
Sbjct: 633 SAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQGE 692

Query: 79  NLALGYTD--TGAVDAWYGEISKYNYSN-PGF---SESTGHFTQVVWKSTAEIGCGYKYC 132
           N+A G T      VD WY EIS Y+Y +  G     +  GHFTQ+VW ST ++GC    C
Sbjct: 693 NIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQC 752

Query: 133 GTTWNN-----YIVCSYNPPGN 149
            T         Y++C Y   GN
Sbjct: 753 DTMAKYGQNSIYLLCEYKDAGN 774

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 34/70 (48%), Gaps = 10/70 (14%)

Query: 642 SPSFAISTATTTESNLITNTITASCSTDSNFPTSAASSTDETAFTRTIS------TSCST 695
           SP+       T E +LI NTI +S   D NF       T ETA  + ++      T+C  
Sbjct: 518 SPTLLFLAIQTNEFDLI-NTILSSSRIDINF---QDEQTKETALYQAVAANLFEATACLL 573

Query: 696 LNGASTQTSE 705
           +NGAST+  E
Sbjct: 574 INGASTEIKE 583

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.121    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,001,249
Number of extensions: 508377
Number of successful extensions: 5535
Number of sequences better than 10.0: 343
Number of HSP's gapped: 3964
Number of HSP's successfully gapped: 1179
Length of query: 866
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 756
Effective length of database: 12,788,129
Effective search space: 9667825524
Effective search space used: 9667825524
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)